GenomeNet

Database: RefSeq
Entry: NC_009052
LinkDB: NC_009052
Original site: NC_009052 
LOCUS       NC_009052            5127376 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Shewanella baltica OS155, complete genome.
ACCESSION   NC_009052 NZ_AAIO01000000-NZ_AAIO01000199
VERSION     NC_009052.1  GI:126172257
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02598299
            Assembly: GCF_000015845.1
KEYWORDS    RefSeq.
SOURCE      Shewanella baltica OS155
  ORGANISM  Shewanella baltica OS155
            Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
            Shewanellaceae; Shewanella.
REFERENCE   1  (bases 1 to 5127376)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Sims,D.R., Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Mikhailova,N., Brettar,I., Klappenbach,J., Konstantinidis,K.,
            Rodrigues,J., Tiedje,J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of chromosome of Shewanella baltica OS155
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5127376)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Sims,D.R., Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Mikhailova,N., Brettar,I., Klappenbach,J., Konstantinidis,K.,
            Rodrigues,J., Tiedje,J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 3634605
            Source DNA and bacteria available from James Tiedje
            (tiedjej@msu.edu)
            Contacts: James Tiedje (tiedjej@msu.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/05/2014 15:31:55
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,736
            CDS                          :: 4,513
            Pseudo Genes                 :: 73
            rRNAs                        :: 31 ( 5S, 16S, 23S )
            tRNAs                        :: 117
            ncRNA                        :: 2
            Frameshifted Genes           :: 43
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5127376
                     /organism="Shewanella baltica OS155"
                     /mol_type="genomic DNA"
                     /strain="OS155"
                     /db_xref="taxon:325240"
     gene            41..1429
                     /gene="dnaA"
                     /locus_tag="SBAL_RS00005"
                     /old_locus_tag="Sbal_0001"
     CDS             41..1429
                     /gene="dnaA"
                     /locus_tag="SBAL_RS00005"
                     /old_locus_tag="Sbal_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A0KR35.1"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_006083826.1"
                     /db_xref="GI:492998674"
                     /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPN
                     RFVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSRPSAKKPSVPAPIAPTRVANTQ
                     TKATVGTTFNVQAEPMANANHRSNINPSYQFDNFVEGKSNQLGKAAALQVAENPGGAY
                     NPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFK
                     RYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDR
                     LKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGA
                     LNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSK
                     RRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIK
                     EDYANLIRTLSS"
     gene            1449..2549
                     /locus_tag="SBAL_RS00010"
                     /old_locus_tag="Sbal_0002"
     CDS             1449..2549
                     /locus_tag="SBAL_RS00010"
                     /old_locus_tag="Sbal_0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007652338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_006083825.1"
                     /db_xref="GI:492998673"
                     /translation="MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKL
                     TGTDLEVELVGQVVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSG
                     RSRFSLATLPAEEYPNVEAFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLF
                     ETEGNVLRAIATDGHRLALSHRTIEAQLPEKQVIVPRKGVMEMARLLESDDLDIAIAI
                     GDNAIRATTANTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRASILSNE
                     KFRGVRIQLENGLLKITANNPEQEEAEEIIDVEYNNQALEIGFNVSYLLDVLNNLKSD
                     DVRITLIDGNSSALIENHLEEDSMYVVMPMRL"
     gene            2751..3833
                     /gene="recF"
                     /locus_tag="SBAL_RS00015"
                     /old_locus_tag="Sbal_0003"
     CDS             2751..3833
                     /gene="recF"
                     /locus_tag="SBAL_RS00015"
                     /old_locus_tag="Sbal_0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CYH7.1"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RecF"
                     /protein_id="WP_011845334.1"
                     /db_xref="GI:500170909"
                     /translation="MSLTRLNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIY
                     FLGMGRSFRSHLSQRVINNDDDKLTLFATLNLARGDSKIGLRRFRSGETEVRIDGEKV
                     KRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHADPQFYGAWTNVRRVLKQ
                     RNQLLRNGSAYSNIQFWDQEFVRYAEQVTEIRNHYVDSLNELLKGIIGEFLPSVDVKV
                     SFTRGWDSKTDFAELLENQYSRDLATGHTVSGPHKADLRLRVGTLPAQDALSRGQLKL
                     LVCALRIAQGKLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLTDTGAQVFVTAIDP
                     AAIVDSLHTPPSRMFHVEQGRVTVIE"
     gene            3850..6267
                     /gene="gyrB"
                     /locus_tag="SBAL_RS00020"
                     /old_locus_tag="Sbal_0004"
     CDS             3850..6267
                     /gene="gyrB"
                     /locus_tag="SBAL_RS00020"
                     /old_locus_tag="Sbal_0004"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084772.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_011845335.1"
                     /db_xref="GI:500170910"
                     /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
                     VDNSIDEALAGHCSDITITIHVDGSVSVKDDGRGIPVSIHEEEGVSAAEVIMTVLHAG
                     GKFDDNSYKVSGGLHGVGVSVVNALSKKLQMTIRRAGKVYEQFYTHGVPDAPIKEIGD
                     ATKTGTEIRFWPSEDTFSDVEFHFEILAKRVRELSFLNSGVGIRLIDERDNKNEFFKY
                     EGGISAFVDYLNRNKTPVNKDVFHFMQEREDGITVEVAMQWNDGYQENIFCFTNNIPQ
                     RDGGTHLVGFRSALTRNLNSYMENEGYNKKGKTSATGDDAREGLTAVISVKVPDPKFS
                     SQTKDKLVSSEVKTAVEQTMGEKLNDYLLENPADAKLIVGKIVDAARAREAARKAREM
                     TRRKGALDLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGK
                     ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIR
                     TLLLTFFFRQMPELIERGYVYIAQPPLFKVKKGKQEQYLKDEPALTQYLTTQALDGTI
                     VYPTQGAIGMSGEPLERLVTQYREVEAIVARLEQRYPTHITNRMLYHPMITNDMLADE
                     GKMKEWIDAFIHELVEMESSGVLYSAEPILDPERKVYLPKITIRKHGIDTNYLFTYDF
                     FQSSDYQRIGKLGAALDGMIEEGGYVQRGERVKEVGSFLEALDWTISEAKRGLYIQRY
                     KGLGEMNPEQLWETTMDPESRRMLQVTIDDAVGADQLFTCLMGDQVEPRREFIEANAL
                     NVANLDV"
     gene            complement(6353..7015)
                     /locus_tag="SBAL_RS00025"
                     /old_locus_tag="Sbal_0005"
     CDS             complement(6353..7015)
                     /locus_tag="SBAL_RS00025"
                     /old_locus_tag="Sbal_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_011845336.1"
                     /db_xref="GI:500170911"
                     /translation="MDLYIGNKNYSSWSLRAWLMAAKSGVQFNEVLLQLDTDSFYQQL
                     KAISPTLKVPTLVDGNITVWDSLSICEYLNDTYLAGSAWPQDPKQKAKARSIASEMHS
                     GFNAVRNALPMNIRASRYVELTDAVRKDIERIDAIWSAQMAEFAPSHAEGTWLFGQWS
                     IADMMFAPVVMRFLTYGVEVSQASSAYMQHVISCPEMQAWMSAAKAETEIVAADEAGI
                     DR"
     gene            7256..7558
                     /locus_tag="SBAL_RS00030"
                     /old_locus_tag="Sbal_0006"
     CDS             7256..7558
                     /locus_tag="SBAL_RS00030"
                     /old_locus_tag="Sbal_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011845337.1"
                     /db_xref="GI:500170912"
                     /translation="MWLRVIYPASVLIFMLPAVVNADEANKLLNMCKACHGESGMSRF
                     EHIPNIGWQNSDYLLKQLRAFKTGNRQDPTMTKVAQLLSEADMQQMADYFYLGKDK"
     gene            7560..8786
                     /locus_tag="SBAL_RS00035"
                     /old_locus_tag="Sbal_0007"
     CDS             7560..8786
                     /locus_tag="SBAL_RS00035"
                     /old_locus_tag="Sbal_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin containing oxidoreductase"
                     /protein_id="WP_011845338.1"
                     /db_xref="GI:500170913"
                     /translation="MDLNRRVFIKGAVATSVLSALPVKWVFADQLPAAVTPLDISALT
                     WTKAEDLPSYFKVLNTHPLNAFPPEHKLAPAVTPADASFIRWNGIVPDFKALDAKTWT
                     FKVDGESVATPKTYTIDELKRRFKHYTLQLLIECGGNSRSGFFPSTKGNQWNNAGVFC
                     SEWTGVLVSDVLKDCGIKADAIYTGHHGVDRHLSGKGEAISRGVPIKAALEELGLIAW
                     SMNGEDIPYLHGYPLRIVFGGRPGSVSQKAATGISVRNKVHDGHKMEAPAYQLPKYPI
                     APGESVDNKDYRIIEEMIVKSLITEPQSGTELAVGQKMVIAGHAWAGLREVVKVEVSY
                     DYGTSWFTAELEKPKNVAAWQQWKIELQLPSQGYYEIWAKATDNQGDSQPVVQPQWNP
                     KGYMFNGCHRIVVRVV"
     gene            8786..9169
                     /locus_tag="SBAL_RS00040"
                     /old_locus_tag="Sbal_0008"
     CDS             8786..9169
                     /locus_tag="SBAL_RS00040"
                     /old_locus_tag="Sbal_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_006084776.1"
                     /db_xref="GI:493001300"
                     /translation="MRVLNKLFIFLGLVASSISLAAEYPVDPKSGLIMAPGWELVNYQ
                     CNACHTSMIVVQNHGDKAFWKETLQWMVDTQGLWDLSDTWEPTLSYLSTYYGQAEMDM
                     TLFRRLPLEPSLPPALVNSVSKETK"
     gene            9166..9501
                     /locus_tag="SBAL_RS00045"
                     /old_locus_tag="Sbal_0009"
     CDS             9166..9501
                     /locus_tag="SBAL_RS00045"
                     /old_locus_tag="Sbal_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011845339.1"
                     /db_xref="GI:500170914"
                     /translation="MKALIISLIALCGLSTEVFGEVYQADSERGQALATAQCESCHGN
                     AVIAMAKQFPNLKGQKFAYLNKQLVDFKAGLRLDPLMQAQVSALSSEQLQDVALFYSQ
                     QVTPNLSAN"
     gene            complement(9592..10512)
                     /locus_tag="SBAL_RS00050"
                     /old_locus_tag="Sbal_0010"
     CDS             complement(9592..10512)
                     /locus_tag="SBAL_RS00050"
                     /old_locus_tag="Sbal_0010"
                     /EC_number="6.3.4.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084778.1"
                     /db_xref="GI:493001307"
                     /translation="MIEVIKAGALTTVQDLGRMGYRHLGVTQAGALDRPALCLANRLL
                     SNPDNTPVLELTFGQSIFLFKRDAWIALTGADFDARIDNKPIVCGWRYSIKAGQKLSL
                     RGGNKGMRAYIAVDGGVKVPLVMNSAATDLTSGIGGFHGRALEAGDRLTLGSAHPLRR
                     QVGAIQKSWDGHIRALATKHTQAFSLKSQQTFWQTQWQLSAESDRASAILKGDTLTLA
                     KPFPVQSHTVTPGVVQVSASGQPLVLLADAQTTSSHPQIAVIIEADLWKLAQTRPGQT
                     VKFELVDDEQAATAQAEWHDYFYRLQRSLG"
     gene            10846..11886
                     /locus_tag="SBAL_RS00055"
                     /old_locus_tag="Sbal_0011"
     CDS             10846..11886
                     /locus_tag="SBAL_RS00055"
                     /old_locus_tag="Sbal_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006083816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011845340.1"
                     /db_xref="GI:500170915"
                     /translation="MIKSLFNKLFNIRDTATVERPKSFSTTDLGKSLEPARKPAKPLE
                     DISVVSVDLAALFYSLSFPTRVKDTGGVANNLERRVMAEIEQALASPQVIAEKVLKLP
                     SKVLELDRKLADPQFDIKDLLALIERDPLLSIEVLKLCNSPAFKRSDRDITSLQQALV
                     QLGREQLRKFVTTCLVREMLDIKPIYFRRFGAEIWRHSMQVAFLASELSDEDQDTAFL
                     LGLLHDVGKLAIFKMLLDAFVQAEPGEQPNSGLFRQVMTTKSLTLSSLLAKHWQLPNT
                     FETELDKLASVNSRPQAGLAAVIWRANVISEISMLHQAGQLSPEILANLLQQVNLDQT
                     QFDGLHQKLTQF"
     gene            complement(11974..14043)
                     /locus_tag="SBAL_RS00060"
                     /old_locus_tag="Sbal_0012"
     CDS             complement(11974..14043)
                     /locus_tag="SBAL_RS00060"
                     /old_locus_tag="Sbal_0012"
                     /EC_number="6.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit beta"
                     /protein_id="WP_011845341.1"
                     /db_xref="GI:500170916"
                     /translation="MNFENLLIELGTEELPPKSLRKLAESFLANLTEELTKADLAFSS
                     AVWYAAPRRLAINVTELALAQADKVVEKRGPAVSSAFDAEGKPTKAAEGWARGNGITV
                     EQAERLVTDKGEWLVHNAKVEGVETKNLIAAMAQRALDKLPIPKPMRWGNNKTQFIRP
                     VHTATMLLGSELIEGELLGIKSARTVRGHRFMGLKQFELAHADHYLTDLKEKGKVIAD
                     YESRKALIKADAEKAAAKIGGTADIEDSLLEEVASLVEWPVVLTASFEEKFLSVPSEA
                     LVYTMKGDQKYFPVFDDAGKLLPNFIFVTNIESKDPAQIISGNEKVVRPRLADAEFFF
                     NTDKKHTLESRLPSLETVLFQQQLGTLKDKVNRISALAAFIAEQTGANAVDAARAGLL
                     SKTDLMTNMVMEFTDTQGTMGMHYARLDGETEAVAVAMEEQYKPRFSGDTVPSAGVSC
                     AVALADKLDTLVGIFGIGQAPKGAADPFALRRAAIGVLRIIVENKLPLDLVDLITKAQ
                     ALHGTNLSNANASDEVLEFLMARFRAWYQDKGIGVDVILAVLARRPTRPADFDSRINA
                     VSHFRSLEASSALAAANKRVSNILAKVEGALPTTINASLLTEAAEQALAAKLNELQPL
                     LAPLFANADYQQALTLLAGLRESVDQFFEDVMVMADDEALKNNRLALLNNLREQFLHV
                     ADISLLQ"
     gene            complement(14054..14959)
                     /locus_tag="SBAL_RS00065"
                     /old_locus_tag="Sbal_0013"
     CDS             complement(14054..14959)
                     /locus_tag="SBAL_RS00065"
                     /old_locus_tag="Sbal_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WH93.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="WP_006083814.1"
                     /db_xref="GI:492998662"
                     /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQ
                     TFLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGS
                     LQALGIDTQIHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPV
                     TGEITYGLERLAMYIQGVDSVYDLVWTDGPLGRITYGDVFHQNEVEQSTYNFEHADVD
                     FMFTLFDQCEKMCQHLLSLEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILR
                     VRTMAKAVAESYYQAREALGFPMCK"
     gene            15077..15691
                     /locus_tag="SBAL_RS00070"
                     /old_locus_tag="Sbal_0014"
     CDS             15077..15691
                     /locus_tag="SBAL_RS00070"
                     /old_locus_tag="Sbal_0014"
                     /EC_number="3.2.2.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="WP_011845342.1"
                     /db_xref="GI:500170917"
                     /translation="MEEIRCGWVSDDPLYREYHDKVWGRPVYDPKELFAKLCLDGQQA
                     GLSWITILKKQQNYEQAFANFEPEVIAGFDEAKVEELMLNPGIVRNRLKVNSIIKNAK
                     GYLVYTADGKDFSAFLWSFVGGKPIVNQFTAMSQVPAQTPESEAMSKALKKLGFNFVG
                     STICYAFMQAVGMVNDHLVECISYQACVDSCAGQHHREHQYSSC"
     gene            complement(15877..19064)
                     /locus_tag="SBAL_RS00075"
                     /note="amidohydrolase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(19327..19773)
                     /locus_tag="SBAL_RS00080"
                     /old_locus_tag="Sbal_0017"
     CDS             complement(19327..19773)
                     /locus_tag="SBAL_RS00080"
                     /old_locus_tag="Sbal_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosysynthesis protein"
                     /protein_id="WP_011845345.1"
                     /db_xref="GI:500170920"
                     /translation="MPKLLAIAYKTVKRGPMNEVLCANVTQLSGVEKDVFGRPGKRQV
                     TVLSKIQWQQACHSIEADLPWTTRRANLLVDDLVFSSADVGKHLQIGELRLEITGETD
                     PCKKMEIAHVGLETALTPDWRGGVTCRVLNDAMIHLGDEITLVNPS"
     gene            complement(19822..20067)
                     /locus_tag="SBAL_RS00085"
                     /old_locus_tag="Sbal_0018"
     CDS             complement(19822..20067)
                     /locus_tag="SBAL_RS00085"
                     /old_locus_tag="Sbal_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4Y1B4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sulfurtransferase TusA homolog"
                     /protein_id="WP_006083810.1"
                     /db_xref="GI:492998658"
                     /translation="MNDAFSTAQHRLDALGLRCPEPVMMVRKTVRQMAAGETLLIIAD
                     DPATTRDIPSFCEFMDHTLIASETTQTPYQYLIKKGL"
     gene            complement(20238..21400)
                     /locus_tag="SBAL_RS00090"
                     /note="diguanylate cyclase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(21644..22807)
                     /gene="fadA"
                     /locus_tag="SBAL_RS00095"
                     /old_locus_tag="Sbal_0020"
     CDS             complement(21644..22807)
                     /gene="fadA"
                     /locus_tag="SBAL_RS00095"
                     /old_locus_tag="Sbal_0020"
                     /EC_number="2.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8EKS0.1"
                     /note="FadA; fatty acid oxidation complex component beta;
                     functions in a heterotetramer with FadB; similar to
                     FadI2J2 complex; functions in beta-oxidation of fatty
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="WP_011845346.1"
                     /db_xref="GI:500170921"
                     /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKGLLLRNPQ
                     LDPNLIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDAIHQAA
                     RAIMTGMGDTFIIGGVEHMGHVPMSHGVDFHPGLANKVAKASGMMGLTAEMLGKLHGI
                     TREQQDAFAVRSHQRAYAATVEGRFAKEIYGIEGHDANGALIKVLQDEVIRPETTMES
                     LAALRPVFDPVNGTVTAGTSSALSDGASAMLIMEESKARALGLPIRARIRSMAVAGCD
                     AAIMGYGPVPATQKALARAGITVADLDVIELNEAFAAQSLPCVKDLGLADVVDDKINL
                     NGGAIALGHPLGCSGARISTTLINLMEDKDATLGLATMCIGLGQGIATVFERV"
     gene            complement(22830..24980)
                     /gene="fadB"
                     /locus_tag="SBAL_RS00100"
                     /old_locus_tag="Sbal_0021"
     CDS             complement(22830..24980)
                     /gene="fadB"
                     /locus_tag="SBAL_RS00100"
                     /old_locus_tag="Sbal_0021"
                     /EC_number="1.1.1.35"
                     /EC_number="4.2.1.17"
                     /EC_number="5.1.2.3"
                     /EC_number="5.3.3.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609503.1"
                     /note="includes enoyl-CoA hydratase,
                     delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase,
                     3-hydroxyacyl-CoA dehydrogenase, and 3-hydroxybutyryl-CoA
                     epimerase; catalyzes the formation of an hydroxyacyl-CoA
                     by addition of water on enoyl-CoA; also exhibits
                     3-hydroxyacyl-CoA epimerase and 3-hydroxyacyl-CoA
                     dehydrogenase activities; forms a heterotetramer with
                     FadA; similar to FadI2J2 complex; functions in
                     beta-oxidation of fatty acids; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid oxidation complex subunit alpha"
                     /protein_id="WP_011845347.1"
                     /db_xref="GI:500170922"
                     /translation="MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLTSLDAALD
                     SIKQDSNIKALVLTSSKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLP
                     FPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGA
                     DNALEWITTGKDQRAEDALKVGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRK
                     LSALTLPKLEAMMSFTTAKGMVFAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQA
                     FIKLAKTDVAKALIGIFLNDQFVKGKAKKAGKLAKEVNNAAVLGAGIMGGGIAYQSAS
                     KGTPIVMKDIAQPALDLGLNEAAKLLSAQVARGRSTPEKMAKVLNNITPSLDYAAIKH
                     SDVVVEAVVEHPKIKAQVLAEVEGYVSEDAIIASNTSTISINLLAKSMKKPERFCGMH
                     FFNPVHKMPLVEIIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFA
                     GFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGK
                     SGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKPKKDVDPTSYGLLKDAFGELKAFEA
                     DDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVYGLGFPPFRGGVFRYLDTMGVAN
                     FVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA"
     gene            25471..26793
                     /locus_tag="SBAL_RS00105"
                     /old_locus_tag="Sbal_0022"
     CDS             25471..26793
                     /locus_tag="SBAL_RS00105"
                     /old_locus_tag="Sbal_0022"
                     /EC_number="3.4.13.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WHA1.1"
                     /note="catalyzes the hydrolysis of dipeptides with a
                     proline at the C-terminal; also catalyzes the low
                     efficiency hydrolysis of organophosphate di- and
                     tri-esters; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="WP_011845348.1"
                     /db_xref="GI:500170923"
                     /translation="MDQLAHHYRAHIAELNRRVAEILSREALSGLVIHSGQPHRMFLD
                     DINYPFKANPHFKAWLPVLDNPNCWLVVNGRDKPQLIFYRPVDFWHKVSDVPDMFWTE
                     YFDIKLLTKADKVAEFLPTDIANWAYLGEHLDVAEVLGFTSRNPDAVMSYLHYHRTTK
                     TEYELECMRRANQIAVQGHLAAKNAFYNGASEFEIQQHYLSAVGQSENEVPYGNIIAL
                     NQNAAILHYTALEHQSPAKRLSFLIDAGASYFGYASDITRTYAFEKNRFDELITAMNK
                     AQLELIDMMRPGVRYPDLHLATHAKVAQMLLDFDLATGDVQGLVDQGITSAFFPHGLG
                     HMLGLQVHDVGGFSHDERGTHIAAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNE
                     LKQDNRGQQINWQTVDELRPFGGIRIEDNVIVHQDRNENMTRKLGLTD"
     gene            26821..27435
                     /locus_tag="SBAL_RS00110"
                     /old_locus_tag="Sbal_0023"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            27513..28970
                     /locus_tag="SBAL_RS00115"
                     /old_locus_tag="Sbal_0024"
     CDS             27513..28970
                     /locus_tag="SBAL_RS00115"
                     /old_locus_tag="Sbal_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_006083804.1"
                     /db_xref="GI:492998652"
                     /translation="MQYKTIIRIIGLLIGLFSITMLPPALIAVWYNDGGGTAFMQAFF
                     VSLFIGFWLWYPNRHCKEELRTREGFLIVVLFWTVLGSIGALPFIFSSQPDLSWTDSF
                     FESFSALTTTGATVIVGLDFLPKAILFYRHMLQWLGGMGIIVLAVAILPVLGVGGMQL
                     YRAEIPGPVKDSKMTPRIAETAKALWYIYLLLTISCATAYWLAGMSVFDAVCHSFSTI
                     AIGGFSTHDASMGYFDSSVINLICVFFLIVSAVNFSVHFAAFSRRGINVRVYFKDAEF
                     KMLVAIQLILTAICFLTLYHSGIYDSPEETLDHALFQAVSVATTAGFGTESFHMWPLF
                     LPILLIFSSFIGGCGGSTAGGIKVIRVILLLLQGSRELKRLVHPKAMFSIRIGSKALP
                     DRVVDAVWGFFSAYALVFVICMLALMAMGLDDITAFSATAACLNNLGPGLGAVASNYA
                     SIGDGAKWVLVAAMLFGRLEVFTLLILFTPTFWKN"
     gene            28973..29497
                     /locus_tag="SBAL_RS00120"
                     /old_locus_tag="Sbal_0025"
     CDS             28973..29497
                     /locus_tag="SBAL_RS00120"
                     /old_locus_tag="Sbal_0025"
                     /EC_number="1.3.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006083803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_011845350.1"
                     /db_xref="GI:500170925"
                     /translation="MQTLIIYSTIDGQTLAICQKMKTIAEQAGEQVALVTLEQADALS
                     LADFDKVLIGASIRYGKHRPELYQFVNRHHAVLDTKINGFFTVNVVARKPLKNTPETN
                     PYMQKFLQLSLWQPQLLEVFAGKIDYPKYGFFDRTMIRFIMWMTKGPTDITGTFEFTD
                     WEKVDAFGNRFSQH"
     gene            complement(29560..29868)
                     /locus_tag="SBAL_RS00125"
                     /old_locus_tag="Sbal_0026"
     CDS             complement(29560..29868)
                     /locus_tag="SBAL_RS00125"
                     /old_locus_tag="Sbal_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011715321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_006083802.1"
                     /db_xref="GI:492998650"
                     /translation="MQNDIDVAAMVTNAESAAKWLKAIANPYRLMILCLLLDKELSVT
                     ELNATVPLSQSALSQHLAVLRAEDLVDTRKSSQIVYYKLKNEQVTQVISILHSRYCAV
                     "
     gene            30069..30620
                     /gene="hemG"
                     /locus_tag="SBAL_RS00130"
                     /old_locus_tag="Sbal_0027"
     CDS             30069..30620
                     /gene="hemG"
                     /locus_tag="SBAL_RS00130"
                     /old_locus_tag="Sbal_0027"
                     /EC_number="1.3.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196468.1"
                     /note="catalyzes the oxidation of protoporphyrinogen IX to
                     form protoporphyrin IX; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_011845351.1"
                     /db_xref="GI:500170926"
                     /translation="MTRVLVLYFTRGGHTAKIANAIADQLTFRGAKVDLVDINSAAAT
                     CINWPDYEVVALGACVLYGTYDKSVFKFIEQHAEALGALPNSFFCVNVVARNPEKRIP
                     ENNKYLQKFIALSPWTPADLKIIAGKVDYPSWPWYDRLMIQLIMKMTKGPTDPKSVID
                     YTDWADVKVYADHLLELVDVTAI"
     gene            complement(30655..32097)
                     /locus_tag="SBAL_RS00135"
                     /old_locus_tag="Sbal_0028"
     CDS             complement(30655..32097)
                     /locus_tag="SBAL_RS00135"
                     /old_locus_tag="Sbal_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011918268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkH"
                     /protein_id="WP_006084792.1"
                     /db_xref="GI:493001351"
                     /translation="MLNFRPLLFILGLFLSMLTAFMLIPLLLAVFNAEETVGSFMLSA
                     LVTGISASLCLHNGQSKTINLNIRDMFLLTSLTWLIVSLFAAMPFTLYHGIGYTDAFF
                     ETMSGITTTGSTVLSGLDTMDHSILIWRSLLQWLGGIGFIVMAVAILPFLNVGGMRLF
                     RTESSDWSDKAVPRTQSMAKYLFFIYILLTVACCVAYHLAGMTWFQAINHAMTTLSTG
                     GYSTSDSSMAAFSHSAHWVGVFFMAAGGLPLLMFVHTIQQRDLRIWNDAQVKGFLFFL
                     TFVSCSIGFWLWQTRDIELLDALRLSSFNVVSVVTTTGYGLTDYGAWGAFANIAFMFL
                     MFVGSCSGSTSGGIKIFRFQIAGAIMREQLKQQCHPNGIFRERYNNRIISEDIVRSLI
                     TFVLLFVMVIVGLSVILVLTGLDPMTSFTGAITAVTNVGPGLGPIIGPAGNFSTLPDV
                     AKWALSLGMLLGRLEILTVAVLFHPSFWKY"
     gene            complement(32118..33527)
                     /gene="trkA"
                     /locus_tag="SBAL_RS00140"
                     /old_locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
     CDS             complement(32118..33527)
                     /gene="trkA"
                     /locus_tag="SBAL_RS00140"
                     /old_locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011494487.1"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="WP_006083799.1"
                     /db_xref="GI:492998647"
                     /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDHDKSRLRALQDKYD
                     LRVVAGHAAHPDVLREAGAEDADMLIAVTNSDECNMAACQIAYTLFGTPTKIARIRSE
                     PYLAMRDKLFIDSETKNSDGRPRGGFVIDELIAPEQLVTAYIQRLVEYPGALQVLEFA
                     EGRLSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADD
                     EVFFVADSRHIRAVMSEMQKLDNSYRNIMIAGGGNIGLGLAKRLERTHSVKLIEHKYE
                     RAEALSEQLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMSALLAKRMGA
                     KKVMVLIQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAI
                     EAIAHGDASTSKVVGKAIGDIKLPPGTTIGAIVRNDEVLMAHDKTVIEQGDHVILFLV
                     NKKFVGEVEKLFQPSAFFF"
     gene            complement(33543..34829)
                     /locus_tag="SBAL_RS00145"
                     /old_locus_tag="Sbal_0030"
     CDS             complement(33543..34829)
                     /locus_tag="SBAL_RS00145"
                     /old_locus_tag="Sbal_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845352.1"
                     /note="catalyzes the methylation of cytosine at position
                     967 (m5C967) of 16S rRNA; SAM-dependent methyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011845352.1"
                     /db_xref="GI:500170927"
                     /translation="MNLRALAAKAIFEVLEKGVSLSVALPDQQKHLASGKDKALLAEL
                     CYGVMRTLPQIEKRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAEA
                     CRQLKFEGMVKVVNGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDII
                     QQSHERPPMWLRNNRLSQSRAEYLAALAELEIEASEGSSADAILLAHPKDVATLPRFH
                     EGAASVQDGAAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKR
                     LERVQQNLDRLSLKAELIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWL
                     RKNHDIEELAELQQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLERTADAKL
                     DTLSQQNSPQDIGWQITPGQDNMDGFYYARLLKATD"
     gene            complement(34831..35787)
                     /gene="fmt"
                     /locus_tag="SBAL_RS00150"
                     /old_locus_tag="Sbal_0031"
     CDS             complement(34831..35787)
                     /gene="fmt"
                     /locus_tag="SBAL_RS00150"
                     /old_locus_tag="Sbal_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006083797.1"
                     /note="modifies the free amino group of the aminoacyl
                     moiety of methionyl-tRNA(fMet) which is important in
                     translation initiation; inactivation of this gene in
                     Escherichia coli severely impairs growth; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_011845353.1"
                     /db_xref="GI:500170928"
                     /translation="MKPLNIIFAGTPDFAARHLQALLNSHHNVIGVYTQPDRPAGRGK
                     KLTASPVKELAVANNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTP
                     RLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTTLPIED
                     SDTSASLYEKLAEQGPVALLQALEGLANGTLAAEKQDEALANYAEKLSKEEARLDWNK
                     SAQQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSETTSTAAPGTIISASKKGIEVAT
                     ADGVLTLLNMQLPGKKPLNVADILNARGEWFSPNTRLANEAQ"
     gene            complement(35796..36308)
                     /locus_tag="SBAL_RS00155"
                     /old_locus_tag="Sbal_0032"
     CDS             complement(35796..36308)
                     /locus_tag="SBAL_RS00155"
                     /old_locus_tag="Sbal_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_006084795.1"
                     /db_xref="GI:493001360"
                     /translation="MAQLKVLQFPDERLRTQATPITEFNAELQTQIDDMFETMYQEKG
                     IGLAATQVDYHKQLIVMDLQDEVERPKVFINPEIIASSGDFCNEEGCLSVPGIYAKVD
                     RAEFVTVKALDRHGNEFIVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLE
                     KAARLDAKEA"
     gene            36434..37564
                     /locus_tag="SBAL_RS00160"
                     /old_locus_tag="Sbal_0033"
     CDS             36434..37564
                     /locus_tag="SBAL_RS00160"
                     /old_locus_tag="Sbal_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_011845354.1"
                     /db_xref="GI:500170929"
                     /translation="MEIPMKRLILLALMTFNCTFVAADTLTLKAGHPESYVVKKGDTL
                     WDISAAFLNDPWKWPRLWDVNPQIANPHLIYPGDQLTLVFVDGQPRLVRNGDMVDSAK
                     PHVKKSPEGRIIAKSNAIPAVDLALIEHYLVQNRVVATDWLAEQPMVLAGESPSRHHI
                     VGDVIYIDAELPMNQKYGVYERGREFFNKASGEAIGQEAILASTGQVVESGKVSKIKL
                     LTSFRETKAGFRVMPMESDSLMSAYFTPKPAELKTPAVVLAIESKMREAGKLDVVYLD
                     KGTQDGVEPGVVFSIYRDGEVIVINNDGMPVPATERTAYDNLMASVSSDRAIQMPDIY
                     HGKLLVFKVFDKASLGLIVSTERPVRVDDKLIAPESLALRGQ"
     gene            37648..38664
                     /locus_tag="SBAL_RS00165"
                     /old_locus_tag="Sbal_0034"
     CDS             37648..38664
                     /locus_tag="SBAL_RS00165"
                     /old_locus_tag="Sbal_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_011845355.1"
                     /db_xref="GI:500170930"
                     /translation="MEVDDLRQRLEHEREALPLSDHLLHSLAIDYQKVDVALEWQQQA
                     ADHHLVCFSDPLYPPLLKQLSDPPAVLFVKGCLEALALPYLAIVGSRNASPGGLQVAY
                     QLAVEMCSMGFGICSGMAMGIDGAAHKACVEHQGRTVAVLGTGIETVYPRKHRQLYHD
                     IQQQGCILSEFWPDVGPFAGNFPKRNRIISGLSLGTLVVEACRKSGSLITARLAMEQG
                     REVFAVPGSILGGYHQGCHDLLRDGAKLVETAADIVEELASLTAYHLEELKLCHHIQQ
                     GEICNLPFSSLLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVR
                     VKRS"
     gene            38667..39140
                     /locus_tag="SBAL_RS00170"
                     /old_locus_tag="Sbal_0035"
     CDS             38667..39140
                     /locus_tag="SBAL_RS00170"
                     /old_locus_tag="Sbal_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0I0R9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein Smg"
                     /protein_id="WP_006083793.1"
                     /db_xref="GI:492998641"
                     /translation="MFDILMYLFENYVHSEVELLVDEDELTKELTRAGFHQSEILKAL
                     TWLERLAELQEGDKPYLCNHDQHSFRIYTKDEMDKLDVESRGFLLFLEQVKVLNVETR
                     EMVIDRVMELDEPTLILEDLKWVILMVLFNAPGHESAYEQMEDLIFEQPEGRLHS"
     gene            39260..39823
                     /locus_tag="SBAL_RS00175"
                     /old_locus_tag="Sbal_0036"
     CDS             39260..39823
                     /locus_tag="SBAL_RS00175"
                     /old_locus_tag="Sbal_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006083792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase"
                     /protein_id="WP_012586346.1"
                     /db_xref="GI:501582027"
                     /translation="MSKIDEQLFSAHEHALEKEYELCPECGSELSVKHSKHGGFIGCN
                     NYPSCNYTRPLVQHESIETQVIEGSVCPECGHELAVKSGRFGIFIGCTQYPSCTHIEK
                     QDQASDKPDIPCPECKTGKLEHRTSRFGKSFYACSAYPKCKFIVNYPPVAEACPSCGF
                     GILVERKGAAGMRLECPQKTCKYKRPL"
     gene            39950..40516
                     /locus_tag="SBAL_RS00180"
                     /old_locus_tag="Sbal_0037"
     CDS             39950..40516
                     /locus_tag="SBAL_RS00180"
                     /old_locus_tag="Sbal_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_011845357.1"
                     /db_xref="GI:500170932"
                     /translation="MLQLHPSDIKDIILQGGVIAYPTEAVYGLGCDPDNDTAIQKLLA
                     VKQRPWQKGLILVASDFQQLLAYVDESQLTAEQLEFAFSKWPGPFTFVMPIKAHVSKY
                     LCGEFDSIAVRVSAHAGVQALCRALNKPLVSTSANLAGEDPALTAAEILADFTGKIDA
                     LVLGELGEQRQPSTIIDARSGKILRNGQ"
     gene            40542..41450
                     /locus_tag="SBAL_RS00185"
                     /old_locus_tag="Sbal_0038"
     CDS             40542..41450
                     /locus_tag="SBAL_RS00185"
                     /old_locus_tag="Sbal_0038"
                     /EC_number="1.3.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_011845358.1"
                     /db_xref="GI:500170933"
                     /translation="MSVPDAAVVKAFLLDLQNRICAGLQALDGQARFAADSWTRAEGG
                     GGTSRVLTQGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNP
                     YIPTTHANVRFFIAQKEGADPVWWFGGGFDLTPYYPFEEDVREWHQTSKDICAPFGDE
                     VYPKYKKWCDEYFFLPHRNETRGVGGLFFDDLNQAGFEQSFSFMQAVGNGFLTAYAPI
                     VERRKDTEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW
                     QYAYTPEAGSPEADLYDNYLKPRDWV"
     gene            complement(41485..41922)
                     /locus_tag="SBAL_RS00190"
                     /old_locus_tag="Sbal_0039"
     CDS             complement(41485..41922)
                     /locus_tag="SBAL_RS00190"
                     /old_locus_tag="Sbal_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="globin"
                     /protein_id="WP_006083789.1"
                     /db_xref="GI:492998637"
                     /translation="MNWLKKIFSKHTPPQDDRDPSQSNAYDLIGGEKVIRAITKCFYQ
                     KMASSAETTTLLAIHRAPIAESEQKLFEFLSGWLGGPQLYQQKYGHPALRARHMHVDI
                     DEAMRDQWLFCMKFAIEENIKKPEHRAAIFEAISTLADHMRNQ"
     gene            42076..42924
                     /locus_tag="SBAL_RS00195"
                     /old_locus_tag="Sbal_0040"
     CDS             42076..42924
                     /locus_tag="SBAL_RS00195"
                     /old_locus_tag="Sbal_0040"
                     /EC_number="1.1.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase (NADP+)"
                     /protein_id="WP_011845359.1"
                     /db_xref="GI:500170934"
                     /translation="MTDRYAVFGNPISHSKSPFIHGQFAAPTQESLTYEAILAPVDGF
                     EASLTAFFNAGGKGANVTVPFKEQAFALCDSISPEAKLAGAVNTLSLLADGTIRGDNT
                     DGLGLVADLIANLGSLQDKRVLLIGAGGAARGCILPLLNAGIAQLIISNRTHTKAQLL
                     VDIFTSVDNGAFANRVTAVEMNELAGEFDIIINSTSASLVGELPPLPTHIITTQTVCY
                     DMMYGASVTAFNQWALSQGAAKVIDGLGMLVGQAAKSFTLWRGIEPDTQVVLTLLRDK
                     LMAEPK"
     gene            42930..43205
                     /locus_tag="SBAL_RS00200"
                     /old_locus_tag="Sbal_0041"
     CDS             42930..43205
                     /locus_tag="SBAL_RS00200"
                     /old_locus_tag="Sbal_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845360.1"
                     /db_xref="GI:500170935"
                     /translation="MNQSILFPDLQYWDDAQGQICFMAQSQGMNIKCYISAAKLRELN
                     DFSEQPSTDEAAAMLALFDAVRFDAEEMAEELIEAEEFDEFGAVRLG"
     gene            complement(43325..43873)
                     /locus_tag="SBAL_RS00205"
                     /old_locus_tag="Sbal_0042"
     CDS             complement(43325..43873)
                     /locus_tag="SBAL_RS00205"
                     /old_locus_tag="Sbal_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006083786.1"
                     /db_xref="GI:492998634"
                     /translation="MSGPLRTYQGIHPQLGNNVYVDEASVLVGDIALDTDASIWPMVA
                     ARGDVNHIRIGKRSNVQDGSILHVTRKSAARPDGHPLIIGDDVTIGHKAMLHGCKVGN
                     RVLVGMGAIILDGAILEDDVILGAGSLVPPGKVLQSGYLYVGSPAKQARPLTPAEMAF
                     LPESADNYVRLKNEYLVELQNI"
     gene            44432..45977
                     /locus_tag="SBAL_RS00210"
                     /old_locus_tag="Sbal_R0001"
     rRNA            44432..45977
                     /locus_tag="SBAL_RS00210"
                     /old_locus_tag="Sbal_R0001"
                     /product="16S ribosomal RNA"
     gene            46338..49265
                     /locus_tag="SBAL_RS00215"
                     /old_locus_tag="Sbal_R0002"
     rRNA            46338..49265
                     /locus_tag="SBAL_RS00215"
                     /old_locus_tag="Sbal_R0002"
                     /product="23S ribosomal RNA"
     gene            49386..49501
                     /locus_tag="SBAL_RS00220"
                     /old_locus_tag="Sbal_R0003"
     rRNA            49386..49501
                     /locus_tag="SBAL_RS00220"
                     /old_locus_tag="Sbal_R0003"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            49791..52241
                     /locus_tag="SBAL_RS00225"
                     /old_locus_tag="Sbal_0043"
     CDS             49791..52241
                     /locus_tag="SBAL_RS00225"
                     /old_locus_tag="Sbal_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011845361.1"
                     /db_xref="GI:500170936"
                     /translation="MLRKLSLAVLLPLCMLTLYLVLVIGEYLFESDQVRAELAQRQST
                     LIKQQLFRMQNVVQSAQALQDVERIEQEVSLAALDMGTMVYILVDADSRIRFANHTVW
                     RDSNAMQVIDGYDATRDRAVVQAFLPQILVNLERLTIQAYYPVLPQYGGAVDLIYLEA
                     DLAPLVAEASAKLQQRFMRVWGLGGLLLIGFTFILYFLLIRPFQILSEAAKQVGTSSF
                     STSIPWSSSEVLSLQASLQQVHERLSRAVKQLNDSELRWLFAVEGSRNGIWDWDISTG
                     EVFLSDRWKEMIGYAPDELAGVFQTWEARLHPDDRDIVLDALQEYVSGKSKEFESVHR
                     LRHREGHYVWVLDRGMLVDWDPQGRPTRMIGIHMDVSESAKNHAAINELVDQSVTGRK
                     MLPDVFMARLSQFLTQGNSSGQWGSLLLVEVDRLGLVATLNSHELERLLTQVAARLSS
                     YFTENITVGRLESGDFVLLAKDLAIDASVAARRALALASELRQVIARPFHYGHHHFEL
                     SANVGICLLDSIETLDPALVMRRAELATLSAKRPGQAGCAFYHAEMDLRQSRDEQLQQ
                     ELQTALQQDSMTLMFQPVMNAHSELVSAEVLTRWYRTDGEFIPPAEFVALAEQGGMIA
                     ELDFWVANRVCQFIQTSHAQGWSLPTLTLNISAFSFGQADFVDALIALVKEHGIAPHQ
                     LGIELNEAALLMQPQFVAERVSKLVDAGIGIVLDHFGSGSSALSCLANQPLVAVKLDM
                     SCIDSLAAMPQRVKALIVSAQQFNLHVVAKGVESPQHYQAFVEFGCDGYQGYLFSRAL
                     NQADFIQLVCPRPLLRSV"
     gene            complement(52198..53181)
                     /locus_tag="SBAL_RS00230"
                     /old_locus_tag="Sbal_0044"
     CDS             complement(52198..53181)
                     /locus_tag="SBAL_RS00230"
                     /old_locus_tag="Sbal_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011845362.1"
                     /db_xref="GI:500170937"
                     /translation="MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMV
                     KHPQAHTAIVLSSGRVESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGH
                     VRRFNDYIDDFALFMQKKVLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAP
                     MYGIKLPMPKAFVRWLASKLDTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAY
                     RDLYDAAPKLQLGSPTNRWLTESLDAADTCVLATAQIRTPILILQASEDKIVDNAAQN
                     LAVSTHCQLKVIAGAAHEIFMEKDAYRNQALNYALDFFKRFAIKDEDKQAG"
     gene            complement(53277..55088)
                     /locus_tag="SBAL_RS00235"
                     /old_locus_tag="Sbal_0045"
     CDS             complement(53277..55088)
                     /locus_tag="SBAL_RS00235"
                     /old_locus_tag="Sbal_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845363.1"
                     /db_xref="GI:500170938"
                     /translation="MHKLLTPSLLICALSACSATQITKNSQTAAPQAISTAQSQVEPI
                     APALQAIIDQSWQLQLSASPEMAYSMGDASAAGKLSDLSPAALAKLNQGQIAVLAQLK
                     ALDRSSLSKEDKINAQILEDQIQNDVDLYRFKDYYLPITAESGFHAYITSIAQGRFNT
                     LEDYRNYIAKLNALPTYFAQQTHWLKQGLAEGITPPKVTLNGFEDSISAYIVPVEKSG
                     YFKPFTQYPSYFTEAQKTQLTQEGRALVEQKVLPLYQNFYDFMTKEYIPNARENIAAS
                     SLPNGAEFYENRVRYYTTLNMTSAEVHELGLKEVKRIRQEMEQIIKSVGFKGSFADFL
                     HFLRTDPQFYTTSADQLLKEAAFIAKKADAMLPKYFGKLPRKPYGIAPVPAEIAPKYT
                     TGRYSGSNSDDEPGYYWVNTYALDKRPLYELEALTLHEAVPGHHLQISLNSELTSLPD
                     FRRYGYISAFGEGWGLYCEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAQG
                     WSRQQAIDFMASNTALSLHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEQELGD
                     KFDIRAFHDAVLENGSVPMSILEQQINDFIEAKKATR"
     gene            55299..56294
                     /locus_tag="SBAL_RS00240"
                     /old_locus_tag="Sbal_0046"
     CDS             55299..56294
                     /locus_tag="SBAL_RS00240"
                     /old_locus_tag="Sbal_0046"
                     /EC_number="3.5.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8EDT7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_011845364.1"
                     /db_xref="GI:500170939"
                     /translation="MIDTSIPLVDLHRHLDGNVRVNTIWELGHQHGIALPADSLETLA
                     PFVQIQGKETSLVAFLKKLDWMVGVLADLDAVKRVAYENVADAALSGLDYAELRFSPY
                     YMAMNHKLPIEGVVEAVVDGVKAGLKDYNVKINLIGILSRSFGQAACTQELEGLLAHK
                     QHLVAMDLAGDEMGFPGELFNEHFKRVRDADLAITAHAGEAAGSQSMWQAIQELGATR
                     IGHGVNAIHDPKLMEYLAKHRIGIESCPTSNLHTSTVASYADHPFRTFMDAGVLINLN
                     TDDPGVSAIDINHEYRIAKSELKLTDAELAQVQRNGVEMAFLSDSERKALYAAKV"
     gene            complement(56389..57729)
                     /locus_tag="SBAL_RS00245"
                     /old_locus_tag="Sbal_0047"
     CDS             complement(56389..57729)
                     /locus_tag="SBAL_RS00245"
                     /old_locus_tag="Sbal_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011867514.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_011845365.1"
                     /db_xref="GI:500170940"
                     /translation="MIEKYNYSGPRYTSYPTALEFDDTFTEQNLLTAIENSKSDKLSL
                     YIHIPFCAKLCYYCGCNKVITRHQHKADQYIEYLSQEIIKRAPLFKHYSVTQMHWGGG
                     TPTFLNPEQILKLTSLIKANFNFAEEGEYSIEVDPREIELSMLDTLKEAGFNRISIGV
                     QDFNKEVQIAVNREQDEQFIFDLMAKAKAMGFVSTNIDLIYGLPHQTPETFAVTMQRV
                     LDLSPDRLSVFNYAHLPARFAAQRKIKDEHLPSPKQKLEMLHQTIETLTGAGYQYIGM
                     DHFAKPDDELAKLQREGRLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRP
                     YYEAIDKEGHALWKGCSLNRDDEIRRVVIKQLICHFELDMAKIDEKLGINFETYFAED
                     LKLMQTFIDDKLVEIVDRQITISPTGRLLIRNICMCFDLYYRQKARQQQFSRVI"
     gene            complement(58027..58494)
                     /locus_tag="SBAL_RS00250"
                     /old_locus_tag="Sbal_0048"
     CDS             complement(58027..58494)
                     /locus_tag="SBAL_RS00250"
                     /old_locus_tag="Sbal_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845366.1"
                     /db_xref="GI:500170941"
                     /translation="MSTAIIILGFIIIVALSSYATFLILKLKQQKKRQQAEQAEREVT
                     ANAKRAQVLDDIRYIATAMIEDRCEISEGVVRIGRLFEMLSLSERVAPDYPSLFKHFE
                     LIKDHPIMDARQALPKQERMKLDLIRMKSEAALEQGISDDAKKLADYQAKAMH"
     gene            complement(58569..59129)
                     /locus_tag="SBAL_RS00255"
                     /old_locus_tag="Sbal_0049"
     CDS             complement(58569..59129)
                     /locus_tag="SBAL_RS00255"
                     /old_locus_tag="Sbal_0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_011845367.1"
                     /db_xref="GI:500170942"
                     /translation="MSRSKKTRKGGENSPKLQPRVKKQDRAVATGKRKDSGNKSGSRH
                     NESLILAQAPQQQAAKKKDPRHGSKKPIALAIPAAVVTDKAAQPKVKQAKLTDEQKLL
                     KLEEDPRLNQLLDMLEEGRDLNDVDQKWLDQQLSKIEALMIKLGISDDMDNDAPSSPA
                     KSLSDDELFDKFESGADLLKDYQDKF"
     gene            complement(59220..59858)
                     /locus_tag="SBAL_RS00260"
                     /old_locus_tag="Sbal_0050"
     CDS             complement(59220..59858)
                     /locus_tag="SBAL_RS00260"
                     /old_locus_tag="Sbal_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011845368.1"
                     /db_xref="GI:500170943"
                     /translation="MPRCPLCHNSQTQLLHQDKKRSFYVCKTCELTFADANSHLPPAA
                     EKQRYGRSRIALKQKQLSQFILPLLAQLEQQQAGSLLGLNFGRILNDESLATIENAGH
                     KLNQYDPFFAPNHDVLKQEYDFICCYRVFEHFQYPIKEWALLSRLLHSGGWLAISTPL
                     LTELDGFAKWHYKNNLTHVSFYQRQTFEYLANNSDFELLFAVKDLVLMQKTS"
     gene            complement(60679..61302)
                     /locus_tag="SBAL_RS00265"
                     /old_locus_tag="Sbal_0051"
     CDS             complement(60679..61302)
                     /locus_tag="SBAL_RS00265"
                     /old_locus_tag="Sbal_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_006084749.1"
                     /db_xref="GI:493001273"
                     /translation="MKKLALALSVVIAAISSPAIAEGNAEAGKTKIIVCSACHGMDGN
                     SMIDMYPKLAGQHATYLQKQLHDFRSAAQTGGKDGRMDPIMSGMAMPLSDQDILDITA
                     YFSSQAIQVAEAKDVPELGAKLYKGGDVSRGITACMACHGPDGKGAELAGFPTLAGQH
                     ANYIKIQLTKFREAGRHNDLNGMMQDVAKKLSDSDIDALSKYLSSLK"
     gene            61471..62130
                     /locus_tag="SBAL_RS00270"
                     /old_locus_tag="Sbal_0052"
     CDS             61471..62130
                     /locus_tag="SBAL_RS00270"
                     /old_locus_tag="Sbal_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CYM5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_006079362.1"
                     /db_xref="GI:492986334"
                     /translation="MTESRIDFRRAKFLISAPDIAHLDQYLPGDVGVEIAFAGRSNAG
                     KSSALNALTEQKSLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLALKNKWQ
                     QALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQSA
                     KMKTVNEVRLALSEFGDWVQVEPFSSLKGTGKPKVLAILNEWCHPQWLTDELDAANNA
                     E"
     gene            complement(63394..66159)
                     /locus_tag="SBAL_RS00275"
                     /old_locus_tag="Sbal_0053"
     CDS             complement(63394..66159)
                     /locus_tag="SBAL_RS00275"
                     /old_locus_tag="Sbal_0053"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588960.1"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_011845369.1"
                     /db_xref="GI:500170944"
                     /translation="MPTVAKNPLVLVDGSSYLYRAYYAPPHLTNSKGEATGAVYGVVN
                     MLRSLLTRYQPSHIAVVFDAKGKTFRNDMYSEYKAQRPPMPDDLRSQIEPLHRIIRAL
                     GLPLISISGVEADDVIGTIARQASLENRAVLISTGDKDMAQLVDENVTLINTMTDTIM
                     GPEEVAIKFGVGPDRIIDLLALMGDKADNIPGLPGVGEKTALAMLTGAGSVSNLLAEP
                     EKVAELGFRGSKTMAAKIIENADMLKLSYELATIKTDVELEQDWHELTIKPADKDELI
                     KCYGEMEFKRWLAEVLDNKITANTPIDAASETQEDSTPVEAIATQYDCILTEAELDAW
                     IAKLKEADLMAVDTETTSLDYMVAELVGISFAVEAGKAAYLPLTHDYVGAPTQINKTV
                     ALEKLRPLLEDPKLKKVGQNLKYDISILANAGIKLQGVAFDTMLESYVFNSVASRHDM
                     DGLALKYLGHKNISFEEIAGKGAKQLTFNQIPLETAAPYAAEDADITLRLHQHLWPRL
                     EKEAELAAMFTEVELPLIQVLSDIERQGVLIDSMLLGQQSDELARKIDTLEEKAYDIA
                     GEKFNLGSPKQLQVLFFEKLGYPITKKTPKGAPSTAEEVLVELALDFPLPKVILEHRS
                     LSKLKSTYTDKLPLMVNAKTGRVHTSYHQANAATGRLSSSEPNLQNIPIRTEEGRRIR
                     QAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE
                     VTTEQRRRAKAVNFGLIYGMSAFGLARQLDIPRHEAQTYIDTYFARYPGVLRYMEETR
                     AGAADLGYVSTLFGRRLYLPEIRDRNAMRRQGAERAAINAPMQGTAADIIKKAMINIA
                     QWIKTETQGEITMIMQVHDELVFEVDADKAEALKKTICTLMAQAADLDVELLAEAGIG
                     NNWDEAH"
     gene            66547..67209
                     /locus_tag="SBAL_RS00280"
                     /old_locus_tag="Sbal_0054"
     CDS             66547..67209
                     /locus_tag="SBAL_RS00280"
                     /old_locus_tag="Sbal_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis protein"
                     /protein_id="WP_011845370.1"
                     /db_xref="GI:500170945"
                     /translation="MKKVAVLLSGCGVFDGTEIHESVLTLLCLSKAGAHYQCFAPDIK
                     QMHVVDHLTGEVDATASRNVLVESARIARGEVKATTELAIAEFDALIIPGGFGAAKNL
                     CNFATNGSECEVDPLVTDFINEFILAKKPVGFICIAPMMIPRLYPHGVKGTIGNDSDT
                     VAAFNLMGGEHQVATVHEIVVDEANRIVSTPAYMLAGSIAEAHSGIEKLVAKVLEMTV
                     AR"
     gene            complement(67291..68136)
                     /locus_tag="SBAL_RS00285"
                     /old_locus_tag="Sbal_0055"
     CDS             complement(67291..68136)
                     /locus_tag="SBAL_RS00285"
                     /old_locus_tag="Sbal_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S54"
                     /protein_id="WP_006079366.1"
                     /db_xref="GI:492986353"
                     /translation="MIEIGRLPNSRAAQAFVDYLKGEHIDCQIEPLEQGVAILVIHDK
                     DLEQARTEFAHFMAHPYDSKYLQASWEHGDTQTKIDYGAPSLQLFTQFITGAGPVTLI
                     VFAVCVLIFAAMNLGFANQTYAALSYFGAVPSSEFSQFWRVFTPSLLHFSAMHVIFNL
                     LWWWYLGGKIETRIGTAPLLILLFVAGTLPNVIQYYVGGPNFGGLSGVVYAVVGYTWV
                     MGIRKPAAGIDFPPSYMAFMMIWLALGFTDILGVAVANGAHIGGLLIGLAQGLFDSRK
                     SSSSV"
     gene            complement(68133..68438)
                     /locus_tag="SBAL_RS00290"
                     /old_locus_tag="Sbal_0056"
     CDS             complement(68133..68438)
                     /locus_tag="SBAL_RS00290"
                     /old_locus_tag="Sbal_0056"
                     /EC_number="2.8.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007644071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="WP_006084745.1"
                     /db_xref="GI:493001269"
                     /translation="MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLN
                     NENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCEQGFDDVYSLDGGYSAWHEANA"
     gene            complement(68540..69565)
                     /gene="tdh"
                     /locus_tag="SBAL_RS00295"
                     /old_locus_tag="Sbal_0057"
     CDS             complement(68540..69565)
                     /gene="tdh"
                     /locus_tag="SBAL_RS00295"
                     /old_locus_tag="Sbal_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011498030.1"
                     /note="converts threonine and NAD to
                     1,2-amino-3-oxobutanoate and NADH; functions in threonine
                     catabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-threonine 3-dehydrogenase"
                     /protein_id="WP_006079369.1"
                     /db_xref="GI:492986366"
                     /translation="MKALSKLKAEKGIWLVDAPKPVMGHNDLLIKIKKTAICGTDMHI
                     YNWDEWSQKTIPVPMVVGHEYVGEVVDIGQEVRGFKIGDRVSGEGHITCGHCRNCRAG
                     RTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSF
                     DLVGEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKE
                     SLKDVMKELGMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKVAMLGIPGGEMAIDWSKV
                     IFKGLVIKGIYGREMFETWYKMASLIQSGLDISPIITHHFKIDDFQQGFDAMGSGQSG
                     KVILSWD"
     gene            complement(69577..70770)
                     /locus_tag="SBAL_RS00300"
                     /old_locus_tag="Sbal_0058"
     CDS             complement(69577..70770)
                     /locus_tag="SBAL_RS00300"
                     /old_locus_tag="Sbal_0058"
                     /EC_number="2.3.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084744.1"
                     /note="catalyzes the formation of 2-amino-3-oxobutanoate
                     from acetyl-CoA and glycine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="WP_011845371.1"
                     /db_xref="GI:500170946"
                     /translation="MASTSFYAQINQQLADIKAEGLYKSERVIASPQQTAIQVNQQEV
                     INFCANNYLGLANHPELIKAAQQGLDSHGFGMASVRFICGTQDIHKKLEASLSEFLGT
                     EDTILYSSCFDANAGLFETLLDAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMAD
                     LETQLIAAKEAGARNILIATDGVFSMDGVIANLKGVCDLADKYGALVMVDDSHAVGFI
                     GANGRGTHEYCNVMDRVDIITGTLGKALGGASGGFTSGKKEVIDWLRQRSRPYLFSNS
                     LAPSIVTASIHVLEMLKSGQALREAVWENSRYFREQMSAAGFTLGGADHAIIPVMIGD
                     AKLAGDFANRLLAEHIYVIGFSFPVVPKGQARIRTQMSAAHTREQLDKAITAFTRIAK
                     EMGII"
     gene            complement(71058..71705)
                     /locus_tag="SBAL_RS00305"
                     /old_locus_tag="Sbal_0059"
     CDS             complement(71058..71705)
                     /locus_tag="SBAL_RS00305"
                     /old_locus_tag="Sbal_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_011845372.1"
                     /db_xref="GI:500170947"
                     /translation="MKTRDKIIYASLELFNEHGERNITTNHIAAHLNMSPGNLYYHFR
                     NKEDIIRCIFSLYENHLESGFQPYEDKQVDVELLIGYFDAMFYTLWQFRFMYANLADI
                     LARDEELKKRYLHAQQQVLTRSSHVLHKLKQDGFLHLESDKITPLADTIKMIVSFWIG
                     YQLTQSSTSTITKATLYEGVLRVLMIFKAYATPTSVATFTRLEQHYHALANQESL"
     gene            71848..73113
                     /locus_tag="SBAL_RS00310"
                     /old_locus_tag="Sbal_0060"
     CDS             71848..73113
                     /locus_tag="SBAL_RS00310"
                     /old_locus_tag="Sbal_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090659.1"
                     /note="catalyzes the transfer of
                     2-keto-3-deoxy-D-manno-octulosonic acid to lipid A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_011845373.1"
                     /db_xref="GI:500170948"
                     /translation="MNRFLYSTILYLLSPLLIVYLAFRAIKSPDYRGRWGERFGLTRL
                     KSTDLLIHSVSMGETLAAIPLIRLIMQSHPELSITVTTTSPTGSAEVRKAFGDSVQHC
                     YLPFDLPWCVRRFLRQVSPKWCVIMETELWPNLVAVAAKRGVRLMLANARLSAKSAAQ
                     YAKHPTLNRPMLQRLDVIAVQTQVEAQRFIELGVSPDRVTVCGSLKFDLSITPERLAN
                     AKQLRQAWGRETSPIWVAGSVHPGEFDAMLTAHRQLLAQWPDALMIIAPRHPEQFSAV
                     AEVVASQGFESVRRSGNFPVTATTQVLVGDTMGELLTFYGAADQAFVGGTLIANGGHN
                     PLEPVAMGVPVMVGPNHWDFAQITQMLADAGGLRIVASADELAANLIAYFAKPELRQQ
                     AANAGLAVVEANRGALQRQFALVQSLIKS"
     gene            complement(73139..73894)
                     /locus_tag="SBAL_RS00315"
                     /old_locus_tag="Sbal_0061"
     CDS             complement(73139..73894)
                     /locus_tag="SBAL_RS00315"
                     /old_locus_tag="Sbal_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079376.1"
                     /note="catalyzes the phosphorylation of
                     3-deoxy-D-manno-octulosonic acid at the 4-OH position;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid kinase"
                     /protein_id="WP_011845374.1"
                     /db_xref="GI:500170949"
                     /translation="MNAQIQIIKTAQGHMALCQDTPKDIAPAWFAVDFWRAKDAVVGS
                     SKGRYTTWFVAFEHSHWVLRHYWRGGLMEKFSKDAYVYTGLENTRAMAELRLLNILYH
                     EDFAVPKPIAANIVRDGLFYRADIIIERVEGAEDLVAKLSKGLMNTEQWQALGATIAQ
                     FHQRGVYHADLNAKNILFQPAQTAPITPERFYLIDFDRGELKTPSPQWQQSNLDRLLR
                     SFNKEQGKLPSLAFTADNWSSLMMGYQAAMQSA"
     gene            73994..75058
                     /locus_tag="SBAL_RS00320"
                     /old_locus_tag="Sbal_0062"
     CDS             73994..75058
                     /locus_tag="SBAL_RS00320"
                     /old_locus_tag="Sbal_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_011845375.1"
                     /db_xref="GI:500170950"
                     /translation="MSLNPNTMNSLCLLRLSAIGDVCHAVAMVQAIQRQYPELKITWV
                     IGKLEYQLLKHLPGIEFVIFDKSQGWRSYFNLRKALKGRRFDVLLHMQVALRATLASL
                     AISAKVRIGFDRVRAKEGQWLVTNRRVEPLAKPHVLEGFMGFAKAIGVNDLTPQWHIP
                     VPIADTEFAQTQIKDNEKVFIICAAASKAERNWLPERYAAVASHAIAKGFRVMLCGGP
                     TQLEKDLAEQILQACPSKIDNLVGKTSLTQLLALLKRASLVLAPDTGPAHMAVTQGTP
                     VIGLYAHSNPGRTGPYLSQQYVASTYDEAIASQHSGEVKWGIRAKGEHLMALISVEAV
                     IEKFELVVNDGHVSDDICGY"
     gene            75068..76138
                     /locus_tag="SBAL_RS00325"
                     /old_locus_tag="Sbal_0063"
     CDS             75068..76138
                     /locus_tag="SBAL_RS00325"
                     /old_locus_tag="Sbal_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845376.1"
                     /db_xref="GI:500170951"
                     /translation="MTVQTSTKFLFIPVSSAEGIGEYMRSMIIADEVKRLWPSAEIKF
                     ILSQQAPYAAQCPYPAVLLEDTPTKQVKAVNQVMSDYLPDIVLFDASGRKSQLAHAHK
                     LGAKVIFLSQHKRKRSRGMKIGRALVTDCHWVVQPEFVIGPISWLDRLKLKLINKPAP
                     LNIGPVFTQPDASTQSALLAQYQLTQNEFVLFNAGSGGHKLNGELAADIFAQAAHESY
                     KASGITSVMVFGPNYPNPLPELEGVVVIPQLNNQQFINMLAAAKAAVLSGGDTLLQAI
                     ALRKPTLAVPVSKDQPPRIAKCVSANVALGSVTELDVLNGNIKQLLSSEGIMRLATSL
                     EKDYKLNGLDLVMKQLERWIRL"
     gene            76189..77178
                     /locus_tag="SBAL_RS00330"
                     /old_locus_tag="Sbal_0064"
     CDS             76189..77178
                     /locus_tag="SBAL_RS00330"
                     /old_locus_tag="Sbal_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620468.1"
                     /db_xref="GI:504433366"
                     /translation="MSVDERVYDYCEFIVDLTKLDEPRLPGISAILRIKNGAEFLRSS
                     IESHLPYYDEIVACYNDCSDNTAEILKELSEIYPEKIKVFEYLPKVHPIFSDAHNSSS
                     TDNVHSLANFYNFTLSKVRYNVATKLDDDHIAIDRNLAPVIDTIRRDILLKVRKIYTF
                     SGVNLALDANGKLGVFQQEPLVGTGDHMYFPVSSKIYFSQEKDVESFHFVDKNEKKYM
                     GIMYFHLKYLKVGCGFVNLEPKKRAEILTRHLHFAGVAELDDFISESSIKRLRKHHNP
                     IEYWLRTQHLVNKTIYSVLGRNPPLRIARLSQLYDDLNGLKLDECVVKRIKRF"
     gene            77211..77960
                     /locus_tag="SBAL_RS00335"
                     /old_locus_tag="Sbal_0065"
     CDS             77211..77960
                     /locus_tag="SBAL_RS00335"
                     /old_locus_tag="Sbal_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_011845378.1"
                     /db_xref="GI:500170953"
                     /translation="MNKSTVSLVITSCNRFDLLEKTIESFLKYNTYPISQYIVIEDSH
                     NREKLENTLAKFKGIEFVMVHNEPQLGQMKSIDRAYSLVTSDYIFHCEDDWEFYREGF
                     IEKSLEVLLSDDKVVTVWLRETNDTNSHTVLPELYFCKNDASLTYRGMHQNDLLHGVY
                     WHGFTLNPGLRRLADYQLIAPIAQYTSEGGVGNKYYELGFKAAIFPEGSVRHIGYHRG
                     IRYNADIAKWRKDFNVAFRRFKSKIHKILKV"
     gene            complement(78044..79156)
                     /locus_tag="SBAL_RS00340"
                     /old_locus_tag="Sbal_0066"
     CDS             complement(78044..79156)
                     /locus_tag="SBAL_RS00340"
                     /old_locus_tag="Sbal_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_006079381.1"
                     /db_xref="GI:492986406"
                     /translation="MSNIYIIYRAMFNLDGTLTTIGGIENYILNLTEVLSLQGWKCHL
                     VQPAKEPFMFETSHVNVHGVSTGFFRGNLKKFALAKWVQINADKKKDIIIYATDSYAV
                     NLSGYKQIAIQHGISWDKPRKANNSFIQFTSSLLNHCKYLSYIKNNSTLVCVDHNFIN
                     WYRTWFNVGNKKVKIIYNFYNEKISNSDFEKKWNNNSEIKIIIARRFVDYRGIDLIAP
                     IIKRLLPQHKIQVSFAGDGPLKPYLESLFANDSNVDIMQYGPDDSFKVHKEHHIAIIP
                     TLGSEGTSLSMIEAMAAGCMVLSSNIGGLSNLIIDGYNGSLVMPTSQDMEQALSSALN
                     NVDLCKKLAKNGLNSITLPCAKDTWSKGWIDVINNQ"
     gene            complement(79156..80277)
                     /locus_tag="SBAL_RS00345"
                     /old_locus_tag="Sbal_0067"
     CDS             complement(79156..80277)
                     /locus_tag="SBAL_RS00345"
                     /old_locus_tag="Sbal_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_006079382.1"
                     /db_xref="GI:492986408"
                     /translation="MKILLVFGTRPEAIKMCPLAKMLATDTQLDVKICVTAQHRHMLD
                     QVLSIFELKPDYDLDLMKPNQTLEWLTGAIVEGVGKVIKEFQPQIVLVHGDTTTSFSA
                     ALAAFYQKVDVGHIEAGLRTGDIHSPWPEEANRKLTAVLSKLHFAPTQTAAQNLKNEG
                     YLPEHIYVTGNTVIDALFETLAFTRKDNYSHPSELSPLFDQLQGKKVILITGHRRENF
                     GVGFENICTALKTIALSNPNVQLIYPVHLNPQVQKPVYEYLGELDNFHLIEPLDYQSF
                     VSLMDRADIILTDSGGIQEEAPSLKKPVLVLRDKTERPEAVAAGTVRLVGTDIDKIVS
                     EITQLIDNPSAFGETINPYGDGQACQRIHKIIKLHYQVD"
     gene            80574..81065
                     /locus_tag="SBAL_RS00350"
                     /old_locus_tag="Sbal_0068"
     CDS             80574..81065
                     /locus_tag="SBAL_RS00350"
                     /old_locus_tag="Sbal_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WUF6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="WP_006079385.1"
                     /db_xref="GI:492986420"
                     /translation="MHTRAIYPGTFDPITNGHADLIERAAKLFKHVVIGIAANPSKQP
                     RFTLEERVELVNRVTAHLDNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQL
                     ANMNRRLSPDLESVFLTPAEENSFISSTLVKEVALHGGDVNQFVHSEVATALAAKLKL
                     AKP"
     gene            81156..82631
                     /locus_tag="SBAL_RS00355"
                     /old_locus_tag="Sbal_0069"
     CDS             81156..82631
                     /locus_tag="SBAL_RS00355"
                     /old_locus_tag="Sbal_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079386.1"
                     /db_xref="GI:492986427"
                     /translation="MKAFLTPTILATSIASGLFFSSILAAAPWVDASDIYLRADIQAL
                     ADAGVITVPVNTYPLMWSGIGGDLAKVEPELLSPSLVQAYARVNFYYQSAVDNRGNAR
                     IKVSAASDPARFQHYGSDYREKGEVLGSYEYLGSRVAYKATVAETYDPQDNKNFRLDE
                     SYFAIILGNWIATLGSVEQWWGPGFDSALHRSNNARPMQSLTLSRNNAAAFETPWLSW
                     IGPWTFKTGFSLTEVDRAVPKTAEWDMRLSARPIKQLEVGLSWSTLFCGEGQDCNFNF
                     WWDSVASNSVCLDGTSDCAPEERRDAGHRTQSIDMRYTSSWQDIPVGLYLEHSCENGS
                     DCGSLWGIDTHFGTSGKQFKLFMEYSDTYVKCDGDSANCFYEDPVYLSGSRYYGRALG
                     STYDSDAQTFVVGLVGQFSNSRGFTSLLRYAKLNKDGTNVASTWAPQPPKEDLLMLEL
                     SYRMPVWKGMWSLGGTVSRSEFDVQENDTNATLFSSFEYRF"
     gene            complement(82697..83704)
                     /locus_tag="SBAL_RS00360"
                     /old_locus_tag="Sbal_0070"
     CDS             complement(82697..83704)
                     /locus_tag="SBAL_RS00360"
                     /old_locus_tag="Sbal_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079388.1"
                     /db_xref="GI:492986432"
                     /translation="MKYLVTGAAGFIGAKVSERLCLLGHEVIGIDNLNDYYDVNLKLA
                     RLDLLQTLDNFHFIKLDLADREGIAALFARHAFQRVIHLAAQAGVRYSLDNPLAYADS
                     NLIGHLTILEGCRHHKIEHLVYASSSSVYGLNQKMPFSTEDSIDHPISLYAATKKANE
                     LMSHTYSHLYQLPTTGLRFFTVYGPWGRPDMALFKFTKAILAGEVIDVYNHGDLSRDF
                     TYIDDIVEGIIRVQAKPPSPNTDWTVDAGTPATSSAPYRVFNIGNGSPVQLLDFITAL
                     EDALGIKANKNFLPMQPGDVHSTWADTSDLFDAVGYKPLVDINTGVAQFVNWYRQFYN
                     K"
     gene            complement(83728..84891)
                     /locus_tag="SBAL_RS00365"
                     /old_locus_tag="Sbal_0071"
     CDS             complement(83728..84891)
                     /locus_tag="SBAL_RS00365"
                     /old_locus_tag="Sbal_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079389.1"
                     /note="catalyzes the formation of UDP-glucuronate from
                     UDP-glucose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_006079389.1"
                     /db_xref="GI:492986435"
                     /translation="MKIVVVGMGYVGLSNAVLLAQQNQVTAIDLVPERVKQVNERKST
                     VVDELIEDYLQNKPLNLTATTENVAFQSADFVIIATPTDYDPQTNYFNTHSVESVIHD
                     VLAVNPDTTIIIKSTVPVGYTAALRHKFKSDNILFSPEFLREGKALYDNLYPSRIVVG
                     ERSARAQVFADLLAKAAIKQDIPILLTDSTEAEAIKLFANTFLAMRVAYFNELDTYAE
                     SRGLNTRQIIEGVSLDPRIGDYYNNPSFGYGGYCLPKDTKQLLANYNDVPNNLISAIV
                     DSNTTRKDFIADAIISKQPKCVGIYRLIMKADSDNFRASAVQGVMKRIKAKGIEVVVF
                     EPVLKEDYFFKSRVMRDLTEFKSMCDVIVSNRMVDELNDVADKVYTRDLFNHD"
     gene            85100..85810
                     /locus_tag="SBAL_RS00370"
                     /old_locus_tag="Sbal_0072"
     CDS             85100..85810
                     /locus_tag="SBAL_RS00370"
                     /old_locus_tag="Sbal_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichol-phosphate mannosyltransferase"
                     /protein_id="WP_011845379.1"
                     /db_xref="GI:500170954"
                     /translation="MVIKLWSVELISIVLPAKDEVGNIGHLMEEICQALQGLTEFEIF
                     VVDDGSQDDTFGEVMRTAAEQQCDAKAIRHERSTAISTGVLHARGKYIVTLDADGQND
                     PADIPAMFAQLPQIQAEHFCIAGYRKNRKDTAWKRFQSRFANKVRDALLHDGVPDTGC
                     GLKLIPRETFLRLPYFDHMHRYIPALVRRMGGEIFISVVNHRDRQVGISKYTAWNRRY
                     YGCDQAWAQSQSRQGCTQ"
     gene            85831..>86241
                     /locus_tag="SBAL_RS00375"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(86634..87449)
                     /locus_tag="SBAL_RS00380"
                     /old_locus_tag="Sbal_0075"
     CDS             complement(86634..87449)
                     /locus_tag="SBAL_RS00380"
                     /old_locus_tag="Sbal_0075"
                     /EC_number="3.2.2.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HPK4.1"
                     /note="Involved in base excision repair of DNA damaged by
                     oxidation or by mutagenic agents. Acts as DNA glycosylase
                     that recognizes and removes damaged bases; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="WP_011845381.1"
                     /db_xref="GI:500170956"
                     /translation="MPELPEVEVTRQGIAPFLVEQTVVDLVIRNGSLRWPVPDIAKQI
                     IGQVIRQVRRRAKYLLIDTDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRI
                     LRFNDPRRFGAWLWCELPEEAHPLLAKLGPEPLTQAFNVAQLAAALAGKKKAIKLCLM
                     DNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTL
                     KDFTNADGKPGYFAQKLHVYGRGGETCTSCGNLLSEIRLGQRTTVFCGICQTR"
     gene            complement(87485..87940)
                     /locus_tag="SBAL_RS00385"
                     /old_locus_tag="Sbal_0076"
     CDS             complement(87485..87940)
                     /locus_tag="SBAL_RS00385"
                     /old_locus_tag="Sbal_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079392.1"
                     /db_xref="GI:492986448"
                     /translation="MALTRKQWNNVIIVACVFMVAVLTFMDNKTNNVPSDAQLLFDDN
                     APLSQLQLNGIWLHKQASQWECDTTVLNCDEWAKAWQTIRVSPLTAAPETTDNPQELV
                     IQIADIRDAQLWIYFPNEGALKSPAGNWYLVPPSLRAKLQPILDAKPAA"
     gene            complement(88030..89013)
                     /locus_tag="SBAL_RS00390"
                     /old_locus_tag="Sbal_0077"
     CDS             complement(88030..89013)
                     /locus_tag="SBAL_RS00390"
                     /old_locus_tag="Sbal_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084726.1"
                     /note="together with moaC, is involved in the conversion
                     of a guanosine derivative (GXP) into molybdopterin
                     precursor Z; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011845382.1"
                     /db_xref="GI:500170957"
                     /translation="MSLMVDSFGRKVEYLRLSVTDRCDFRCVYCMTEDPCFLPKDHVL
                     HLEELAWIAQAFTELGVTKIRLTGGEPLVRTDCDQLVSLLGKLPGLTDLSMTTNGSRL
                     TKFAKPMFAEGLKRLNISLDTLNPTLFTQLTRNGKLDRVIDGIDSAIAAGFERIKINA
                     VILKQQNDNEVIDLVDFCRGRRLDIAFIEEMPLGEIDERKRARHCSSDEVKAIIESRY
                     PLQLSNKRTGGPARYYTMADSPIHIGFISPHSHNFCHECNRVRVTVEGQLLLCLGNEH
                     AVDLKSIVREFPADIERLKAAILTGINLKPKQHDFGNNQVQILRFMNATGG"
     gene            complement(89030..90841)
                     /locus_tag="SBAL_RS00395"
                     /old_locus_tag="Sbal_0078"
     CDS             complement(89030..90841)
                     /locus_tag="SBAL_RS00395"
                     /old_locus_tag="Sbal_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="WP_011845383.1"
                     /db_xref="GI:500170958"
                     /translation="MSNPFVNPLAIPVLGFCAYSGTGKTTLLKQLIPELNQRGLRLAV
                     IKHAHHNFDVDIPGKDSYEMRKAGARQMLVASHVRWALMTEDARDGDPELVHLLKQIE
                     ADKVDIVLVEGFKKLALPKIELHRAAHGKPFIYTQDENILAIACCDDTQLPSDALPNE
                     LRRLDLNNVSQIADFVIEYAQNWEAPLQYPISAVDACTIGDNKNLTVSQGLAQILSHV
                     SPVAEVEEIDLDALDNRVLASDSISPVDVPQQTNSAMDGYAFVYQDPMPATLKRVGEV
                     LAGHQYSGTLNAGETVRIMTGATVPVGADTVQPRELAKEVDGNVSFDGRILAGQHVRL
                     AGEDIARGQVALAKATRLSAAEQGLLGSLGLNRLNVYRRPTVAVFSTGDEVSQPGEAL
                     KANCIYDSNRFTIKAMAKRLGCDVIDLGIIEDSETALEATLAKAATLADVVISSGGVS
                     VGDADYIKTVLARLGKIDFWRISMRPGRPLAFGKIGDSLFFGLPGNPVAVMVTFLQFV
                     QPALRKLAGEVNWQAQLFPAISDETLRSRQGRTEFIRGIYQLGKDGRLHVSSTGNQGS
                     GMLSSMVKGNCLIIIGDDAEAVNAGETVFIQPFADLL"
     gene            complement(90875..91465)
                     /locus_tag="SBAL_RS00400"
                     /old_locus_tag="Sbal_0079"
     CDS             complement(90875..91465)
                     /locus_tag="SBAL_RS00400"
                     /old_locus_tag="Sbal_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor guanylyltransferase"
                     /protein_id="WP_006084724.1"
                     /db_xref="GI:493001248"
                     /translation="MSSQIDAVILAGGMARRMGGDDKGLVELNGEAMIKHTIDRIKPQ
                     VKEILINANRNQTRYAEFGFKVISDEHTGFLGPLAGMITAMGQTDADYLLVVPCDCPL
                     LPTDLVPRMLAAIKAEDAEIAVASDGEYEQPVVLLLKPSLRDSMKAFLEAGERKVDFW
                     YAKHHFVVESFSDQPNAFVNVNTPEQKQRLAMEITK"
     gene            complement(91449..92159)
                     /locus_tag="SBAL_RS00405"
                     /old_locus_tag="Sbal_0080"
     CDS             complement(91449..92159)
                     /locus_tag="SBAL_RS00405"
                     /old_locus_tag="Sbal_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011845384.1"
                     /db_xref="GI:500170959"
                     /translation="MTKVKLIARDLEMSFGARLLFKADALSLCQGDVIYLQGDNGTGK
                     STLMKILAGLMAPTKGKIETEGFAKNSWWRRNPLLGKAVYLHQHPYLFDGTVEYNLTY
                     GLNFSSETKAKAKQRITQAIEMAQLGSLLHARASNLSGGERQRLAIARAWILQPKLLM
                     LDEPTSNMDKDSQELVLKMIQQLKHEGTGMLLSSHQNCALTSICEQQWHIEGERVTTA
                     YQHPESLPAQESLYVIAN"
     gene            complement(92163..92870)
                     /locus_tag="SBAL_RS00410"
                     /old_locus_tag="Sbal_0081"
     CDS             complement(92163..92870)
                     /locus_tag="SBAL_RS00410"
                     /old_locus_tag="Sbal_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_006079398.1"
                     /db_xref="GI:492986471"
                     /translation="MSDGWLALLQQALSLLFSLDPDVWSIISISFSVSFAALLITLVP
                     SMVLGFVLAFAPFRGKWIVTNLVQTLQSIPTVVIGLLVYLLLTRNGPLGDLKWLFTQE
                     GMILGQMLICAPVLIAMSQAAFTSVDRRAWETSRTLGASWCRAVWTVCRELRMPLLLA
                     IVAAFSRILTEVGCSMMVGGNILNVTRNIPTAIALETSKGDFAQAIALGLVLLILALI
                     LNFALGGLRGKAMPRSH"
     gene            complement(92867..93691)
                     /locus_tag="SBAL_RS00415"
                     /old_locus_tag="Sbal_0082"
     CDS             complement(92867..93691)
                     /locus_tag="SBAL_RS00415"
                     /old_locus_tag="Sbal_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tungsten ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011845385.1"
                     /db_xref="GI:500170960"
                     /translation="MLNMKSHIKSLLGLIVAASMFTVLPAHSTEVIKLATTTSTENSG
                     LLKELLPKFESESGYKVQVIATGTGKALKLGEQGDVDLVMTHAPSAEAKFVADGFGVE
                     PRGIMENDFVVLGPKNDPAKIRDSKNAEEAFAKIAKSGVPFISRGDNSGNHIKELEVW
                     KAASVTPDFKGYTSVGQGMGKTLLMANEMQGYTLSDRGTFVAYKTKLDLGVDFDGGKT
                     LANPYQVILINSAKYPDLNHKGAKAFSDWLISKEGQSMINNFKVDGEQLFKATYSE"
     gene            93976..95358
                     /locus_tag="SBAL_RS00420"
                     /old_locus_tag="Sbal_0083"
     CDS             93976..95358
                     /locus_tag="SBAL_RS00420"
                     /old_locus_tag="Sbal_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_006079400.1"
                     /db_xref="GI:492986477"
                     /translation="MSQIDNNLKPLPSAVSVLIVDDEPGMRSFLNKALSKKFALVETA
                     GSIEDAEQLRSRCHFDLLIVDIRLPGRSGIEWHEALDEQGRRSDIIFMTGYADMEVAI
                     TALRAGASDFIMKPFHLEQMMTAVDRCIERRLLKRENLMLRREVSIGYSSTIIGSSEA
                     MKSVKHIIERVAPTNAVVLIQGESGTGKELVARQLHLLSGRQGPFVPVNCGSIAPELL
                     ESELFGHTAGAFTGAKGNREGLFSFASGGTIFLDEIGEMPLKMQTALLRVLEQKAIRP
                     VGSEKEVNIDVRVIAATNRTLIDEVDAGNFRRDLYYRLNVLDILIPPLRDRPEDVVEL
                     THHFTRQLAAELGVREVVWSHEDMVKLQQHEWPGNIRELRNMIERCILLGKPPAEYWK
                     QQLKSESLSTSGYPLDWPLKEVEKHHVTSVVDLHSGNKSAAARDLGVSRKTLDRKYKE
                     WFDFSGDQES"
     gene            95360..97513
                     /locus_tag="SBAL_RS00425"
                     /old_locus_tag="Sbal_0084"
     CDS             95360..97513
                     /locus_tag="SBAL_RS00425"
                     /old_locus_tag="Sbal_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845387.1"
                     /db_xref="GI:500170962"
                     /translation="MSFFTHFFGVSWQQMQAKVRYRILILTLLPILLTLVSLVFITIY
                     WNISYTGKQLFMKVKADLSVAENTLQQVQVRQEKQLERVVTSWTFQNDFRPLFSGKEL
                     TGEVIHRASLDAFLLEQKKQLNLDYLRLVTVAEAAADPDLRQILPKINGLLPYSGLMV
                     LPPERLSRIDPELAVTASIPIVATLRAQSPTKTVEERGLLSRSLLPVPDMQGKVAWYL
                     DGGILFNRDIRIVDHIRDLVYDKGTLPERSIGTVTIFLDNIRISTNVPLHFYPTGNET
                     QGRALGSLVSEEVKEKVLTQGEQWVDRAFVFNDWFISAYAPLEDIRGQRVGMIYTGFS
                     ESPFIHNYLLNIIELGTILMLVLLVSGLLVYRGAYSLLQPIERIHHVVQAVQSGRNIR
                     IGALGLDRDNELSNLAEQFDSMLDLLQRRNAQIQAAAEQLEMKVEERTRSLQDKTLEL
                     QRNVALLNETRQQLVTNEKLTALGELTAGIAHEINNPTAVILGNMELLRYELGDNAEV
                     VKEEIDLVIQQVGRISTIIRSLLQYSRPGEFNAPLEMHPITPIIEEMLVLVRHSIQKQ
                     EVVLITELNASCPVQVNRPQLLQVLINLVVNAAHAMDGKGRIWVRTYDWVQQDMPIGV
                     KIEVEDEGSGIAPEQLGRIFDPFYTTRKDGTGLGLSLSYGIIKRIGGTIEVSSTLGKG
                     TLFTIGLYHEAKEDQQNNPYEGLHIAGNDSDMSAD"
     gene            complement(97864..98322)
                     /locus_tag="SBAL_RS00430"
                     /old_locus_tag="Sbal_0085"
     CDS             complement(97864..98322)
                     /locus_tag="SBAL_RS00430"
                     /old_locus_tag="Sbal_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_011845388.1"
                     /db_xref="GI:500170963"
                     /translation="MYSIEIKAESGLTPELATQLIQLSQQIPELDRPLTSEVLNQRLQ
                     GKKCLILVAYVEGELAGFKMGYEQEEAIFYSWLGGVASDFRRLGLAQSLLKYQETWAR
                     RQGYNHIQVKTMNRFPAMLNLLISNQYLITELNADPKSLVDHKLHLRKSI"
     gene            complement(98423..99082)
                     /locus_tag="SBAL_RS00435"
                     /old_locus_tag="Sbal_0086"
     CDS             complement(98423..99082)
                     /locus_tag="SBAL_RS00435"
                     /old_locus_tag="Sbal_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079405.1"
                     /db_xref="GI:492986495"
                     /translation="MLMLTTAQLRRALFLLVGFHILIICVSNYLVQLPFQLFGYHTTW
                     GAFSFPFVYLATDLTVRIFGQQAARSIILKAMVPALMISYVMGVVFHQGSFQGADSLA
                     EWNTFVFRIAFASFAAYLIGQLMDIKVFARLRMSRSWWVAPAASTLVGNLVDTLVFFS
                     IAFYASSDSFMAANWPEIATVDYGFKLIVSLGLFLPAYGVLLKVLQDKILRTNPQESI
                     S"
     gene            99315..100055
                     /locus_tag="SBAL_RS00440"
                     /old_locus_tag="Sbal_0087"
     CDS             99315..100055
                     /locus_tag="SBAL_RS00440"
                     /old_locus_tag="Sbal_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011845389.1"
                     /db_xref="GI:500170964"
                     /translation="MRRFFAIFCLLLAVLPVSICAAQPIVVNVATASWDDFANRDETG
                     YYFELLQRVFPEPEWQLKVQFMPFARSLYLVEHNRTDITLSVYKGDTKKALLTENTVE
                     VDSIYVAVTAELAATWTGLESLSHKRVQAMLAYRYNMLTPVPMYYEESSDMLTMLNSL
                     NAGRIDAVLDYKSNLLMYVPKLKAPQNFVIIQGVLKAETYFAFANTEKGQMLKHHFDL
                     AHKRLIDSGEQDRLYLETLEKRRVDGEK"
     gene            complement(100068..101426)
                     /locus_tag="SBAL_RS00445"
                     /old_locus_tag="Sbal_0088"
     CDS             complement(100068..101426)
                     /locus_tag="SBAL_RS00445"
                     /old_locus_tag="Sbal_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="WP_011845390.1"
                     /db_xref="GI:500170965"
                     /translation="MPVHALSEDLKSLIDKLIQLKQVPPTEPIVQLSLNTVAMPLISW
                     LASQTQFPRIYWHGRDRIEEVAAIGACKDFRFETGINDQQLAMAYQEQRALSTNQNIR
                     YYGGVAFDRTIESWPEFGNSRFILPRIEFRRSGSKFSLLVNLNFAENDHHSEIDKAIA
                     AIEAVMPAKPLSPPKKIVPLGRSDKPDFERWKTLVEQVVEPKFNQDTPKVVLSRLTQL
                     EVNEPIDPWMVMACWQGRNPNSFQFGFQFSPERTFISCSPERLFRRRQQELFTEALAG
                     TTVRGLSQEEDIALANALLEDNKNSVENQLVRSHIVNMLTPLSNYVGADELATIFKLN
                     HIQHLHRAIRAELKPGVNDFQLLQALHPTPAVGGLPRHSALNFIRQREGYTRGWYAGA
                     CGYFNKYESEFSVAIRSALFEPGRINLFAGAGIIAGSEPEAEWQELENKLATIMSILF
                     EM"
     gene            101851..103974
                     /locus_tag="SBAL_RS00450"
                     /old_locus_tag="Sbal_0089"
     CDS             101851..103974
                     /locus_tag="SBAL_RS00450"
                     /old_locus_tag="Sbal_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011845391.1"
                     /db_xref="GI:500170966"
                     /translation="MITTNTLFRVSSLALAIGLSFTVQADEIARDPRLNINEVIVVHG
                     DGGEASEMATTHWSISEEEIRATGAQSLDQVLKNVPGVYIRVGGDGTPRVDIRGFKTR
                     HVTLLVNGVPMSSADDGQFDPSIIPTSQIASVEVSVGPTSVLYGPSGAGGVINIITKQ
                     GSTAPALAGRLEAGKDNTFNGDISAAGSGDDWQGLVSVSRQQTDGFPMSNDFEPTQYQ
                     DGELRVNSDKEVTNVYAQGSYWLSDKTQLIANMALRSGEWGKPARDGTGSGKLKFERT
                     DDYDAHTFQLGLAHQFDDTFTLRGFGYHNQSDTLEASYADETYQAVRLSQDGRSVVQG
                     VNLQLITDLHTAGLFTTSVIAEKQSWKSVVDTYTPNTGSNNGGTTGSGGGTGTGGGTG
                     TGGGTGTGGGTGTGGGTGTGGGTGTGGGTGTGGAENLNDSAWLYTAAAEYQYQSELQY
                     GFTLGGAYHSLDTTDSTDGNYSAMASSYWQAAQDSRLSLSVARKVRFPSMVNLYSQLS
                     GNRDLEAEESKHVELGLEQNLPASNDFSLYGYYTDAKNYIAKDVDGFYQNMGRYKFKG
                     VDFQINNHAIEHLDLSFSYSLLDSEEIDGDDTLDALQYRPRHQLRWQMSYEFPFETQV
                     HLNVERILDQVYATQVKVGGQTQYQQQSLDNYTLVDVNLVQPLIRDKLDVYLRATNLL
                     DENYYQSEALPQAGRQIFIGVNWQI"
     gene            103976..105346
                     /locus_tag="SBAL_RS00455"
                     /old_locus_tag="Sbal_0090"
     CDS             103976..105346
                     /locus_tag="SBAL_RS00455"
                     /old_locus_tag="Sbal_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011845392.1"
                     /db_xref="GI:500170967"
                     /translation="MKLLALEGVSFNYGSQLPTVLQEVNLAIGTGQCHCVSGPTGSGK
                     SSLLNLLAGVLNRPHEGHIWRYPQLVTGLVMQDPQTQLLRQTVGAEVAFALENLGIPA
                     EQMLPKVQLALRRVGLYLRLDTQVSTLSLGQKYRLMIAAQLVCEPHLLLLDEPWAQLD
                     DHGVSELLVVLRNLIQDGMALVLVEHNASAFAEIIQHYWQLEAGKLSEGIYTVTDAPQ
                     TEAPAWRNQPKFEHLGKVLVSAEAFEFGFDACPTLFACPQGFQLQAGEIVTLVGDNGS
                     GKTSLLKTIAGVLSSRQRLPLKVLGRRPKLGIYGAELGLLMQRPSRQLFETSVLAEMQ
                     FSLRRFELPKERAAQMLDELDLFSLAQLSPHKLSYGQQHLIALASLACLRPKVLLLDD
                     PLAGMDKHYYGKVWYLLKRLSSQGCAILLSSHRSIEHSAVSRQLSLRNGLLVEELIET
                     GERYVG"
     gene            105336..106016
                     /locus_tag="SBAL_RS00460"
                     /old_locus_tag="Sbal_0091"
     CDS             105336..106016
                     /locus_tag="SBAL_RS00460"
                     /old_locus_tag="Sbal_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter permease"
                     /protein_id="WP_011845393.1"
                     /db_xref="GI:500170968"
                     /translation="MWASCRRLRALRHWSYERRETALCALSLLLVCVLSACAFVLPAA
                     LLLPLAGLNGLLVIHGLLRRGSIWGVLKLGLVQLSITLSLYLILYGVEHLAQGAVVVT
                     RIILATIPGWWLCITTAPERIGEVLSAFLPTKWAFVVAASLSLLPYMADEIREIYQIQ
                     CLRGARITPKALRNPKNWSELVYCVLFPVLIQLLKLSRQMAVAAQCRHFGLAQRPTHW
                     HSPRDKND"
     gene            106009..106551
                     /locus_tag="SBAL_RS00465"
                     /old_locus_tag="Sbal_0092"
     CDS             106009..106551
                     /locus_tag="SBAL_RS00465"
                     /old_locus_tag="Sbal_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="core component of ECF transporter"
                     /protein_id="WP_011845394.1"
                     /db_xref="GI:500170969"
                     /translation="MTKKIPLSLQDSLFVGFCATLLVALTGMLRLKLGLSGHSMFLMS
                     FFYLICYGVLGRFGSMTACGVIAGIVAMALGVGKGGPMILLKFALPAIAMDLVALLLP
                     LSMNLHWRCVILGIAGCIAWAGKVALTNMLAGMALDVVMIQWGLSVLKGGFFATLGAL
                     LVPPVLTRLKAHDLLHRDKF"
     gene            106581..107320
                     /locus_tag="SBAL_RS00470"
                     /note="DNA-binding protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            107359..107598
                     /locus_tag="SBAL_RS00475"
                     /old_locus_tag="Sbal_0095"
     CDS             107359..107598
                     /locus_tag="SBAL_RS00475"
                     /old_locus_tag="Sbal_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079419.1"
                     /db_xref="GI:492986510"
                     /translation="MDLNLVEHAFELKDDRWIFKAGLAQYPQARQVAKLCTRFIPDDE
                     DEQIDDEPRSCYNCQYRRWMVAGFECLALRHLLKK"
     gene            107832..109022
                     /locus_tag="SBAL_RS00480"
                     /old_locus_tag="Sbal_0096"
     CDS             107832..109022
                     /locus_tag="SBAL_RS00480"
                     /old_locus_tag="Sbal_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HD family phosphohydrolase"
                     /protein_id="WP_011845397.1"
                     /db_xref="GI:500170972"
                     /translation="MSESAESVELIKLPVSQLTLGMFVSAIDKNDKGQLAIANAGQIK
                     HKDAILKLAKSGIKFVWVDAERSAEHCGLKKKTTNDSQTDNRKAPVSRDKQQAQAKVM
                     LTEAKDLIRKVLSETFEGKAIEVAPFEALADTMIESVMLDADALKCMSALRSKDAYLL
                     EHSVNVAFLLVTFGKYLQLDRDMLRQMAVGGILHDIGKIKVDNKVLHKPGKLTPEEFE
                     HMKLHQVYELEIMNETTGLSQISKDICLMHHEKLDGRGYPRGLKDDEIPRHGRMSCIV
                     DIFDALTATRCYKEAMSPAAAFKILLSLTPFHLDQQLVYEFIRCIGIYPVGSLVELSD
                     GRIGIVWASKDRDALHPIVKCFYSLKVKRYTDVAMVDLLKSELYIERGVSPSSLDIDP
                     TPFY"
     gene            109135..109770
                     /locus_tag="SBAL_RS00485"
                     /old_locus_tag="Sbal_0097"
     CDS             109135..109770
                     /locus_tag="SBAL_RS00485"
                     /old_locus_tag="Sbal_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraquat-inducible protein A"
                     /protein_id="WP_011845398.1"
                     /db_xref="GI:500170973"
                     /translation="MNSAMKSLFPIFIILLSLALLIPGVTQPILSISGTIDKAKLTEQ
                     GIEQVAQRFDEDSGRDSARGMLSMVSGLLGLNSLKGEVEVLQKTRSIWGTVTELYHSG
                     NGLVAGLVMLFSVVVPALKLSLMLAQQCVSSIGLKLRINAVVNALAKWSMADVFVVAL
                     IITFMAGNASGGMGEMLKTQAQFENGFYFFTAYCILSILSGFLVRRPTPIL"
     STS             109433..110437
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     gene            complement(109845..110150)
                     /locus_tag="SBAL_RS00490"
                     /old_locus_tag="Sbal_0098"
     CDS             complement(109845..110150)
                     /locus_tag="SBAL_RS00490"
                     /old_locus_tag="Sbal_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011627657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845399.1"
                     /db_xref="GI:500170974"
                     /translation="MSTEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREH
                     SHFNIKEQVEGYREFCKFEIMHPAAQQAALLTALALVCKHNPCRYWIMPIYQNGTLS"
     gene            complement(110147..113200)
                     /locus_tag="SBAL_RS00495"
                     /old_locus_tag="Sbal_0099"
     CDS             complement(110147..113200)
                     /locus_tag="SBAL_RS00495"
                     /old_locus_tag="Sbal_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C peroxidase"
                     /protein_id="WP_011845400.1"
                     /db_xref="GI:500170975"
                     /translation="MLTSVIRFSLTQRLFVLIVALIIMLAGARAWFSIPLDAFPDISP
                     TQVKIILKAPGMTPEEIEAQITVPIETELLGIPHQSILRSTTKYAISDITLDFDEGTD
                     IYWARQQVSERIAAVWDSFPEGVTGGVAPMSTPLSEIFMFSLENPNLSLMERRQLLEW
                     EIRPLLRTVAGVADVNILGGYAKSFSVTPKPAAMAAAGVSFAALQQAIVENNHNEGAG
                     KLTIGTDTIIVRAEGRIDDIDELKQLVIKADDARVYRLQDLADIQIGHLARYGAVTKD
                     GNETAEALIIALKDANTAQVVKNIKEKLDQISLTLPEGSQINTFYDRANLINTAIDTI
                     SNALFEAVVLVIILLALFLGNVRAALVVSLSLPLSALMTFLMMDYFNLSANLMSLGGL
                     VIAIGMLVDSSVVVVENMVNLIATKQRLPRLHLIFRATKDVAIPVVSGTVIVMIVFSP
                     LLTLSGLEGKLFTPVAVTIVFAMLSALVLSLTVIPVIASYLVNEKAAKEPKAIEKLKQ
                     LYLGSLKGTFSHQKRFIVIAFSLLIVSLGLFGLVGKTFMPTLDEGDIILQLEKSPSIS
                     LEASIAIDKQIQQTLLAKVTEIKQMVARTGADEIGLDPMGLNETDVFLELLPRSEWRF
                     ANKEALIDAIRTVLLDYPGVNFNFTQPIQMRVSEMLTGSIGDVAIKVFGNDIDTLGQL
                     TSQIQQLVNATSGSVDVKMAMIEGSPFINLTLDNELARGFGMSTMEFARYLKSQLEGV
                     IVTEVLQGKKRTPVLIANNQSHLSSINELKNQLLVMPDHSLKRLSDVATLSYKQGPIL
                     IEREQGNRFSVITTNVQGRDIVSFVEELNAKIAQEIKLPSGYSVSFGGEFENQQRATS
                     NLLLVIPIAIALITLILFTTFGSLAKAGLILANVPFAMMGGIVSLYLSGEYLSVPASV
                     GFIALLGVAVLNGVVMVSYYEQTKHMFSNLRERVEQGAARRLRPILMTATTAMFGLMP
                     LVFASGPGAEIQKPLAIVVIGGLLTSTITTLYLLPILYFWLEKRK"
     gene            complement(113202..114230)
                     /locus_tag="SBAL_RS00500"
                     /old_locus_tag="Sbal_0100"
     CDS             complement(113202..114230)
                     /locus_tag="SBAL_RS00500"
                     /old_locus_tag="Sbal_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079425.1"
                     /db_xref="GI:492986516"
                     /translation="MMAKYGACLFCLSASVATLAQAESLTISSLGNLDLSYVQPQKVA
                     SYEGSPLPAQVEILPGNDYWISTPENIQQISFLVGQGQLVTKGQAIVKLTGPEVFHYL
                     AQVEAAGSLYQLAKSRYERNKPLLNNGSISAEKWREISQDYFSTHLEYEHMQHFMEIV
                     KSTDATTDSLVVGTPVAGIVKLNQVNGPYMAGSQLFSLVPSDSIRVKVSVPMSQSHSL
                     SAVNINQCHIAIESMSAIAEGAFVTAWSSPVPQECNLLLGQQITVIPEYQKAVYLLPK
                     NSVFSWEQDSQVFTKTADTLTSITIDILGSTPEQYIVESDQDLSQIQVLSQSVAAVKG
                     IMLGLGGE"
     gene            complement(114227..115450)
                     /locus_tag="SBAL_RS00505"
                     /old_locus_tag="Sbal_0101"
     CDS             complement(114227..115450)
                     /locus_tag="SBAL_RS00505"
                     /old_locus_tag="Sbal_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal transporter"
                     /protein_id="WP_011845401.1"
                     /db_xref="GI:500170976"
                     /translation="MSVSTSCIKLCLLATLVSSSFLCHAANSELSQALSTSQARLHSL
                     SQSGGQLPQSQISLSSSSWLNGLPSISLSHLGSLDNGNSYEQELSLNLPIKSPALHSS
                     DKQIKQLTQGIQAQQVALQGLYLSGLLRQSLWEHRLAAVKLAKLNRKSQLLDKLHSQQ
                     KQLTDAGELPIAHILLLERELVDIALERVDLNQQQAEALALYQQLTGQDQIPQDITET
                     ARPLSASSQPNDILAQHPLWQLLSLQKQQQLLIIQSQQAGDKDPWTVSLTAKNTADNQ
                     VDDQQLGIAVSVPLTLGSALSQTELSQWQQANTEHTLNLDRTYIELKTQLKKLEQQQQ
                     NLLDQQTLLTQALHLSRTITEELAKVKDQNQVSYEVWLRRYMDALDTESRLALNQVAQ
                     QQLHSQQLQALGISL"
     gene            115596..116123
                     /locus_tag="SBAL_RS00510"
                     /old_locus_tag="Sbal_0102"
     CDS             115596..116123
                     /locus_tag="SBAL_RS00510"
                     /old_locus_tag="Sbal_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_011845402.1"
                     /db_xref="GI:500170977"
                     /translation="MKDLVIIGLLALIICFKLFDISSDIQLGIPQWHIAQEAMLLVLT
                     VIGAMYLSYDLIRRSREVKALAKRLEHADKKIDNMSTQMRSARQEYSQAVSQQFETWG
                     FTKSEQQVAFLLLKGLSFKEIAEVRQTKEKTVRQQASTIYGKAAVDGRHTFCAWFMED
                     FIQEHNQDLAANEAA"
     gene            complement(116428..117378)
                     /locus_tag="SBAL_RS00515"
                     /old_locus_tag="Sbal_0104"
     CDS             complement(116428..117378)
                     /locus_tag="SBAL_RS00515"
                     /old_locus_tag="Sbal_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006084708.1"
                     /db_xref="GI:493001232"
                     /translation="MNSSSTSQQDNKTHRIVFICAGLLCLAPFISSPMALVLGFTLAS
                     LGWVPVQWNIAALTKKLLSYSIIGLGFGINLNAAIEASTHNFGLIVGSIFFTLSLGFV
                     LTRALKFDHVTGHLIASGTAICGGSAIAAVAPAINARNDQTATALACVFVLNSVALFL
                     FPALGHLLNMSQYDFGVWSAIAIHDTSSVVGAASAYGDEALKTATTIKLARALWIIPI
                     ALVSAMLFGGDKRKLNLPYFIGFYCLAIAVAHWLPQFNAVYDTLFMMSKRALVLCLFL
                     IGAGITVQKMRASGPKPLLLGVMLWAAIGITSLVYILYFQ"
     gene            complement(117665..118228)
                     /locus_tag="SBAL_RS00520"
                     /old_locus_tag="Sbal_0105"
     CDS             complement(117665..118228)
                     /locus_tag="SBAL_RS00520"
                     /old_locus_tag="Sbal_0105"
                     /EC_number="2.3.3.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="WP_011845404.1"
                     /db_xref="GI:500170979"
                     /translation="MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFL
                     DRLFPLNSGSHQDVSSYVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQ
                     DLGCHVELSFDRSGMIGARDVANLEDIQIGTSLNMVVGTPESRSAASRHWLSLLHAGM
                     SSANDTQDKLFTAKDGSDYNLKSIVNL"
     gene            118480..120009
                     /locus_tag="SBAL_RS00525"
                     /old_locus_tag="Sbal_0106"
     CDS             118480..120009
                     /locus_tag="SBAL_RS00525"
                     /old_locus_tag="Sbal_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_011845405.1"
                     /db_xref="GI:500170980"
                     /translation="MRNDQSLMRKSHFLGTKIRNLRKRNNLTMEDLSARCIRVDAGSA
                     PSVSYLSMIERGKRVPSAGMLAVIAAVFQKDADWFLDDVPEESAITPDKGRRGGISGM
                     ALEPSFLFSNDILQIAIPEMLSQTGISGRQFAHLLIRAHQEHHQNHFPDLERAAEEVG
                     LKRMPLSLDDMLDIAKGMGLKIKWIDSTPQEVIDDMGVSSRQLVTSFFEPPSTIYVNK
                     ILKNRPNRLKYDLAVHIGHCVLHNKDGLKSVMTSGRKEEVDEEAGMQSNTLNAQDILH
                     AWRDFESSFFAGALLCPKVPYRQLLDRHGYEIEVHKQLQVSASVAMRRMTVVSPYPHW
                     HYFDAYAPGKLKAVYRGNGIPLPWGNMRLVEDPCQHWAVFRMISEPTVGTSAQISILN
                     VGNEPRIYCCESIKVEDSAGNPHVLCAGIDLNPAIEAQGKDALSIAHDLKDACVASGG
                     SVTIPKHIKSDLVSVAKILNINWIERGIKNDARLICSRGAVCPRQPSCYQAGKSQCDG
                     E"
     gene            120570..121478
                     /locus_tag="SBAL_RS00530"
                     /old_locus_tag="Sbal_0107"
     CDS             120570..121478
                     /locus_tag="SBAL_RS00530"
                     /old_locus_tag="Sbal_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845406.1"
                     /db_xref="GI:500170981"
                     /translation="MKELHFSIVSDSLLKTHKAKLSDCEYLELSSAREILSKILDHEE
                     LYDQVIESYVEAKSTMYEMSVRAISDSVKYDYIKNHNNRSKLNRLYFNVLNFSKLYLD
                     RHFHDGDKKSFVKSITASESSHDEVKKHRQDISKNNPDYIFGCKLRNYVQHASLPVKT
                     FTTGVRWSPEDNQSVAIFHVPLAKKKLIDSGIFSQQMLLKYGEKIDLHQIMDGYIYAI
                     SEMHLKSRQLIKNYMEKSLEVINLKRRQIELEHSSSLCDINVVDTEQGVSLCSLHVEW
                     FSVVEHLQKKNLHSLNFKRFTHIPYQ"
     gene            complement(121674..122000)
                     /locus_tag="SBAL_RS00535"
                     /old_locus_tag="Sbal_0108"
     CDS             complement(121674..122000)
                     /locus_tag="SBAL_RS00535"
                     /old_locus_tag="Sbal_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845407.1"
                     /db_xref="GI:500170982"
                     /translation="MTATGELLTCFIAMGLLALSYFSHHRAVRNRPLTDAQARGFRTA
                     GTATLVLCYWLASRHYGPAYASVLLLGWVCLSSIILVILLSYKPRWLQPILPASAVVC
                     LLGLLY"
     gene            complement(121997..123601)
                     /locus_tag="SBAL_RS00540"
                     /old_locus_tag="Sbal_0109"
     CDS             complement(121997..123601)
                     /locus_tag="SBAL_RS00540"
                     /old_locus_tag="Sbal_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011845408.1"
                     /db_xref="GI:500170983"
                     /translation="MKDSFFRSMTWLHTWVGLLTCWVLFLVFFAGTAAYYRAEINIWM
                     QPENHGSQYDVNADNQQLILKGLTALAQQAPDAETWWVYLPTQRTPLLTYAWSEPAAE
                     GQRFGDYHQSFINPATGEALPKARESRGGDFLYRLHFDLYYMSVITARWIVGFCTMFM
                     LVAIISGIVIHKRIFKDFFSFRPGKGPRSWLDAHVASSVLALPFHLMITYTGLVTLMF
                     MYMPWGLNTQYGDETQAFYSQWKPIYSSSVPSGEAATMQSPQQLLASLNAAMPMSDEA
                     SSPIEMLQVEHLNDANARVTVRISPEHSLNQQAPWYRFSAVTGKLTEESTATSAANKT
                     QSTMIALHSGRFAGQGLRLLYLLAGITGCVMIATGAIMWAEKLAQKQHKSGQFKPGLA
                     LVKMLNLATFAGLPIALASYFYANRLLPVSFVDRENWEIHCFFISWALVALFACFKRD
                     KQTWQRLFLFTALLYGLLPLLNAMTSQYQLISNLQRQAYVLAGFDLMMLALAALFYMA
                     AKRLRSSQKVRAAQVTKATAELGIES"
     gene            complement(123598..123966)
                     /locus_tag="SBAL_RS00545"
                     /old_locus_tag="Sbal_0110"
     CDS             complement(123598..123966)
                     /locus_tag="SBAL_RS00545"
                     /old_locus_tag="Sbal_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845409.1"
                     /db_xref="GI:500170984"
                     /translation="MTEKTNITPPLTQRLMRWKMSAIWSDSLHIGNRCLAATFGGYLL
                     SAIATILLAQILPLSQVDRVLTAMMLSFTVYTCAVIWVFSVKSTWRYWLDLFALSGLL
                     YLAYLAAKALDINPIQGGGL"
     gene            complement(123959..127138)
                     /locus_tag="SBAL_RS00550"
                     /old_locus_tag="Sbal_0111"
     CDS             complement(123959..127138)
                     /locus_tag="SBAL_RS00550"
                     /old_locus_tag="Sbal_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_011845410.1"
                     /db_xref="GI:500170985"
                     /translation="MLKFGIKHGTLLSVIVLIFCVLGTAAALRIPIQMIPDLDVRTIS
                     VATGWPGATPQDVEKEILLEQERYLRTLPNLQRMTSWADTGSAWVELEFPQSTEISDA
                     LIRVSNALSQVSSYPENVDQPRLYSSSYSDNAFMYFRLVPVAGNPLNLDIDMMRDFAN
                     DFIRPQMERVKGVSSVTIQGGAERQIQILLDPAKLAQRGISIMDVRQAIRDRNKDTSA
                     GDIDSGKKRYLLRVIGRFEDLNQLKQLILKRQGNTNILLQDVAEIKLDHAEIRELSFA
                     EQERTLSLAVKRDVGSNVIAIKAAMMPVVAQINQNQLAQHAMQLELFSDDVRYVQDSV
                     ANVWVNLGLGALLATLVMYLFLRSSRATLIGVIGIPLCTLAAFVGLLVFNRTINVISL
                     AGVAFAIGMTVDNSIVVLESIEQARRRGLNRLEAAISGIYDVWPAVLASTLTTVLVFV
                     PILFIKQEAGQLYSDIAIAIASSIIASMLVAVFIVPAAIARFGFGKMHSAQTNQSEPP
                     KASRILSLVSQLVLSAKRRAAVIVLSLVSTIGLAAWLMPPAEYLPEGEEPKAFTSMVA
                     PPGYNLSEMAKIAEELTTQLSARVNAEATSFESGEQKIPPLKYYTLSVGVGSIWVMSE
                     PVRSQDMEAMMSSLTALFEQYPGMRAYSSRGSIISSNDGGTRAVALDISGPNQASLYR
                     AAEAAYQAAEKVFAEPQLYSDPSTLSLDQPLWQISPRWQRLVEQDFSGSEFGYAVSAL
                     SDGAYVDEFFLNDNKVDIFLFSLAGNQQSLSQLALAPIVTPKGNVLPLQALADISEQM
                     DSDSLRRVDGRRTVTLYIIPPRAIALETAVAKVREELVPILYQQGAVGKDVSLDISGA
                     ADQLEATKAALSSNFLVAVLIIYLLLVAIFNHWGYPLFVLVTIPLGLAGGLVGLQALN
                     YTGSLFAYLGGQGWHQPFDMITMLGFLILLGTVVNNPILIVEQSRKNLQSGLFSVVDA
                     VKSAVANRLRPILMSTATTLFGLLPLVLFPGAGSELYRGVGIVVLAGLIVATLLSLTF
                     LPALLISVLSYTNRANLTASSAKVAHHHD"
     gene            complement(127143..128192)
                     /locus_tag="SBAL_RS00555"
                     /old_locus_tag="Sbal_0112"
     CDS             complement(127143..128192)
                     /locus_tag="SBAL_RS00555"
                     /old_locus_tag="Sbal_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_011845411.1"
                     /db_xref="GI:500170986"
                     /translation="MRYLMIGLYLLCFAVHASAVPVTVALPQTGSTNELLPLSGSIKS
                     ARVARLSARTDGLVAKVLVDAGSQVRAGQPLLALDDTLAVHQLAQRQADVIAVKTMLA
                     EKQRLLTEAQTLSAQQLFPETERAIRQAALTEAEANLQSLTAALAHQKEVVARHQLMA
                     PFAGVISSKQTETGEWVNVGTEIFTLVSQEQLWLDIQVPQEMFQSVATATHVDIAADM
                     LPEQQFIGHVNALVPVSDHNARSFLVRLTIPEADGLLMPGTSATATFHLQRAQHSVVV
                     PQDALIRHPDGQFSVFTVQNNIAQRHTVQVGHTSAIGIEILSPLPKDAPVVIRGNESL
                     QDQQSVSVLNSVIGG"
     gene            complement(128220..128861)
                     /locus_tag="SBAL_RS00560"
                     /old_locus_tag="Sbal_0113"
     CDS             complement(128220..128861)
                     /locus_tag="SBAL_RS00560"
                     /old_locus_tag="Sbal_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter"
                     /protein_id="WP_011845412.1"
                     /db_xref="GI:500170987"
                     /translation="MKQALVLLTLLGGIAFSAQAHEVWLERSSDGSVKVQFGEPGSEY
                     ATAEELASLSAARIFDANAKAPLTATAQADHLLVKTQDGKSDVSFYADTAWQPWKTET
                     GLQAAILYARTGQEHTKALQDFEFTPVKSGDPEFVLSYKGAPLVNHPVQVYRPGFWSK
                     SFTTDAQGKFALDTPDAGRYLLVSNHTTEGKQTLAGNEVDSVLHITTTSFITQ"
     gene            complement(128902..131088)
                     /locus_tag="SBAL_RS00565"
                     /old_locus_tag="Sbal_0114"
     CDS             complement(128902..131088)
                     /locus_tag="SBAL_RS00565"
                     /old_locus_tag="Sbal_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011845413.1"
                     /db_xref="GI:500170988"
                     /translation="MPPLSVLTSWRSPLIPVLLSTLTLTVQANTDPKQDEKEDTEQIE
                     RLNVVGTYTRAAMNSATGLSMSLKETPQSVTLITEEMISDKGLITMESVLNHTPGVTM
                     VGDASENSKIFVRGYALDSGVQIDGLITTSSSNVYSGSIDQGLDPVIAERVEVLKGAA
                     GILSGLGEPSATVNFIRKRPTDDTRATASVSYGSWNTYRLEADVSGWLTDSGNVKGRF
                     VSAVKKGDSFIDRYQRDTTVLYGVVETSLSTDTSLSLFADYQKSQTDGVYNWNSNPAF
                     YTDGTAVDFGRSYSSSQDWTHWDVTQKSLMAEFKHRFDNDWSLVSAYRIANATIDALA
                     FYPGDNIVKSTGEFVGPWGDTYAAQHDRESDTNSFNLYATGNFDLLGREHSAVIGFNY
                     GDNEFDNINTNSAPQRRYNVADQGNYPKPNLPNSPTNGQKNEQSQSGVYGTVRINVLD
                     SLKLMVGGRVSNWSYEKHDLVGNSTDATMEKTGIFIPYYGLVYDVTEQISVYASRTEI
                     FKPGTYFGEDGQLLEPAEGTNVEGGIKVALFDDTLNMSAAVYETNKDNEPEYAGKGQL
                     PSGDFIYESIDGITTKGYELEIAGRLTDLWDISGGYTHNDAEDEDGLRRQTYLPEDIF
                     KLTTKYNFEDILPGVTAGASWRWQSSTFYQGTIWGVDGAPNVAYRQAQSAYSLVDLMF
                     GYQITPSISMQVNINNIFDKNYNRSLWGYADFGEPRNATLSLRWTL"
     gene            complement(131491..132738)
                     /locus_tag="SBAL_RS00570"
                     /old_locus_tag="Sbal_0115"
     CDS             complement(131491..132738)
                     /locus_tag="SBAL_RS00570"
                     /old_locus_tag="Sbal_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl phosphate reductase"
                     /protein_id="WP_011845414.1"
                     /db_xref="GI:500170989"
                     /translation="MTLIKNLSQEAAKAALILAQVDEQLKNTVLLDMARSLREKSYEI
                     QSANLIDLHRATADNVAPAMLDRLTLTPERVEAMALGIETIAALPDPIGNERYIGQRP
                     NGLSISKMRVPLGVVCMIYEARPNVTADAGALCFKSGNAVILRGGKEALHTSKIIATI
                     LQSVLKQYGLPEALITVVPDPDRALMLELMQQRDYIDVIIPRGGEGLINFVSDNSKIP
                     VIQHFKGVCHLYVDKDADLDIALDLLLNGKTQRTGVCNALEALLVHQEIASQFLPKVA
                     KALAEHKVKINACTQSGGYFENCTYMEEDDFGQEYLDLEIAIRQVDHFDHAIQHIARF
                     GSQHTEVICTENEVTAARFQRAVDASVVMVNASSRFSDGSELGLGAEIGIATSKLHAY
                     GPMGLESLTAEKYLVSGTGQVRA"
     gene            complement(132787..133887)
                     /locus_tag="SBAL_RS00575"
                     /old_locus_tag="Sbal_0116"
     CDS             complement(132787..133887)
                     /locus_tag="SBAL_RS00575"
                     /old_locus_tag="Sbal_0116"
                     /EC_number="2.7.2.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="WP_011845415.1"
                     /db_xref="GI:500170990"
                     /translation="MTDLPWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQG
                     IQVVLVSSGSVAAGWHHFGEVDKPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLT
                     HGDLRNRDRYISIKDTIFSLLEHGLLPIINENDAVTADKLKVGDNDNLSAMLAAAADA
                     DTLIICSDVNGLYTQNPHENPDAQLIKQVTEINAEIYAMAGGASSAVGTGGMRAKIQA
                     AKKAISHGIETFIINGFDADSFNQLLKGQNPGTLFTPDEKPMQDHLHWMTHTSQAQGE
                     VIVENDFNISLDIHSEQLTSDDVVAINGDFSAGDTILVRKGDGTKLAKAKSNYSSCLL
                     SFITDQDDREFASEFQQKTGPIISEKNIAILE"
     gene            complement(133899..135395)
                     /locus_tag="SBAL_RS00580"
                     /old_locus_tag="Sbal_0117"
     CDS             complement(133899..135395)
                     /locus_tag="SBAL_RS00580"
                     /old_locus_tag="Sbal_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090617.1"
                     /note="involved in the sodium dependent uptake of proline;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline:sodium symporter"
                     /protein_id="WP_006079435.1"
                     /db_xref="GI:492986526"
                     /translation="MNYLAYISLAIYFIVMLAIGLFAYKKSTSDVSGYILGGRKVSPQ
                     VTALSAGASDMSGWMLMGLPGAMFLVGFETIYIALGLLIGALINYLVVAPKLRVYTEV
                     ADNALTIPEFFAKRFGNANGSIRIISAVIIVIFFTLYTSAGLVAGGKLFESAFGLNYD
                     IGLVVTLAVVVSYTLLGGFLAVSLTDFVQGCIMFVALVLVPVVAYQEFTSADTMLNFA
                     YQSIPHFTDAMQNVTMLGLISSLSWGLGYFGQPHIIVRFMAIRSVADIKTARHIGMGW
                     MTVTIVGALATGLVGIAYANKFGMKLTDPETIFIVFSELLFHPIISGFLLAAILAAIM
                     STISSQLLVSSSSLTEDIYRVISKKESTEKDMVKMGRFGVAGVAIVASLLALDRSSSV
                     LSLVSNAWAGFGAAFGPLVLFSLYKANLTHKAAIAGIVSGAATVLFWIYAPVLADGQA
                     LTTVVYEMIPGFAVSSVVIWIVSLLDTDPCAKTTKLFHKAGRVLAEDR"
     gene            complement(135739..137811)
                     /locus_tag="SBAL_RS00585"
                     /old_locus_tag="Sbal_0118"
     CDS             complement(135739..137811)
                     /locus_tag="SBAL_RS00585"
                     /old_locus_tag="Sbal_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein"
                     /protein_id="WP_011845416.1"
                     /db_xref="GI:500170991"
                     /translation="MTLLLKSLFFPDRRTLIFAIKGVISMELALYVAMFLNLERPYWA
                     LVSAVFLQIRPESGLVIEKGLCQIGGTLVGALAGIAILNWFTPYPELALGLLACWIGL
                     NSGLSAMVRQQNFVYAFAMAGMTACLIVLIVMASPSTADSAKIFDVAQSRISEIVVGA
                     ICAVLVSSLLWPTKVKHSLQLHAKNTINHTLNYLALELDLQGEHTSRHEHIDTIMVSV
                     SALSDDSSAVIYEGPEGRGQSHAANFLCNKTLSLLAAIQIFGRLQRNHSHLVSEPLAK
                     SLANMRSSFTLMAQSSDYQECYKMARTLRYQLQQNLMQYRDRAPLETRLLKVAMELSA
                     DLIMVLKSYNVLTSHSAVQLNAPPMEFHRDPLIGVTTGLRSMAVFVIGASLWIGTGSS
                     AVLMMILLPVVFSIMMARQPLPMLTTILRRILVGITIAVPLTVFYALPLLAQSSGDFE
                     ILVLVLAGPFFIGLLALANRPTLPYGLGICVPFAVLVQPSNTISFAIENTVSNALAIF
                     VGVTVLYWLFKLITEPSQRLMQYRLLQSIQKDLVHIAQHDDPEPWFNARMGDRLLRIA
                     SYEKGSGKSSRVFTDLVFTALNLGHVSIRMRRMLQGISDTHLNLGLENALNLWQHNLG
                     QAFIACAHGQVAEEFKISSEALLEALAQCPLPHEQFTMITGMFERITLTFERTAHSIA
                     EQKNTSEK"
     gene            complement(137817..138680)
                     /locus_tag="SBAL_RS00590"
                     /old_locus_tag="Sbal_0119"
     CDS             complement(137817..138680)
                     /locus_tag="SBAL_RS00590"
                     /old_locus_tag="Sbal_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HylD"
                     /protein_id="WP_011845417.1"
                     /db_xref="GI:500170992"
                     /translation="MGKIFRISLTLIVVAVAGIAGHWIWSHYLYSPWTRDGRVRAEII
                     TIAPDVSGWVNQLNVKDNQVVNKGDVLFTVDDTRYKATIAELNAKAESQKLAWELAKH
                     KYKRRIGLTNDNLVSKETFDEAFINTELARTSYELAQAQLNTAQIDLARTQIHAPENG
                     TLINLSLRNGNYVSKGNSVFSLVKQDSFYITGYFEETKIPLVHIGQNADVSLMSGGHV
                     LHGKVTSIGKAIANTNVTTNGQLLPQIGQTFNWVRLSQRIPVDIQLDSIPKDIELSVG
                     MTVSIQLQTDK"
     gene            complement(138687..138887)
                     /locus_tag="SBAL_RS00595"
                     /old_locus_tag="Sbal_0120"
     CDS             complement(138687..138887)
                     /locus_tag="SBAL_RS00595"
                     /old_locus_tag="Sbal_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079439.1"
                     /db_xref="GI:492986530"
                     /translation="MLKELAFDGLLFSPLIIFIPLAFLLSCITRLVLYQTGLYHKLWR
                     EAWFEVGLFICYLALVIYLLGS"
     gene            complement(139069..140424)
                     /locus_tag="SBAL_RS00600"
                     /old_locus_tag="Sbal_0121"
     CDS             complement(139069..140424)
                     /locus_tag="SBAL_RS00600"
                     /old_locus_tag="Sbal_0121"
                     /EC_number="1.8.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084672.1"
                     /note="catalyzes the reduction of 2 glutathione to
                     glutathione disulfide; maintains high levels of reduced
                     glutathione in the cytosol; involved in redox regulation
                     and oxidative defense; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione reductase"
                     /protein_id="WP_011845419.1"
                     /db_xref="GI:500170994"
                     /translation="MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVN
                     VGCVPKKVMWYGAHVAEAMNLYAKDYGFDVTVNKFDWNTLVENREAYIGRIHDAYGRG
                     FANNKVTLLNGYGRFVDGNTIEVDGEHYTADNILIATGGAPTIPDIPGAEYGIDSDGF
                     FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVEAM
                     ATEGPTLHTHSVPKAVVKNADDSLTLSLENGESITVDCLIWAIGRSPATGNIGLENTE
                     VQLDSKGYVITDEQQNTTHKGIYCIGDIMAGGVELTPVAVKAGRLLSERLFNGMTDAK
                     MDYSLIPTVVFSHPPIGTMGLTEPEARTHYGDDNVKVYTSTFTSMYTAVTAHRQACKM
                     KLVCAGKDEKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTM
                     R"
     gene            complement(140604..141167)
                     /locus_tag="SBAL_RS00605"
                     /old_locus_tag="Sbal_0122"
     CDS             complement(140604..141167)
                     /locus_tag="SBAL_RS00605"
                     /old_locus_tag="Sbal_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845420.1"
                     /db_xref="GI:500170995"
                     /translation="MLAQHFYLIRTAVIALLLLFLPVIHSADARQLLELEPESEPSLE
                     SLSQSTQTAPLPLGTLLDSEGKPINLPDQEQSSFEYSAPTLTPAEPSKATKSTKDTQS
                     TKATKSKKLSRKQQLASREHVANDPNCRWLDKRMDQLEAQLGGKQDNAATHQADELSA
                     RQKEWQCLKCGAEGPAQNDHSNCQYRR"
     gene            complement(141335..142126)
                     /locus_tag="SBAL_RS00610"
                     /old_locus_tag="Sbal_0123"
     CDS             complement(141335..142126)
                     /locus_tag="SBAL_RS00610"
                     /old_locus_tag="Sbal_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845421.1"
                     /db_xref="GI:500170996"
                     /translation="MATHSVKLMASILCTLGINGLSYNAFANESLESIESISSAGLSS
                     QNSQALAVTLDLGWDSQYVSQGRNNLQDGGIYWLNTAVQQDNITAYALVGRGDSQAYT
                     EWNIGLEYGFDVAENLEANVGYQRIEGYSNTRCHDNELFAELAYTAEPWLVPSASYVY
                     STEAAGYFVEVSLHSYWHVTDQLSLTPYITQGFDFKYRTEEHDGRNNLQFGLEASYQL
                     SSYMSIDGHISHSIAQEDIEQEAMANGDMSSQDETYAGIHFAITF"
     gene            142395..144434
                     /locus_tag="SBAL_RS00615"
                     /old_locus_tag="Sbal_0124"
     CDS             142395..144434
                     /locus_tag="SBAL_RS00615"
                     /old_locus_tag="Sbal_0124"
                     /EC_number="3.4.24.70"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007652134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="WP_011845422.1"
                     /db_xref="GI:500170997"
                     /translation="MSNPLLSGAKLPLFSQIKPEHIQVAVEHAIAQCRTKIDEVLQNQ
                     GPYTWDNLVAPLEQVDDELSQIWSPVSHMNSVTSTDEWRAAHDACLPLLSEYGTYVGQ
                     HQGLYQAYKALRASNEFAQLSQAQQRVIEHSLRDFELSGIGLDDAQKVRYGEMVKRLS
                     ELTSGFSNQLLDATQAWTKLITDEAELAGLPESAKAAAKAMADARELDGWLFTLDFPS
                     YLPVMTYSENRSLREECYRAFVTRASDQGPNAGEFDNSPLMDEILALRHELALLLGFD
                     SFADKSLATKMAETPAQVMAFLNELALRSKDQAKAEVAELRAFAEAQYGVSEMASWDL
                     SFYAEKLQQHKYEISQEILRPYFPEDKVLSGLFYTVSRLFGLKIVEQKDLDRWHKDVR
                     FFDIFDETGEHRGSFYLDLYARTGKRGGAWMDDCRVRRQTAHGLQKPVAYLTCNFNGP
                     VDGKSALFTHDEVTTLFHEFGHGIHHMLTKIDVAGVSGINGVPWDAVELPSQFMENWC
                     WQEEALAEISGHFETGEPLPKALLDKMLAAKNFQSGMMMLRQLEFSLFDFRMHHEYDP
                     AKGARIQETLDEVRRQVAVLTPPDFNRFQHGFAHIFAGGYAAGYYSYKWAEVLSADAF
                     SRFEEEGIFNPETGRRFLHNILEMGGSAEPMDLFKQFMGREPNIDALLRHSGIAA"
     gene            144619..145149
                     /locus_tag="SBAL_RS00620"
                     /old_locus_tag="Sbal_0125"
     CDS             144619..145149
                     /locus_tag="SBAL_RS00620"
                     /old_locus_tag="Sbal_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_011845423.1"
                     /db_xref="GI:500170998"
                     /translation="MNLYFRLFWLLFWRTRHCRKIDFLGTSRITYRALPSDCDINFHL
                     TNSRYPAFMDLARTYMLAEMGLLKRFLKLKWMPIVNAAEFTYIRDIKPLKTFEIETKV
                     VGWDEKYFYIEQRFASERGLHCIVHVRGVFVCKGKQVPLDVLVKEAGYTDAAPELPPE
                     VVKWKAFLQLKKERNM"
     gene            complement(145175..145822)
                     /locus_tag="SBAL_RS00625"
                     /old_locus_tag="Sbal_0126"
     CDS             complement(145175..145822)
                     /locus_tag="SBAL_RS00625"
                     /old_locus_tag="Sbal_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_011845424.1"
                     /db_xref="GI:500170999"
                     /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRIIDLRDPFSRKEFHQ
                     TYPQARVPLLKTHDELLVPESSIIIEYLDRHCNNSTQLLPQEPQRNLQVRLFDRIIDN
                     DINNPLFQLEKLKHTEDSNEFEIKQLEKQLLVQFQRLDTQLTQHHWVCGDSFTLADCA
                     LIPCLSYSFQHLNLLDLDEIVRYWQQAQLRGAWMLVQEEVLLAEMEETAGIRGIP"
     gene            146030..146719
                     /locus_tag="SBAL_RS00630"
                     /old_locus_tag="Sbal_0127"
     CDS             146030..146719
                     /locus_tag="SBAL_RS00630"
                     /old_locus_tag="Sbal_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_006084667.1"
                     /db_xref="GI:493001191"
                     /translation="MSQLERFSSIYARASERKGGAAGLEALLSGCLSDDEIRQYRDAE
                     LLSAMSRQVFQSGFVWRVVVNKWPEYEKSFFGFEPHKVLMLSPEQIQARASDATLIRH
                     LKKTQAIYDNALMIHDVAREHGSLAQLIAAWPTQDIIGLWALLKKRGTRLGGNTGPYF
                     LRGIGKDTFLLTDDVQGYFKAHKLVDAGFTSQTALKQVQAVFNQWQQESGRCLADISR
                     ILACSVGDNRI"
     gene            complement(146852..147589)
                     /locus_tag="SBAL_RS00635"
                     /old_locus_tag="Sbal_0128"
     CDS             complement(146852..147589)
                     /locus_tag="SBAL_RS00635"
                     /old_locus_tag="Sbal_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079449.1"
                     /db_xref="GI:492986540"
                     /translation="MKTRTKFLLSGALLSLAMTAQAADDNQLFGGTINANVNFASDYV
                     FRGESETLDGDIPVVQGTLSWNHNEGWYAGVFSSNIKFADPNLEIVTAPFIGKAGEFG
                     DSGFTYDVMLFSYLYPGASYSNYTELWLKVGKQFGRANLQLEVTPTVDDWFGVDGWHG
                     VNYALHPSYNFDNGVKISGSVGYQDLSGEGAEGWGHWNLGLSKVFYGLNFDVRYHGST
                     VDTDHKVYGTQTEIFDDRFVVGISKSF"
     gene            147869..148369
                     /locus_tag="SBAL_RS00640"
                     /old_locus_tag="Sbal_0129"
     CDS             147869..148369
                     /locus_tag="SBAL_RS00640"
                     /old_locus_tag="Sbal_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011845426.1"
                     /db_xref="GI:500171001"
                     /translation="MNYQRHSGQFKEAILNKLSQSGLSVRQFAEQEGINLSTLYSWQK
                     QFNTSGLNVSKVSSSDKWSSEEKFSVVLETASLSAVELSEYCRAKGLYPEQVNGWKQA
                     CIAGNTSTTLTSKAKTTPGQKTDKKRINELERELRRKDKALAEAAALLVLGKKFDAYW
                     KEKEED"
     gene            148492..149409
                     /locus_tag="SBAL_RS00645"
                     /old_locus_tag="Sbal_0130"
     CDS             148492..149409
                     /locus_tag="SBAL_RS00645"
                     /old_locus_tag="Sbal_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041410793.1"
                     /db_xref="GI:752763677"
                     /translation="MDGDISADKRPTATRPEPGNKLSQAERQAVIDVCNSEEFASLPP
                     SQIVPILADRGEYIASESSFYRVLHTENMLHHRGKAKPRNVHKKPTSYTAKKANEVWS
                     WDISYLPTTVIGKHYYLYMIEDIYSRKIVGWEVHDSETGEQAAALLERTVWSEKCLKK
                     DVVLHSDNGAPMKSLTMRAKMYDLGVVTSRSRPRVSNDNPYSESLFRTVKYHPRWPSE
                     GFKSLEAARKWVNEFVYWYNNEHRHSRIKFVTPNQRHDGLDVGILAKRKALYQTKRNE
                     HPKRWSKEERNWQPIGAVELNPEQHKEAA"
     gene            149555..149845
                     /locus_tag="SBAL_RS00650"
                     /old_locus_tag="Sbal_0131"
     CDS             149555..149845
                     /locus_tag="SBAL_RS00650"
                     /old_locus_tag="Sbal_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011840012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011840012.1"
                     /db_xref="GI:500165396"
                     /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLY
                     NWKEKHEALKQGITLEESERDELKRLRRENKELRMEKEILKKASAFFAREMK"
     gene            149905..150714
                     /locus_tag="SBAL_RS00655"
                     /old_locus_tag="Sbal_0132"
     CDS             149905..150714
                     /locus_tag="SBAL_RS00655"
                     /old_locus_tag="Sbal_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011494884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011840011.1"
                     /db_xref="GI:500165395"
                     /translation="MSVSKSGYYDWHKRPANVISLETLKLYRLVRQLFKQSRGSLGNR
                     EMVKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNP
                     VSANEVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALIKAYNL
                     RQPARGLVFHSDRGSQYTSKQFGRLLLSYGIRASMGDVGACWDNAVVERFFGSLKHDW
                     IFKVNQPTREFMKQDVTAYMKYYNLERLHSANGDLSPVEFENSQLKVSSLG"
     gene            complement(151077..152219)
                     /locus_tag="SBAL_RS00660"
                     /old_locus_tag="Sbal_0133"
     CDS             complement(151077..152219)
                     /locus_tag="SBAL_RS00660"
                     /old_locus_tag="Sbal_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_006079581.1"
                     /db_xref="GI:492986672"
                     /translation="MPFRIVQGTIFVPLNTNTQHLNPTIPIKHVQPLLASSKYPHSLL
                     KYQHHKSVVKGPVSTQDTIDGPNQVTDFSHRLFEVAVNDHQERQQRLSKPLTGHDHAS
                     LNHIKRLVVIGDSLSDSEGRMKSKTLGIMLSSKQYHDGRFTNGFVWPDFISSPAYLNK
                     ELVNYAEGGAVAAKYSKLNPVFWFISNMERQIKKHDFRSNDLVILALGSNDYMTFDKK
                     DTQKVVHCYEKQITTLVENKKIKNILVTGIPDFTKTAYAQKQDEAYHASNSVLVSGHN
                     ASLSQKVTELAERYKAEGVNIQFFDFDNQFTELLDKADKAGYDTHTANSVGYVDIFGT
                     SKAFDPAHRHVFHDEVHPSQEVHQMLASRMSDYITGKFGKLTTIKN"
     gene            152922..154133
                     /locus_tag="SBAL_RS00665"
                     /old_locus_tag="Sbal_0134"
     CDS             152922..154133
                     /locus_tag="SBAL_RS00665"
                     /old_locus_tag="Sbal_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytotoxic necrotizing factor"
                     /protein_id="WP_011845428.1"
                     /db_xref="GI:500171003"
                     /translation="MPMHIFSKANSYDLLTPNLKNSDNASPIQLVSVRPLTEQERKNL
                     TKKNQTYSNFTKNNKSIKSANGLTKIKSLFDNSSGKNKIVSKRGLTIEVKKGSTEEAS
                     AQWKNDPLRNHFKSAELSLQSLLDKEAVLQGQLSPLIGKGIIDCHEKYEYLPFPITHI
                     QNDKNGMYVSSDTIESKTGLIYYTGDHIVPEELIPGSPLGQYFHQAVFDSNLHILAVD
                     NGNKGTVGISFDLNQVKEGQPILIHAGSLSGCSVVFATKSSKLFAFHAGQNNNENNDW
                     ITGEKGAESIAQSAGFLANDTSNTLPCTNNQELVSYLSSHFEQSAFIYCGHGDSVVSQ
                     SNVNCFDYDMGPKRDEARVGNAMALVSNNKGKISVNVLGDDLSIDSGSFETRSLQNST
                     FALFTDKEFSR"
     gene            complement(<154304..>154961)
                     /locus_tag="SBAL_RS00670"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            155338..155841
                     /locus_tag="SBAL_RS00675"
                     /old_locus_tag="Sbal_0136"
     CDS             155338..155841
                     /locus_tag="SBAL_RS00675"
                     /old_locus_tag="Sbal_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="WP_006079584.1"
                     /db_xref="GI:492986675"
                     /translation="MKAHLITRQGWQTLDKELKYLWKEYRPQITLKVQEAAAQGDRSE
                     NADYTYNKRLLRQIDGRVRYLVKRLEELKIVDYSPQQEGKIFFGAWFELENEAGDRVR
                     YRIVGKDELDTKLGYITIDSPMARALIGKQVDDEVVVQTPSGPKEWYINQIRYTPFET
                     TLASEAD"
     gene            156005..158368
                     /locus_tag="SBAL_RS00680"
                     /old_locus_tag="Sbal_0137"
     CDS             156005..158368
                     /locus_tag="SBAL_RS00680"
                     /old_locus_tag="Sbal_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription accessory protein"
                     /protein_id="WP_011845430.1"
                     /db_xref="GI:500171005"
                     /translation="MQTNAHNIAQIIAQELNVREQQVAATITLLDDGATVPFVARYRK
                     EATGGLDDTQLRTLYTRLGYLRELNDRRQVILSSIQAQGKLTPELQRAIDDADSKTRL
                     EDLYLPFKPKRRTKGQIAIEAGLEPLADALLADRSADVEAKAAGYINSDAGFVDVKAV
                     LEGARYILMERYAEDAELLRKVREHLSQNSVLESRLIAGKEKEGAKFRDYFEHTEQLA
                     KIPSHRALAMLRGRNEGFLALSMNADPAAEAGQGSYCEVIISDHLGLKLGDSSVDQWL
                     KTVVTATWRIKIALQMETEFISQMRERAEAEAIKVFARNLGDLLMAAPAGAKATMGLD
                     PGLRTGVKVAVVDNTGKMLCHATIFPHAPQNLWEKSIRTLANLVKMHKVELIAIGNGT
                     ASRETDKLAAELIAAVKDTHPQLTKVMVSEAGASVYSASELAALEFPDLDVSIRGAVS
                     IARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSGSLEAVVEDCVNGVGVDLNMASA
                     PLLSQVAGLNKTLAKNVVDYRDANGQFKNRKELLKVPRLGPKAYEQAAGFLRIREGDN
                     PLDASSVHPEAYSLVETIAKTKQVELASLMGNSDLLRSIKPEEFITAEFGLPTVTDIL
                     AELDKPGRDPRGEFKTAKFKDGVEELKHLKPEMVLEGVVTNVTNFGAFVDIGVHQDGL
                     VHISSLTDKFISDPHTVVKAGDVVKVKVMEVDVERRRIGLSMRLDEAIDQSKSQQRPH
                     NPARTHNSKAPQSAKPAARPTQKQAPKAPANAAMGNAFADAFAKLKK"
     gene            158586..160550
                     /locus_tag="SBAL_RS00685"
                     /old_locus_tag="Sbal_0138"
     CDS             158586..160550
                     /locus_tag="SBAL_RS00685"
                     /old_locus_tag="Sbal_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845431.1"
                     /db_xref="GI:500171006"
                     /translation="MQSGLSPRGHNNAHGPFRAIFIFSLLVLFITTASRIAFGLWQAD
                     RVAAVDGWSHLLIQGFRIDIATLCWLWGIAALGTALFSGDHLIGRLWQPILRVWLTVG
                     LWIILFLEASTPAFIEEYGIRPNRLYVEYLIYPKEVLSMLWAGRKLELIFSVLLTIGT
                     LWGGWVLSGKLTKNLRFPRWYWRPVLAVLIIATTLLGARSTLGHRPINPAMVAFADDP
                     LVNSLVINSAYSLVFAIKQMGSEEDASKVYGKLDNAEIIATIRQESGRPESAFTSTDI
                     PSLSFNQASYTGKPKNLVILLQESLGARFVGSLGGLPLTPNIDALSKEGWYFDNLYAT
                     GTRSVRGIEAVTTGFTPTPARAVVKLGKSQVGFFSIAELLKNHGYTTQFIYGGESHFD
                     NMRSFFLGNGFSDIIDQKDYKSPAFVGSWGASDEDLMRKANSEFERLHSEGKPFFSLV
                     FSSSNHDPFEFPDDRIELYEQPKQTRNNAAKYADYAIGEFFKLAKNADYWKDTIFIVV
                     ADHDSRVGGADLVPVSRFRIPGLILGDNLAPKRDHRIVSQIDLPPTLLSLIGISDSYP
                     MLGRDLTQVSDDWPGRALMQYDKNFALMEGKDVVILQPEKAAQGFEYNEKTEQLTPYA
                     PAAAALEKKALSWALWGSLAYQQELYRLPK"
     gene            complement(160648..161205)
                     /locus_tag="SBAL_RS00690"
                     /old_locus_tag="Sbal_0139"
     CDS             complement(160648..161205)
                     /locus_tag="SBAL_RS00690"
                     /old_locus_tag="Sbal_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845432.1"
                     /db_xref="GI:500171007"
                     /translation="MLVVSNYPQVPLATSNVATDSARVDNQLKPVVIPPQAATKGHEE
                     RAFNPQNERTADQTQQQTKTLENNQQQVQEKQQQQQSSQQQSQQQQEKKAPLVVAERV
                     LPKTLKVAARGQAALQRKDIRLKVSQGAANYASSNAKANTSSAARQSLQGEPTQFYQQ
                     LGQRIGQFYQQQTQPEQESIMSTWI"
     gene            complement(161267..162061)
                     /locus_tag="SBAL_RS00695"
                     /old_locus_tag="Sbal_0140"
     CDS             complement(161267..162061)
                     /locus_tag="SBAL_RS00695"
                     /old_locus_tag="Sbal_0140"
                     /EC_number="3.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pimelyl-ACP methyl ester esterase"
                     /protein_id="WP_014620546.1"
                     /db_xref="GI:504433444"
                     /translation="MSQVTSTNHANLHIEIRGQGPDLVMLHGWGVNSAVFTPLHESLS
                     QYRVHYVDLPGFGHSQMVEGDLLAWVDVLVAALPEHAIWAGWSLGGLVATQAALSYPQ
                     KIKGLITIASSPCFMAREDEAWPGIPPQVLNQFREQLGQNLPKTIERFLAIQAMGSET
                     AKEDIKRLRDLVLARPLPDARALTQGLTMLTDIDLRQQLTGLQQPWLRIWGRLDGLVP
                     KRVQPKMPITPQIEDVMLAKASHAPFISHQQEFLQIFMPWLALQTR"
     gene            162094..162885
                     /locus_tag="SBAL_RS00700"
                     /old_locus_tag="Sbal_0141"
     CDS             162094..162885
                     /locus_tag="SBAL_RS00700"
                     /old_locus_tag="Sbal_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComF"
                     /protein_id="WP_011845434.1"
                     /db_xref="GI:500171009"
                     /translation="MSRFVKRIWPPSAWRIVCLGYQLSTRWLAGSLPNRCLLCHQSIP
                     IPETGICIVCLQSGLYHGPICLGCGKSMQIEVDYCGECQKRQPRKVVAPCSYHQGLGA
                     WIGAIKYQGQLAALPVLCRALVARIKLLEQQGLIMLPQAIVPVPLHPKRLQQRGFNQA
                     WLIAHELSQLLQLPLVSEGLTRQQDTRPQAGLSGAQRRRNLHDAFMLADDFAFQRIAL
                     VDDVVTTGTTVSEIARLFEARYVHVQVWCLARAEAPGLLDDLDNE"
     gene            163127..163705
                     /locus_tag="SBAL_RS00705"
                     /old_locus_tag="Sbal_0142"
     CDS             163127..163705
                     /locus_tag="SBAL_RS00705"
                     /old_locus_tag="Sbal_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007652035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fe/S biogenesis protein nfuA"
                     /protein_id="WP_006079591.1"
                     /db_xref="GI:492986682"
                     /translation="MITISDAAQAHFVKLLADQPEGTHIRVFVISPGTSQAECGVSYC
                     PPDAVESDDIEIEFTGFNAMVDEKSAPFLEDATIDFVTDQLGSQLTLKAPNAKMRKVS
                     GDAPLVERIEYVIQSEINPQLAGHGGNIMLVEITKEGVAVLQFGGGCNGCSQVDITLK
                     DGIEKQLLDMFPGELTGVRDVTDHQHGEHSYA"
     gene            complement(163789..165726)
                     /locus_tag="SBAL_RS00710"
                     /old_locus_tag="Sbal_0143"
     CDS             complement(163789..165726)
                     /locus_tag="SBAL_RS00710"
                     /old_locus_tag="Sbal_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="WP_011845435.1"
                     /db_xref="GI:500171010"
                     /translation="MKRILPLLFLWLCNHAVADTASQLPVEAFASIPDVSSVQLSPNG
                     KKLASVVRVDQAKLKGTVVSIQDIETGEKSIPLHTDNQKFVILSLQWANDNILLISAK
                     FPANRYGTPTTETRLVKYDLTTKKTSSVLPRSVLDRLNWIPQHQGQIIDLMADDPDNI
                     LLSLDGMGENVGEDSVLKVNLAQGKSSYTQNAKKKIISWITDRQHKVRISIYNDDTEY
                     RIYEQAEQKRDSRLLWTFKAFSEDSIWPLGFDADPNILYVRAYHQGFEAIFKVNLTDP
                     KLTKELVYANENTDVEGNLLYSKLKKKVIGISEGDGEEYTFWEKEYVGLQNGLKAVLP
                     NAHNYITQFSADERRYIVYSTSSTEPGTYYFGDRDEKTLYPIANRYGRLKSELLADTQ
                     YLTYEARDKLKIDAYLTVPKGLEAKQLPTIIFPHGGPISYDSNDFDYWAQFFANRGYA
                     VFRMNFRGSAGYGYEFMKAGLKSWGLEMQNDVEDGTRYLIAQGISDPKRICIVGASYG
                     GYAALMGAAMTPDLYRCAVSVAGVTDVAYLVKSSRRFTNYKVVKEQIGDDFDALYDRS
                     PISKADKINIPVLLLHGDKDRVVKVQHSREMYDELKSLKKPVEYIELENGDHYLSNND
                     NRLATFKALDKFLADNLNPKL"
     gene            complement(165807..167174)
                     /locus_tag="SBAL_RS00715"
                     /old_locus_tag="Sbal_0144"
     CDS             complement(165807..167174)
                     /locus_tag="SBAL_RS00715"
                     /old_locus_tag="Sbal_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MatE"
                     /protein_id="WP_011845436.1"
                     /db_xref="GI:500171011"
                     /translation="MNTAKSTWLDLMLNCAKNRQLLALALPMILSNITIPLLGLVDTA
                     VIGHLSEAYYLGGVAVGSTIITLIIWLLGFLRMATTGLVAQAYGANDLHAQHKLLVQG
                     AMLAVLLGAGVIALQVPILNLALGLSEASSEVERYCREYFQVRIWSTPFALLNLVMLG
                     WLLGRQQPKAAMWQLILANLANIILDVVFVLGLGWGVKGAALASVFADITAFSVALTM
                     VLQQLKREADFHLSQLLPHVTLTGYGKLLRLNTDIFIRSLCLQAAFAFMTFHGAGLGD
                     NTVAANAVLLNLLLLISYALDGIAYYAEAEVGRAYGQKQAEQLREAVILAWSWSAITA
                     LGFCAVFSLFGSNIIALLTSINEVRATAQTYLIWLIFLPLWSFSSYLFDGVYIGAAKG
                     KVMRNSMILATFGAFFPTWYLLQQLLLPEQGNHALWAAMSVFMIARSLTLTGHYYFSK
                     DFLNK"
     gene            167197..168243
                     /locus_tag="SBAL_RS00720"
                     /old_locus_tag="Sbal_0145"
     CDS             167197..168243
                     /locus_tag="SBAL_RS00720"
                     /old_locus_tag="Sbal_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_011845437.1"
                     /db_xref="GI:500171012"
                     /translation="MVKRVLLALIGLMTFSAHAVVILQYHHVSETTPAATSVTPAQFR
                     EQMQFLADDGFKVIPLSQVVEAIKQKQDLPAKTVAITFDDGYRSIATTAHPILKEFGF
                     PYTLFVAIEPIKQKFTEMMTWDELITLSKEGADIANHSWAHEHLIRALENESQAQWLA
                     RVKANILDTEKAIADATGHNFKMLAYPYGEYNQALQDMLTENGFVALGQQSGAAGPYS
                     PLTALPRFPVAGQYADLKSLKAKLYSLNMPVIAQSPSDPELKGGHWRPELKVTLDMSD
                     ISAKQVMCYIQGQGSKQPTWLSESEFSVQADLALPAGRSRYNCTAPSKARNGYYWFSQ
                     PWVRPKDDGSWVKE"
     gene            complement(168244..168876)
                     /locus_tag="SBAL_RS00725"
                     /old_locus_tag="Sbal_0146"
     CDS             complement(168244..168876)
                     /locus_tag="SBAL_RS00725"
                     /old_locus_tag="Sbal_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter SenC"
                     /protein_id="WP_011845438.1"
                     /db_xref="GI:500171013"
                     /translation="MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELA
                     PFELVDQHQQAFTNASLQGKWSLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIAPLQVV
                     FLSVDPKRDTPDKLLTYVNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMVGEGENYQVD
                     HSAGYVLVSPQGTRVAVFKPTAALGKPPQVLNDEIISDFRKIVAQYKPSR"
     gene            complement(168924..169829)
                     /locus_tag="SBAL_RS00730"
                     /old_locus_tag="Sbal_0147"
     CDS             complement(168924..169829)
                     /locus_tag="SBAL_RS00730"
                     /old_locus_tag="Sbal_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WU15.1"
                     /note="converts protoheme IX and farnesyl diphosphate to
                     heme O; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase 1"
                     /protein_id="WP_006079596.1"
                     /db_xref="GI:492986687"
                     /translation="MAKPLSITSSLPTFSVTWRAYFEMTKPKVVALMLLTVLVGMCLA
                     VPHAVPVQPLLAGMLGIAMMAGSAAALNHLIDRRIDGLMARTYNRPLPKGRISATRAL
                     IFAASLGSLGFIVLYSLVNPLTAWLTFASLIGYALVYTAYLKRATSQNIVIGGLAGAM
                     PPLLGWTAVTNEFHGHALLLVIIIFTWTPPHFWALAIHRRAEYAKVDIPMLPVTHGVE
                     FTKTCILLYTVLLAIACLLPVLVGMCGPVYFVCSSLLSTGFIYKAWQLKYRDHDGLAM
                     QVFRFSIYHLMLLFMALLLDHYLWN"
     gene            complement(169844..170821)
                     /locus_tag="SBAL_RS00735"
                     /old_locus_tag="Sbal_0148"
     CDS             complement(169844..170821)
                     /locus_tag="SBAL_RS00735"
                     /old_locus_tag="Sbal_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_011845439.1"
                     /db_xref="GI:500171014"
                     /translation="MQLTWVLRLTLVFTLLVILMGAYTRLSDAGLGCPDWPGCYGHIK
                     VPTQDHEIAHAQTIFPDHDIHPEKAWLEMIHRYIAGGLGLLVLFILVLCLKTPEAPKK
                     LPLIIVLLILFQAALGMWTVTMRLMPIVVMSHLIGGFSLISLLLLLYLRTRPRRIFNS
                     ETHARNLAPLALVSLFVLVGQIMLGAWTSSNYAALACTSLPICEGNWVDNLAIAEAFS
                     PFQGQHHSFEFGVLDYPARMTIHIAHRIGAVVTASLLLVLAYRLFVGAAGMRALSLLL
                     VGLVILQVSLGISNVVMHLPLGIAVSHNGGAALLLLTLVAINYFLWRKA"
     gene            complement(170821..171366)
                     /locus_tag="SBAL_RS00740"
                     /old_locus_tag="Sbal_0149"
     CDS             complement(170821..171366)
                     /locus_tag="SBAL_RS00740"
                     /old_locus_tag="Sbal_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845440.1"
                     /db_xref="GI:500171015"
                     /translation="MNSQNKSKHKALGLLLLAFIAPVVIAKLVLSLNLYHGGATNHGE
                     LINPETSYASLGVENPNPKEWQLLYLLPAQCDDACRERLYILRQSHTALGPDQARVEP
                     LILTHPDSDLNALSAFHFNTRPANAGLSHWLDEQQLIIVDPLGSLVLRYPQVQGREAH
                     LAQGKDLVADLRKLLKLSRVD"
     gene            complement(171458..172222)
                     /locus_tag="SBAL_RS00745"
                     /old_locus_tag="Sbal_0150"
     CDS             complement(171458..172222)
                     /locus_tag="SBAL_RS00745"
                     /old_locus_tag="Sbal_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007652020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845441.1"
                     /db_xref="GI:500171016"
                     /translation="MQYPYVLLNKLTVFLLILTVAVFVMLVKLGLWQLARGEEKTMLL
                     AQMEARQSLLPLSFEQLQLKIDKEGVTGYRLHVHAIPASSQIWLLDNQIYQGQVGYLA
                     FQPLQVAAGQPWVLVELGFVAASSHRDELPHISPLSGELNIEGRLYQKQINPLSQALM
                     AETGTSVRFQNLNIPEMAQLLGHPLLDAVLQPDELPALALPHPWQPFPLSAQKHWGYA
                     LQWFSMAAVFAGLMLWQGIKYVKRHSAETIANSRSE"
     gene            172221..172439
                     /locus_tag="SBAL_RS00750"
     CDS             172221..172439
                     /locus_tag="SBAL_RS00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620547.1"
                     /db_xref="GI:504433445"
                     /translation="MNTLFIFKLVLVLLLLFIIFNLGRALFIMVRGDNQVPMSRYLGR
                     RVIFSVLVILLLLVALGTGLISPNPTPY"
     gene            complement(172444..173319)
                     /locus_tag="SBAL_RS00755"
                     /old_locus_tag="Sbal_0151"
     CDS             complement(172444..173319)
                     /locus_tag="SBAL_RS00755"
                     /old_locus_tag="Sbal_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011718712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011845442.1"
                     /db_xref="GI:500171017"
                     /translation="MTTKHENYYVPAQSAWPIIGAIGLFLIALGAGHFVHQLKSGASG
                     GGYILLAGIAVILFMLVGWFRTVINESMTGLYSHQMDRSFRQGMSWFIFSEVMFFGAF
                     FGALFYARMVAVPWLGGASNNAMTHEVLWPQFEAVWPLLTTPDGTKTEAMPWNGLPLI
                     NTIVLLTSSVTLHFSHVSLEKGKRSAITLWLGITILLGMGFLALQAEEYMHAYHEMGL
                     TLTSGVYGNTFFLLTGFHGMHVSLGTLFLLVLFFRVLKGHFSADKHFAFQAGSWYWHF
                     VDVVWLCLFIFVYVL"
     gene            complement(173316..173897)
                     /locus_tag="SBAL_RS00760"
                     /old_locus_tag="Sbal_0152"
     CDS             complement(173316..173897)
                     /locus_tag="SBAL_RS00760"
                     /old_locus_tag="Sbal_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase assembly protein"
                     /protein_id="WP_006079604.1"
                     /db_xref="GI:492986695"
                     /translation="MTNHHQPEKPKSNRKLISMLVMGCIGMFGFGFALVPLYDVLCEK
                     LGINGKTSNTASSYQAITIDTSRIVTVEFISQVQTGMPWKFEPQTKRLEVHPGELIHT
                     AFLARNVSDRATVGQAIPSISPGQGAAYFNKTECFCFNQQHLAASTSAELPLIFFVDP
                     QLPESIHTLTLSYTLYDITDKQLASAIEQGAAK"
     gene            complement(173899..175491)
                     /locus_tag="SBAL_RS00765"
                     /old_locus_tag="Sbal_0153"
     CDS             complement(173899..175491)
                     /locus_tag="SBAL_RS00765"
                     /old_locus_tag="Sbal_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase subunit I"
                     /protein_id="WP_006084616.1"
                     /db_xref="GI:493001139"
                     /translation="MSTTTQDQTAAHDDHHHGAPKGIMRWVLTTNHKDIGTLYLWFSF
                     IMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLI
                     PMMIGAPDMALPRMNNWSFWILPFAFTILLSSLFMEGGGPNFGWTFYAPLSTTYSPDS
                     TALFVFSIHIMGISSIMGAINVIVTIVNLRAPGMTWMKLPLFVWTWLITAFLLIAVMP
                     VLAGAVTMVLTDKFFGTSFFEAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIV
                     PAFSRKPLFGYASMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTG
                     VKVFNWVATMWRGSLSFETPMLFAVAFIILFTIGGFSGLMLAITPADFQYHDTYFVVA
                     HFHYVLVTGAIFSIMAAAYYWLPKWTGHMYNERLGQWHFWCSVISVNVLFFPMHFLGL
                     AGMPRRIPDYSIQFADVNQIVSIGGFAFGLSQLIFLVLVIKCIRGGEKAPAKPWEGSE
                     GLEWTLPSPAPYHSFTTPPEVK"
     gene            complement(175501..177057)
                     /locus_tag="SBAL_RS00770"
                     /old_locus_tag="Sbal_0154"
     CDS             complement(175501..177057)
                     /locus_tag="SBAL_RS00770"
                     /old_locus_tag="Sbal_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B559 subunit beta"
                     /protein_id="WP_011845443.1"
                     /db_xref="GI:500171018"
                     /translation="MKQLLYCLLVVLFAPPLAAADMRFNMTPGVTEISGKVYHLHMTI
                     LYICCAIGLVVFGVMIYAMINHRKSKGAVASHFHESTKVEIAWTILPFIILILMAIPA
                     TKTLIAMEDPSDADLTVKVTGSQWKWHYSYFDQDIDFYSILATPRAQIDGTETKGEHY
                     LLEVDKPLVLPINRKIRFLMTSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGIY
                     RGQCAELCGKDHGFMPIVVQAIPEAEFEAWVTEQKQAAGAAAEAAQAALSQTLSKDDL
                     MTQGEQVYLGHCAACHQPNGEGLQGVFPHLKGSPIATGPLSGHLEIVLNGKTGTAMQA
                     FSKQLSAQEIAAVITYERNAWGNNTGDAVQAKDVNEHMNGSAGTQAPATTPAKTAPTP
                     APTTKPAAVVDSATIVDPASLPTLTHEALMAEGETVYTTTCAACHQLTGAGIPPAFPA
                     LAGSAIATGPVANHLDIVMHGKTGTAMQAFGKQLSPQQLAAVITYERNAWGNNTGDTV
                     QPADIASHGQ"
     gene            complement(177460..177972)
                     /locus_tag="SBAL_RS00775"
                     /old_locus_tag="Sbal_0155"
     CDS             complement(177460..177972)
                     /locus_tag="SBAL_RS00775"
                     /old_locus_tag="Sbal_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="WP_006079607.1"
                     /db_xref="GI:492986698"
                     /translation="MNKLLGNAPRHPGLWLDEVRDADYDWHHAPIACMPTKTQGRQEL
                     IHLSAQLAQLSQQGRWLVLINPPSIGYKQMLANAGVRMDRVLLVHAKDEVETLWAMEK
                     ALTSGTSSAVITWTQSLDARDNRRLQIVAKSARAMGIVLEDVNSHLHGDVRIEQGSLF
                     GQQSFFSAVH"
     gene            complement(177969..178589)
                     /locus_tag="SBAL_RS00780"
                     /old_locus_tag="Sbal_0156"
     CDS             complement(177969..178589)
                     /locus_tag="SBAL_RS00780"
                     /old_locus_tag="Sbal_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007652009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="WP_006084613.1"
                     /db_xref="GI:493001136"
                     /translation="MRPLTPRQAEILELIKRNIADTGMPPTRAEIATRLGFKSANAAE
                     EHLKALAKKGCIEIMPGTSRGIRLTAEVEEVTETGLPLIGQVAAGEPILAQEHVEQYY
                     QVDPSMFHPAADFLLRVKGDSMKNIGILEGDLLAVHKVQQARNGQVVVARVDDDVTVK
                     RFEKKGNVVYLHAENEDYSPIKVDLGYQSLTIEGLAVGVIRNGDWL"
     gene            178750..181173
                     /locus_tag="SBAL_RS00785"
                     /old_locus_tag="Sbal_0157"
     CDS             178750..181173
                     /locus_tag="SBAL_RS00785"
                     /old_locus_tag="Sbal_0157"
                     /EC_number="2.3.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8ECL8.1"
                     /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
                     3-phosphate by transfering the acyl moiety from acyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_011845444.1"
                     /db_xref="GI:500171019"
                     /translation="MPKHDSLWLKSLRWIQKHLVHTIVVPQDPFADLNLDASRPLAYV
                     MKTESLSDIAALSEITAKLGLPSPYEPLVANGVIAPRVVCLQGRKPLFGERAGNEPFL
                     ECFMRLLAVHKERPELDIQLVPVSLYWGRTPGKEDDTMKAAVFERENPTWLRKCLMIL
                     FLGRHNFVQFSNAVSLRYMADEHGTDMGIAHKLARVARVHFRRQRKVMTGPVLPNRQA
                     LFHSLLKSESLRKAIQEEAANKKISETQARETAIEYLDEIAADYSDSLVRIAERFLTW
                     LWNKLYSGINIKGAEQVRQLHHDGHEIVYVPCHRSHMDYLLLSYILYYQGMVPPHIAA
                     GINLNFWPAGPMFRRGGAFFIRRSFNGNKLYTAVFREYLDQLFAKGYSVEYFSEGGRS
                     RTGRLLAPKTGMIAMTMNSVLRGIERPVTLVPVYLGYDHVMEVATYHKELSGKKKKKE
                     SVWQVFGAIRKLGNFGQGYVNFGEPITLQNFLNERAPNWRTELADDPEQKPSWLTPAV
                     NVLANRVMTNINDAAAASSVTLTSLVLLATDQNALERSLLERQLDLYLTLLKKVPYTT
                     YTSVAEGDGKHLVQQGLELNKFVVCADPLGEIVSIEASQAVSMTYYRNNIIHLFIVPS
                     LIASCLTHNKQIPRQQVVSIVADFYPLLKAELFMGIKDVPAYVNQVLDFFIEQGLVVE
                     TDTLTVVPEHTSQLLLLASSVSETLQRYAIIFNLLANRPKMERSELESESHLLAQRLG
                     ALHGITAPEFYDKKLYGTLSVKLKELGYLADNQDKSNINRIRDQANSLLRPSVKQTIV
                     ASVTAEHTV"
     gene            181173..182429
                     /locus_tag="SBAL_RS00790"
                     /old_locus_tag="Sbal_0158"
     CDS             181173..182429
                     /locus_tag="SBAL_RS00790"
                     /old_locus_tag="Sbal_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588833.1"
                     /note="tryptophan transporter of high affinity; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan permease"
                     /protein_id="WP_011845445.1"
                     /db_xref="GI:500171020"
                     /translation="MANHMNAAKHKPAGKSLLGGAMIIAGTTVGAGMFSLPVVGAGMW
                     FGYSILMLLGIWFCMLMSGLLLLETNLHFEPGASFDTLSKQTLGQFWRIVNGVSIAFV
                     LYILTYAYISGGGSIVNHSLQGMGIELPQSVAGLVFAIVLASIVLISTKAVDRITTIM
                     LGGMIITFFLAIGNLLIEIDVTKLLEPDGNSSFSPYLWAALPFGLASFGYHGNVPSLV
                     KYYGKDSATIIKAIFVGTFIALVIYACWLVATMGNIPRSQFIDIIAQGGNMGVLVGAL
                     SEVMASSWLNSMLTLFANLAVASSFLGVTLGLFDYLADLFGFDDSRSGRMKTALVTFV
                     PPTILGLLFPDGFLVAIGFAALAATVWAVIVPALMAYKSRQLFPDSTGFRVIGGTPLI
                     ILVVLFGIVTGACHLLAMANLLPQYS"
     gene            182579..183352
                     /locus_tag="SBAL_RS00795"
                     /old_locus_tag="Sbal_0159"
     CDS             182579..183352
                     /locus_tag="SBAL_RS00795"
                     /old_locus_tag="Sbal_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_011845446.1"
                     /db_xref="GI:500171021"
                     /translation="MKITQYAQGHACWVELANHDWQAAKTFYQALFGWDSVDMPIPEG
                     HFSLFNLAGDDLGAMYQIPESESQIPSHWRVYFAVDDMDASIAAIQAAGGQVHMGPHI
                     VADAGVMAQVSDPQGARFALWQAKNHIGARRQGELNTLCWVELACKEPRTEEAFYCKI
                     FPWTNSPSDMPDIEYSEWQVDGQSIGGMMTIMPEWGDISPHWLLYFAVADCDAFAEKA
                     QALGAQVCIPPSDIPDVGRFSVIADAQGATFAVIKLNQM"
     gene            complement(183558..185519)
                     /locus_tag="SBAL_RS00800"
                     /old_locus_tag="Sbal_0160"
     CDS             complement(183558..185519)
                     /locus_tag="SBAL_RS00800"
                     /old_locus_tag="Sbal_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011845447.1"
                     /db_xref="GI:500171022"
                     /translation="MFSINQLALTKKLAIVPVLLVAMLITLGLTSYFALTDIDNRMRL
                     VTEDLAPESAITSNLLQEIYRLRLAVKTYVKTGSAEAATDFSNQSSKAHEMIAKAKAH
                     ISFPERIKLINQIGEHQVEYVDIFNRKIIVNQQNRERLVSGTLDIKGPEVEKTLSQIM
                     QSSFNDGDVRGAFYAGKTLRELLLVRLYVVKFLVDNQPEQAKRFTDELNKTHLAIDEL
                     AASLENLEYQSQVKQANQLLKEYEQAAQSVVEAINNRNTAIVELDKIGIEMAEMTSDL
                     QDSTMKSLSDAGDKAAQEVSQKITFISIILIIAILMAALITFIVTQSLLSSIREVVTL
                     LNEIADGEADLTQRLPENGHDELTQLAKNFNRFVVRIQVLVSQVKNTTVQLVSASTQL
                     SSVTHSATKDMSSQQNETQQVASAITEMAASAIEVAASADTANKLSEEAREQSLSGRE
                     IVANATHSMKELAEKVEASANTIELLRNDSDKIGEVLDVIRAIAEQTNLLALNAAIEA
                     ARAGEQGRGFAVVADEVRSLASRTQESTKQIQQIIQTLQNRSSSAATMMGQSREATST
                     TVIQVTKVEAALSTITDMVMSISHSVSQMAHAAEQQSTVVEEINISINSVSESANRTL
                     GGVNQTASSANDLLKLGHQLDNLVSEFRV"
     gene            complement(185873..187042)
                     /locus_tag="SBAL_RS00805"
                     /old_locus_tag="Sbal_0161"
     CDS             complement(185873..187042)
                     /locus_tag="SBAL_RS00805"
                     /old_locus_tag="Sbal_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease T2"
                     /protein_id="WP_011845448.1"
                     /db_xref="GI:500171023"
                     /translation="MTKPFCLTIRRIWPQALSLKSLSRTLLAAFGLCAALIISAAPAF
                     AAPATGEFVADKRCELFQSKNKQTNPDQWQSNIGERYPVLEILGNSAKPDWLRVRTNA
                     VKSPMRWISGACGQYLSNVAGSNVSTPATAVEPAQTTTASDIKAKSRDGLKEHGTPEK
                     RPGDQCRIGGEFDANVLALSWQSTFCELYGRRKAECRALSQTPESSQWQHFSLHGLWP
                     NKQQCGTRYGYCSTVKLQPNDFCTYPELELNPSVRKNLEEVMPSAQYGTCLERHEWWK
                     HGTCRSQDPNEYFLLATQLTQAVNASAWVQKFIHDNIGKSVSKSELNQSFDSSFGQGA
                     HAKMSLECGKGLLSEIRINLPEVIKASDSLPSLLAKANKAGRGSCPETIMIDNAN"
     gene            complement(187251..190400)
                     /locus_tag="SBAL_RS00810"
                     /old_locus_tag="Sbal_0162"
     CDS             complement(187251..190400)
                     /locus_tag="SBAL_RS00810"
                     /old_locus_tag="Sbal_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_011845449.1"
                     /db_xref="GI:500171024"
                     /translation="MLKYIIEASIRQRFMVLIIAIMITVWGVQELRKTPLDALPDLSD
                     VQVIIKTPYPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGYSMFGDSYVYVIFEDGTD
                     IYWARSRVLEYLSQISSRLPQNVQPSLGPDASGVGWVYEYALVDRSGNLDLSQLKSLQ
                     DWYLKLELQSVAGVSEVATVGGMEQTYQIVLEPDKMAIYKLDIATIKQAIDKANSEAG
                     GSVIEMAEAEYMVRAKGYRQTLEDFREIPLGITSPSGTGLTLKDVATVRKGPASRRGI
                     AELDGEGEVVGGIVVMRYGENALATIDAVKAKLEELKAGLPDGVEIIPTYDRSHLILK
                     SVDNLFSKVVEEMLVVGLVCLLFLLHARSTLVAVITLPLSILIAFIVMNKMGVNANIM
                     SLGGIAIAIGAVVDCAIVMIENLHKHLEHFKADHDREPDTKEHWRIVTEASIEVGPAL
                     FFSLIIITLSFVPVFALEAQEGRLFAPLAYTKTFAMAAAAFLSITLVPILMGYFIRGK
                     IPSERSNPISRFLIAIYQPSLKLVLKFPKVTLMLALIALASAWYPMTRMGSEFMPALE
                     EGDLLYMPTALPGISASKAAEVLQQTDRLIKTVPEVARVFGKVGRAETATDPAPLTML
                     ETTIMLKPHDEWREGMTLDGIIAQLQQTVKVPGLTNAWVQPIKTRIDMLSTGIKTPVG
                     IKITGADVNELQSIGTKIEAILSKVPHTKSAYAERSGGGRYIDISPKLDVAARYGMTL
                     QDIQDVVRYAIGGMDIGESVQGAERYPINLRYPRELRDNIEKLRELPVITKSGHYLPL
                     RNLADIEINDGAPMLKSENGRLISWVFIDIEGTSIGEYIATAKTALDAELVVPPRYSY
                     SFAGQYEYMQRVDAKLKQVIPMALAVIFILLMMTFGSTIQASIIMLSLPFALVGSTWL
                     LYLLDYNISVAVAVGMIALAGVAAEFGVVMLVYLNNAIKHRQEKDNYHSVNDLKEALI
                     EGAVMRIRPKAMTVATIFFGLLPIMWGAGSGNDVMQKIAAPMVGGMVTAPILSLFVLP
                     ALYLLIYSRKLKKDPAHVS"
     gene            complement(190410..191951)
                     /locus_tag="SBAL_RS00815"
                     /old_locus_tag="Sbal_0163"
     CDS             complement(190410..191951)
                     /locus_tag="SBAL_RS00815"
                     /old_locus_tag="Sbal_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter MFP subunit"
                     /protein_id="WP_011845450.1"
                     /db_xref="GI:500171025"
                     /translation="MNQFNTVKKQAPKAVLILSSLLISTPWLSHAQLANTQEPTATEA
                     AANSATAPKHNPLNQVKTYTCPMHPEVISHEPGRCPKCNMFLVEKLDAANPAAEHAQH
                     QAADHQASEHGQTSADKATSQVFDTPTPKADSLVKAQNHVTTIKYVCPMHAHIISDVP
                     GTCPICGMNLEKVETGGNTQEININVSGSMQQALALKVAKVERDTLWKFVETVGQIDY
                     DESQITHIHARVTGWIEKLMIKSVGDTVKKDQLIYEIYSPDLINAQDDYLLAMDTAKA
                     NGQGRYKDLVRNAGLRLSFLGFNDRQIKQLAESHQTQYRVPFYAKEDGIVKALDIRDG
                     MYIQPSTEVMSVVDLSKVWVIADVFENEQSWIAKGQKAEIAVPAMNISGIEGTIDYIY
                     PELDPVTRSLRVRVVLNNTEVDLRPKTLAKVSLFGGPNKDVLVIPQEALIQTGKENRV
                     IVKQTDDSFTAKAVTVGMMSQGKAEIISGLNEGERVVISGQFLLDSEASLKGSLMRLS
                     SGHQH"
     gene            complement(191973..192233)
                     /locus_tag="SBAL_RS00820"
                     /old_locus_tag="Sbal_0164"
     CDS             complement(191973..192233)
                     /locus_tag="SBAL_RS00820"
                     /old_locus_tag="Sbal_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-exporting ATPase"
                     /protein_id="WP_011845451.1"
                     /db_xref="GI:500171026"
                     /translation="MKTLTNLALIAFLLTSTSVFATAAPHEHQHDNANPQQQAQTYVC
                     PMHPEVTGNKGDTCPKCGMDLEPKATEVKTAEGTMHNAHEHH"
     gene            complement(192501..192938)
                     /locus_tag="SBAL_RS00825"
                     /old_locus_tag="Sbal_0165"
     CDS             complement(192501..192938)
                     /locus_tag="SBAL_RS00825"
                     /old_locus_tag="Sbal_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079621.1"
                     /db_xref="GI:492986712"
                     /translation="MHHTLGRYFLVMFTLLALVGQSVVSNGHAMVPHTMDMSAMNHEA
                     SPQMHHAAMMQMNTENPSDSHSMANADCCNDKMLPGAKQHCCDGTTSCSNDCGHCLTI
                     SVAGTLFSPHLWPSVSMSDTAMATPMPHFHSISLSSAFKPPIA"
     gene            complement(193048..193503)
                     /locus_tag="SBAL_RS00830"
                     /old_locus_tag="Sbal_0166"
     CDS             complement(193048..193503)
                     /locus_tag="SBAL_RS00830"
                     /old_locus_tag="Sbal_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845453.1"
                     /db_xref="GI:500171028"
                     /translation="MKTSLLNKSLLGLTFVIGALLSSTTVTAASLKSTDSLSVISING
                     VPATPFKPIQLSAGKVLLELKYQDIFDYRADDSGNWVKSAPLYLVLDVKASDSYQITQ
                     PKIMTEAEARQFIKYPTIQLSINGDKAGEYPLQSHSQLMAKMLVSNPAF"
     gene            complement(193604..193966)
                     /locus_tag="SBAL_RS00835"
                     /old_locus_tag="Sbal_0167"
     CDS             complement(193604..193966)
                     /locus_tag="SBAL_RS00835"
                     /old_locus_tag="Sbal_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620549.1"
                     /db_xref="GI:504433447"
                     /translation="MAKFWITIAVLFSLIAQSAMVSAMPTSANTNGHSSQTMLMMDAE
                     MNCTMPDCSASDCLQHCQDSMTSHCQTHCLSSLYLEPAVLELAFANPASKRIAIQGWA
                     MQTADLGLTTPPPTSNSL"
     gene            194401..194964
                     /locus_tag="SBAL_RS00840"
                     /old_locus_tag="Sbal_0168"
     CDS             194401..194964
                     /locus_tag="SBAL_RS00840"
                     /old_locus_tag="Sbal_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_006079625.1"
                     /db_xref="GI:492986716"
                     /translation="MNWRALFKPSAKYSILALLVVGIVIGVVGYFATQTTLHATSQDA
                     FCMSCHSQHSLKDEVMASAHGNNRVGIVVQCQQCHIAQEPFQYLKKKIIVSKDVIGFL
                     TIDGFNTQAWLDENRKEQAELARDYLRAIDSSTCQNCHNRIYENQSENMSKMAVRMHS
                     NNFKKAPEDRKTCIDCHKGVAHPYPKG"
     gene            complement(195061..195345)
                     /locus_tag="SBAL_RS00845"
                     /old_locus_tag="Sbal_0169"
     CDS             complement(195061..195345)
                     /locus_tag="SBAL_RS00845"
                     /old_locus_tag="Sbal_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845455.1"
                     /db_xref="GI:500171030"
                     /translation="MKAMPLLINLGKAITLIAWLMMAYNLVMPFEGNVAIILNILFGI
                     TCMMHCFQVAIFHMLFKTLLLLTKLDYLQVFIFGIFSLLAYRQKVMTPAS"
     gene            complement(195320..195958)
                     /locus_tag="SBAL_RS00850"
                     /old_locus_tag="Sbal_0170"
     CDS             complement(195320..195958)
                     /locus_tag="SBAL_RS00850"
                     /old_locus_tag="Sbal_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_037392764.1"
                     /db_xref="GI:739534367"
                     /translation="MTKSPTAKNKPGSGQVRIIAGQWRSRRLPIQDLEGLRPTTDRVR
                     ETLFNWLANDLVNARVLDCFGGSGALALEALSRYASFAKIIELQRGAAMQLKENLQTL
                     KCDKAEVLNADTLVVLQRGCEQGFDVVFIDPPFRKGLAEKTIQLLDTQAWLNDGALIY
                     VEIESELTQLAIPPCWHALKEKNAGQVSYRLYQYQAENTAEPIEDESHALAD"
     gene            196202..198067
                     /locus_tag="SBAL_RS00855"
                     /old_locus_tag="Sbal_0171"
     CDS             196202..198067
                     /locus_tag="SBAL_RS00855"
                     /old_locus_tag="Sbal_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006535411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_011845456.1"
                     /db_xref="GI:500171031"
                     /translation="MAKKGFFSWFRKDKSQDEVVAETPVVTPTQDTEAAERLEQERAE
                     AQRLAVEAEAQAAAAKLAAEQLAAEQAQAERIVQEQAAIEAQRLAEQQAEAARLAAAQ
                     LEAEQLAKVQAERIAQEQAQIEAQRLAEQQAETARLAAAQLEAEQLAVDKLAAEQAAA
                     EQLAQAQAKAEAERIAQEQAQIEAQRLAEQQAEAARLAAAQLESERLAANNLAQAQAK
                     AEAERIDHEQAQIEAQRLAEQQAEAARLAAAQLEAERARVAAEQAAEALAAEQLAAEA
                     LAREQAEALAQQQAEATQTAGPVTELQPEPQARPVKEGLFARLKRGLMRTSENIGSGF
                     IGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQASRKQLKDAEALYDLLR
                     EEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAG
                     DTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKVDVLIADTAGRL
                     QNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQEAVGVTGITI
                     SKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDALFTQEKADS"
     gene            198071..198784
                     /locus_tag="SBAL_RS00860"
                     /old_locus_tag="Sbal_0172"
     CDS             198071..198784
                     /locus_tag="SBAL_RS00860"
                     /old_locus_tag="Sbal_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079632.1"
                     /note="ATP-binding protein of an ATP-binding cassette
                     transporter; when bound to FtsX, FtsEX localizes to the
                     cell division site and plays a role in the assembly or
                     stability of the septal ring under low-salt growth
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsE"
                     /protein_id="WP_006079632.1"
                     /db_xref="GI:492986723"
                     /translation="MIDFQQVSKIYPGGQMALEDVNFHLQQGEMAFLTGHSGAGKSTL
                     LKLITVIERATTGRVAINGHDIAKVSPKHVPYLRRNIGMIFQNHHLLMDRSVFDNVAL
                     PLVIEGFSHGEIRKRVAGALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPPLLL
                     ADEPTGNLDPKLSMDILRLFETFNDAGTSVLIATHDLGLIARMKYRTFTLKQGRMLGA
                     QELHPSVHTRAPTNRGEGQ"
     gene            198781..199746
                     /locus_tag="SBAL_RS00865"
                     /old_locus_tag="Sbal_0173"
     CDS             198781..199746
                     /locus_tag="SBAL_RS00865"
                     /old_locus_tag="Sbal_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_006079633.1"
                     /db_xref="GI:492986724"
                     /translation="MSDSAKLTRSKLPLSGRIVMFFIRHVQQAMASMGELWRNPVSSV
                     MTMAVLGVSLSLPAALQVLVKNAETITSSWNSAAEISLFIEDNRSEQTIQSLLTRIRT
                     YSEVDKVQYIDKNQALEEFQRLSGFGEALAYLDKNPLPAVITVTPTPRYSTPVGAREL
                     LTKLEREPEISFGRLDIEWLERLQAVVRLLERTVMAIAALLVLAVVLVIGNTIRLAIM
                     NRRSEIEVMKLVGATEAFIQRPFLYTGIWYGVIGGILAWLIINLLVWYLDSALAELLG
                     LYGSQLEMKSLTFTELLQLVGLASFLGWLGSYLSVRQHLRSIEPS"
     gene            199971..200828
                     /locus_tag="SBAL_RS00870"
                     /old_locus_tag="Sbal_0174"
     CDS             199971..200828
                     /locus_tag="SBAL_RS00870"
                     /old_locus_tag="Sbal_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="WP_006079635.1"
                     /db_xref="GI:492986726"
                     /translation="MTFQTQSMALTVPQGASSLEAYIHSVTSISMLDAEAEYELAKRL
                     QETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPDVGV
                     RLVSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNIRKAKKRLGWFSDAEVTMV
                     AENLGVSKADVTEMESRMAAQDPAFDLTNDQDEEHDFAPVHYLEDHSSDLAENIENDN
                     WESNAQGRLLSAIKTLDERSQHILRARWLDDDKTTLQELAETYQVSAERIRQLEKNAM
                     NKLKACMEA"
     gene            complement(200930..202342)
                     /locus_tag="SBAL_RS00875"
                     /old_locus_tag="Sbal_0175"
     CDS             complement(200930..202342)
                     /locus_tag="SBAL_RS00875"
                     /old_locus_tag="Sbal_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoate-CoA ligase"
                     /protein_id="WP_011845457.1"
                     /db_xref="GI:500171032"
                     /translation="MSDKRLSKSLTLSPVHQAALAFPQQTAIKLAGQDIRYSELSQRV
                     IALGQQLRAAGIAEGEPLACISLNNLEMICLYWACIDIGAIFFPISPRFPLAQIQGLI
                     DEHQIRYVWRAEISDLQNCSQLALDFNRLSNELAQPVDITRPANVILTSGSSGFPKAA
                     VHCLANHIANAEGARSLIPLEQGDAWLLSLPLFHIGGLAILNRCALVGATVVMPDQAL
                     SLSQQIDQDKLTHLSLVPAQLSKLLADTSSKLQSIKALLLGGGAVSLDLLAELKQRNI
                     ASYTSYGMTEMGSQITTGPALSDGSSGKLLPKRELKIEDSVIWVRGECLFMGYLAPEG
                     IQAGVDQEGWFYTKDRGEWDENGNLHILGRVDNMFICGGENIQPEEIEAALKQHPQID
                     DAIVFAIPNAQFGNLPAAILRGSLTHHTESIANELELFLADKIARFKRPRQYYVWPEN
                     HEQAGLKVNRKALIANLVKH"
     gene            complement(202343..203443)
                     /locus_tag="SBAL_RS00880"
                     /old_locus_tag="Sbal_0176"
     CDS             complement(202343..203443)
                     /locus_tag="SBAL_RS00880"
                     /old_locus_tag="Sbal_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoate synthase"
                     /protein_id="WP_011845458.1"
                     /db_xref="GI:500171033"
                     /translation="MILTSLNLYQYRLPLDVLLPVGKQRIDHRAGLVLQACASANVGD
                     EYKQVEVEIAPLSGIDVDEQVFVGFSRETLAQVQTALTELLPQLGGQHIDTLLDYAEQ
                     SPYPSLAFGLSLLHAKLMGKLDAIRPQTATVPLIYHPSDAGKDLHDNKIAALGMHVHS
                     VKVKVAQTSIEDELSLIYGILRTRPDLKLRLDANRGFTLEQAIEFAACLPLDTIEYIE
                     EPCQNPQDNLEFYQAIGMPYALDESLNDPDYQFAMQNGLTALVIKPMLLGSIEKLANL
                     IDTAQSYGVRCIISSSLESSLGISDLAHLAAILTPDEIPGLDTLSAFNQDLIVSSGKK
                     HFLSLAQLEPVAQHAIDSTQQSDLGAAKREEN"
     gene            complement(203471..204265)
                     /locus_tag="SBAL_RS00885"
                     /old_locus_tag="Sbal_0177"
     CDS             complement(203471..204265)
                     /locus_tag="SBAL_RS00885"
                     /old_locus_tag="Sbal_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_011845459.1"
                     /db_xref="GI:500171034"
                     /translation="MPNMARYGDPSLPTLVLLHGFLGTKADWLPLMPALSQHFYCICL
                     DLPGHGDNQAEGSTEARLDFDFCVESIMARLDSLNPSPDKFHLYGYSLGGRIALHLAK
                     AYPQRLLSLNLESCHPGLADPQEKTARTKNDTQWAERLLHLASKDFLNLWYQQPVFAD
                     MTAAKRKALIEQRSAILDQHPKQLLKEVFLATSLARQASMWDVPSQLACECHFFAGSQ
                     DTKFHALAQEWQLHAPILVHNISGAGHNIHQAAPEALITKIVKLLG"
     gene            complement(204265..205986)
                     /locus_tag="SBAL_RS00890"
                     /old_locus_tag="Sbal_0178"
     CDS             complement(204265..205986)
                     /locus_tag="SBAL_RS00890"
                     /old_locus_tag="Sbal_0178"
                     /EC_number="4.1.1.71"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014611748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylate synthase"
                     /protein_id="WP_011845460.1"
                     /db_xref="GI:500171035"
                     /translation="MRTENTATLNLIWGALILEELARLGVQHVCMAPGSRSTPLTLAA
                     AQQTKLQRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAVANLYPAIVEAWLTHVP
                     LIVLSGDRPPELLGCGANQAIVQPGIFANYATQVNLPTPDAHIAPQALLTTVDEAVAN
                     QTRPVHINCMYREPLYPSELSGVILDAESPYLKPLQTWLQLARPYTQYGKSKQLSSPS
                     DDAIMRFVHGKGVIVVGTLTPEQDPQQLIALSQKIGWPLLTDAQSQLRQHPAAIGNID
                     QLLQHPKARNLLQEADRVLVFGGRLLSKRVIGYLAEQNWHSYWQVLPEQDRLDPSHNA
                     KHIWHANAEQFAALNWYRSSSANWANTLITYNDELHNLFVRNIDQGEFGEAQVIRAIA
                     NTRPLEQQLFIGNSLPVRLYDMYAPVSCCTATTYTNRGASGIDGLLATACGIAAHEGK
                     PTSLIIGDLSQLHDLNSLAIAKGLSSPLVIVILNNDGGNIFNLLPVPNEQVRSEYYRL
                     SHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALDFQGASIIEVNVSQNQASDQIAAL
                     NLWVKQS"
     gene            complement(206168..207136)
                     /locus_tag="SBAL_RS00895"
                     /old_locus_tag="Sbal_0179"
     CDS             complement(206168..207136)
                     /locus_tag="SBAL_RS00895"
                     /old_locus_tag="Sbal_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_006079640.1"
                     /db_xref="GI:492986731"
                     /translation="MHISNMDGLDILSLKILVSLYENKSATYVSKALDIPAPKISRSL
                     KNLREIFGDELFIRRKYGLFPNEFATHLYPIAKEAIECTDKFHKARAANANLVKTHIE
                     IAAPGLIAYAFPKALMQAIKDEQKLMHINITPWSMHTTQDIINGDTTLGICCNKSTAD
                     VAAFGDKLLTTTLQSMDKVYLLASRNHPIFKREITLETIAEYPYVNTDLGNPSSKLSP
                     YQEFCLKSNIKLNTEITITSISSLFEYLGESQALSLLPYRVVYEMVSDVAELHTCQLS
                     QLEAERLYAHAEAPTIFLVQKNQPNKVNDDLVWLSGQIKKIVDHII"
     gene            207546..208022
                     /locus_tag="SBAL_RS00900"
                     /old_locus_tag="Sbal_0180"
     CDS             207546..208022
                     /locus_tag="SBAL_RS00900"
                     /old_locus_tag="Sbal_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011791123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079641.1"
                     /db_xref="GI:492986732"
                     /translation="MNTSVILSYAFMYFVLFVAVPFVFVMFVMTCIKFFKAGPDEAEH
                     HEMKLKPVLFDKQSFNFFKSLKTVVEGKYDVCCNVPLDTVFEMDQHDADLNHECRLDY
                     VLIDHDSSEVKMVISDFGKEHNSPMKKLFSKFNINFIEMNQHKQWDTQSLKQALAV"
     gene            208100..208561
                     /locus_tag="SBAL_RS00905"
                     /old_locus_tag="Sbal_0181"
     CDS             208100..208561
                     /locus_tag="SBAL_RS00905"
                     /old_locus_tag="Sbal_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_011845461.1"
                     /db_xref="GI:500171036"
                     /translation="MSKRQWLWSIRLGAIALLLSFGATSAESALQINSDTTCMKCHKR
                     NGQMLGHHGQDAMKMTCSTCHGEKGDHPKKPNDIVVFGMKDGSELDTQLAVCHKCHTQ
                     RKLGETEWTHNVHAQKVPCAACHKLHSPTEPMADMTPKVRSELCRNCHSGQ"
     gene            208571..209257
                     /locus_tag="SBAL_RS00910"
                     /old_locus_tag="Sbal_0182"
     CDS             208571..209257
                     /locus_tag="SBAL_RS00910"
                     /old_locus_tag="Sbal_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090533.1"
                     /note="4Fe4S subunit; may be involved in the transfer of
                     electrons from quinones to the c-type cytochromes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_006079643.1"
                     /db_xref="GI:492986734"
                     /translation="MENSKRRFLKGTCALFAGATGASLLATVNAAEGAKAESDIKYAM
                     IHDETKCIGCRACEVACRETNQVPEGVSRVRIEQTGPFGEYPNEYYHFSRISCQHCED
                     APCVNVCPTGAAFIDKETGIVSVNAWKCVGCQYCIAACPYKIRFINPVTHAADKCDFC
                     RETNLAQGKQPACVEACPTKALVFGNLKDPTSELVQVLRANPTQRAKVALGTRPKLFR
                     ILAKSGEVIL"
     gene            209254..210195
                     /locus_tag="SBAL_RS00915"
                     /old_locus_tag="Sbal_0183"
     CDS             209254..210195
                     /locus_tag="SBAL_RS00915"
                     /old_locus_tag="Sbal_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197785.1"
                     /note="membrane protein, may be involved in the transfer
                     of electrons from quinones to c-type cytochromes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate-dependent nitrite reductase subunit
                     NrfD"
                     /protein_id="WP_006079644.1"
                     /db_xref="GI:492986735"
                     /translation="MSALHFDTLVWHWPIAIYLFLAGVSAGAMFFAVLLKHFVLKQNA
                     YQSGFVRAACIVAPVAVMAGLGILVADLTKPLDFWKILVFYNPKSVMSMGVLILLIYQ
                     VFMFMWIGLTFRKPVDAWCESRFPIVLKLTALLARFEATITGLLVILSLALGAYTGFL
                     LSALPGYPMLKNPVLPLLFLASGLSSGAASSLLGGVLMNGKPNDKEVHFIHKVEIPLI
                     LVEIVLLFTFFVGLLLTGGQSKIAAFNALGYGFWGWIFWVGIIGLGLSGPLAMNLFMT
                     TTSKRKWAYVAGTACLSLIGVLLLRNFILYTGQMTIA"
     gene            complement(210474..210905)
                     /locus_tag="SBAL_RS00920"
                     /old_locus_tag="Sbal_0184"
     CDS             complement(210474..210905)
                     /locus_tag="SBAL_RS00920"
                     /old_locus_tag="Sbal_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011624482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_006079646.1"
                     /db_xref="GI:492986737"
                     /translation="MDKFDTAIIHSLRQDARQSVSNIAEQVNLSRSAVAERIKKLEQT
                     GVIRGYQVLLSESQKEGVSAYFEIQHQCPRCADVVHVFQAIPEVITCRGISGDMDLLV
                     YVHAPSMRRLHEIREYIDTHTDIIKIKTHVVMSEWINNLGE"
     gene            211157..212419
                     /locus_tag="SBAL_RS00925"
                     /old_locus_tag="Sbal_0185"
     CDS             211157..212419
                     /locus_tag="SBAL_RS00925"
                     /old_locus_tag="Sbal_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_006079647.1"
                     /db_xref="GI:492986738"
                     /translation="MNSNSGTIGRWQGAGLMATTLLGTGVFILPQMTIEKAQSGALVA
                     WILLTLAIIPVALVFGRLASVFPHAAGPAYFVEKAFGRTAGRTIGLIFLLVVPMGAPA
                     AILMTFQFVNALMPISGWSKVGVEVLVIFGLFLINLRGIQVSAKLQFGLTLCIVAVVV
                     LLFGASSFQPGHLTTLASHGMPEMPTVMIAAGIAFWSFLGIEAMTHLADDFRRPQQDM
                     IPAMMMGTVLVGVIYVACTLLLLLVPTDKSVAMIGVFDQLLGGYGAQVIGVLGIASGL
                     ATVNVYSASAARLVWSFSCEGILPRFFAVKNAHGVPIRALAALLSVMASVIVLTYLTG
                     QELEHLIAWSNGVFVVIYLMAMLAAAKLLPRHNWPLVALGCAFCLALGFALGASMSYV
                     LVLILVVAPFLWWQKTHISRKQGLAIPE"
     gene            complement(212510..213121)
                     /locus_tag="SBAL_RS00930"
                     /old_locus_tag="Sbal_0186"
     CDS             complement(212510..213121)
                     /locus_tag="SBAL_RS00930"
                     /old_locus_tag="Sbal_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein TonB"
                     /protein_id="WP_011845462.1"
                     /db_xref="GI:500171037"
                     /translation="MSQNALVSRTGLILASALITLGLFVFMAQLINNPQTITGQASDA
                     PQINILMAERTPIPPKEKTKPEPPKPIPVRERVSVPGETSESLTFTPETFMPEMPTQT
                     TLYTQSAMTAEALPVVQVSPRYPIDAAQSGKEGYVVVGFDITADGTVSNVRVLDANPK
                     RVFDKAALSAVQNWKYKPKFDAGKAVAQLNQQVQLDFKLDQKI"
     gene            213462..214286
                     /locus_tag="SBAL_RS00935"
                     /old_locus_tag="Sbal_0187"
     CDS             213462..214286
                     /locus_tag="SBAL_RS00935"
                     /old_locus_tag="Sbal_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_006084589.1"
                     /db_xref="GI:493001112"
                     /translation="MDSAALLNRVDELPRLPKAISELLDAVNDDNATVKSIATKVAHD
                     PLISARVLRLANCAHYGRSREVGTIDEAVVRLGMQTLRTLVLASAVIGAVPKCEGIDL
                     AQFWGQTFEIALYSQEMAKRCGAIPEEAFTCGILHRIGDLLIAAVSPEDAAKIAEAVA
                     QGKDKHEFERELLGYDSPDIGALLAKNWKFTTALVEGILYQDHPKDSDPFSKLAALLC
                     LSYKVLDEWDTIEDDEKTSWLSQLATKKGLRMEMGGLRTKLTELRGSGFEIGKALA"
     gene            complement(214571..215044)
                     /locus_tag="SBAL_RS00940"
                     /old_locus_tag="Sbal_0188"
     CDS             complement(214571..215044)
                     /locus_tag="SBAL_RS00940"
                     /old_locus_tag="Sbal_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845463.1"
                     /db_xref="GI:500171038"
                     /translation="MIAKLRRFFEAHTQAVSPEDKAHQLKLAAASMLLEVVFADDTLT
                     AEEEALLPKLLTDTLSMSEADAKILIDEAKSVQGSATSLFEFTSAINAEFSLAQKQQL
                     LLAMWQLAYADGQLSQYEDQIIRRTADLLYLKHSELIQMRNLAIAANRHIDQAPQ"
     gene            complement(215145..215675)
                     /locus_tag="SBAL_RS00945"
                     /old_locus_tag="Sbal_0189"
     CDS             complement(215145..215675)
                     /locus_tag="SBAL_RS00945"
                     /old_locus_tag="Sbal_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084587.1"
                     /db_xref="GI:493001110"
                     /translation="MKHTLTLSIFLGTCILAAPASAGWLDNLAGTQAKTEKAATTATA
                     TQSNDLVGSVMSQLGLNQTQAEGGLGSLLGLAQSSLGTTDYSKLAASIPNADSLLAAA
                     PKLDSKSGVSGLLSKAGDLGSSLQGSAMVLDAFEKLGISKDLAMPMINIAKSYLDTNG
                     TEGTSDLLMKGLNSLL"
     gene            215865..216572
                     /locus_tag="SBAL_RS00950"
                     /old_locus_tag="Sbal_0190"
     CDS             215865..216572
                     /locus_tag="SBAL_RS00950"
                     /old_locus_tag="Sbal_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845464.1"
                     /db_xref="GI:500171039"
                     /translation="MSLSAILSEAYNFFRNHLAQLAMLTIPLLLIQVGIQLWLGVEMS
                     KVDLENPQFGVPHMVAMMLLLLTFSVLIAALTLFLELRSQGHSPSAGMVLKASLPFVP
                     PLLLAGVFSGLAILAPVMLFAAFGPLWLVGLVISFYLFARLAYVNFMVVVERLTPLEA
                     IKGSFSFSGPIVLRTIALLMLYLPLSVVGNLLSGAASMGGLPLQMLSDTFMSFIGLFV
                     NVALFRLYMVSKKPSVE"
     gene            216606..218081
                     /locus_tag="SBAL_RS00955"
                     /old_locus_tag="Sbal_0191"
     CDS             216606..218081
                     /locus_tag="SBAL_RS00955"
                     /old_locus_tag="Sbal_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845465.1"
                     /db_xref="GI:500171040"
                     /translation="MGTKTVIKDSEFIQDFSASLSDDYLKAKSYVQDVPTQSLLHIRS
                     FTHKLTELLGQDKHIVFSSPNLYDRIEQLNQQRVIDVKTTRALHRLRADGNRGAHPEK
                     YHLTQAQLLALVQKSIKDVLALVEHLYPKVKGQVAPDYRYEASDAMTAKDLCYRAVME
                     DDAEAQYLVGISFKTKALILKEQELQQDQEFATSAEATSNPEFSGVSPLTSHISAADS
                     FARAAYWFALAAPRHMEALHEHGVALIHGYQGVPEVAKGEQLIATAAEAGVVNAMALL
                     GYFYLVGSESFQPDSKLALQYLQRAAEGEQTEAMANLGVLYYQQKNLTQAYHFISKAA
                     QAGYPHAQYHLALMLANGDGCTRDMIASEYWMAEAAEQGQLDAMLTRAQHMINDDNAF
                     GSDLTQAEDYLRQVIKYGHSVPAMIELSMALADGMLGRIDVVGAAALLKLARQHANKK
                     EAEIIEPLWRSLALQIKNVLKVTQDPAEIHSLNRAQTLLVI"
     gene            complement(218167..218514)
                     /locus_tag="SBAL_RS00960"
                     /old_locus_tag="Sbal_0192"
     CDS             complement(218167..218514)
                     /locus_tag="SBAL_RS00960"
                     /old_locus_tag="Sbal_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845466.1"
                     /db_xref="GI:500171041"
                     /translation="MIYQQFQQSPLQTRISGPRAWLAMAISVSLICLSLFLLPFVLLF
                     GAIALGCLVLFSRFYMARQLAKFNQAQANAKQHAHAADEPLSQVYGSETIVRESNATR
                     HQGRTFEHKEDEH"
     gene            218889..220760
                     /locus_tag="SBAL_RS00965"
                     /old_locus_tag="Sbal_0193"
     CDS             218889..220760
                     /locus_tag="SBAL_RS00965"
                     /old_locus_tag="Sbal_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014611743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011845467.1"
                     /db_xref="GI:500171042"
                     /translation="MNSYSLKQKILFSVVVALSLVIGLLSWQSYSSQKSQLLKNSLEQ
                     VQRLGEQQAERIQEWLAGRQDIMGALASKVEGDSLNTLQQAQASGRFQLTYFGSQAGQ
                     MLDSDPSVDRTGYDPRSRPWYQQAISARGPILTKPYVDVAYNILVVTMAQPTAQGVVG
                     GDLSIASLVDGVNRMKLPANGYAIMMHKDGTVIAYKDQAKTMKPIGEIDNDLNRNVPE
                     QSRAAGTLLPMYFENEGRDKLVWSVDIPNTDWELVLVLDKETLEAPLSSLLFTQLGLA
                     ALALLLSVLAISWLVGMLLGPLSRVSQALAHIADGNGDLTQRISVDTQDEVGVLADSF
                     NRFVGSQHQLISHIRQLANELDADAERSLATTQTSVTELQRQQQEVAMVATAVTEMAS
                     ATNEIAANAENTATAAQQSAASSLQGKELVNKTRNSINSLADEVTQATDVIADLSRHA
                     QSISSILATIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQE
                     VHTTIETLQRTTARAVSLMESSQALAGHSVEDANAAAKALEEITQAVNVISDMAGQIA
                     TAAEEQTQVTGEITQNTVAIKDVTDEITASAMADLAQARGLKARANDLNAQVATFIL"
     gene            221163..223034
                     /locus_tag="SBAL_RS00970"
                     /old_locus_tag="Sbal_0194"
     CDS             221163..223034
                     /locus_tag="SBAL_RS00970"
                     /old_locus_tag="Sbal_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011845468.1"
                     /db_xref="GI:500171043"
                     /translation="MKSYSLRQKILLSVILALSAVILLLSWQSYTSQKKVLLDVNLEQ
                     AQRLGDQQALLIGEWLASRQKIVKGLAGQRNNDIVQAMKQAKQSGGFESTYFGESNGN
                     MRDSEPATDYTNYDPRTRPWYQEAMRTGGSVLTRPYLDTAFNILVVTLAEPVAGGVIA
                     GDLSISNLIEEVNRMKLPANGYAIMMHKDGTVIAYKDQAKTMKPIGEIDNELNNNLPE
                     LSRTTSTLLPMYFEGEARDKLVWGVDIPNTDWELVLVLDKETLEAPLSSLLLTQFGLS
                     ALVLILSVLAISWLVSVLLGPLSRVSQALARIADGNGDLTQRISVDTQDEVGVLADSF
                     NRFVGSQHQLISHIRQLANELDADAERSLATTQTSVTELQRQQQEVAMVATAVTEMAS
                     ATNEIAANAENTATAAQQSAASSLQGKELVNKTRNSINSLADEVAQATDVIEDLSRHA
                     KSISSILATIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQE
                     VHTTIETLQRTTARAVSLMESSQALAGHSVEDANAAAKALEEITQAVNVISDMAGQIA
                     TAAEEQTQVTGEITQNTVAIKDVTDEITASAMADLAQARGLKARANDLNAQVATFIL"
     gene            complement(223119..224090)
                     /locus_tag="SBAL_RS00975"
                     /old_locus_tag="Sbal_0195"
     CDS             complement(223119..224090)
                     /locus_tag="SBAL_RS00975"
                     /old_locus_tag="Sbal_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845469.1"
                     /db_xref="GI:500171044"
                     /translation="MNIDNLARIDLNLLVILKVLLEEQSVTRAASRLHISQSALSKSL
                     NRLRETLDDPLFQRTAHGLKPTAHALILGQKLPNILQDLYQLTQPPTFNPASSNRQFS
                     FAMVESAYETLIPYFIGPMLTTAPNVKLDSYVWTEKSMQDLQQGQIDFGISGRDLHPL
                     SDFQVDRLPEGIAYQTLFTDQQVCLVREDHPLMAALTSAQWKLPLYLDMAHVQVRCEG
                     SDWWALDYFLADLGHRRRISTTVPDFYGAASVCAHSDLIFTLPSSFARHACQLYPLKL
                     LPLPFEFMPMAYVLLWHQRNDEDQGHKWIRETICESVAKLFTPAEIL"
     gene            224204..225412
                     /locus_tag="SBAL_RS00980"
                     /old_locus_tag="Sbal_0196"
     CDS             224204..225412
                     /locus_tag="SBAL_RS00980"
                     /old_locus_tag="Sbal_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="WP_006079661.1"
                     /db_xref="GI:492986752"
                     /translation="MRRNLLPILMSMVLLSPLAIDIYLPSMPTMAAEFAVSASDVQST
                     IVLFLFAMGLGQVLIGPLADRYGRRPVAIFGVLLYGASSLLAAAAIEFHWLQIARLLQ
                     GLAACSTSIVVFSAVRDCYDQKEGAKIYSYLNGAICVIPALAPTLGGLLAMQFGWRST
                     FVFMTLYAMLMLLVVGYRLPETRPANTVTTGPLYRWGRYKPVLGNTHFLFYAFACMSA
                     MAAILCYVSYAPVWLIGHLGLSELMFSGLFGFNAVFNIVACFTAPLVIRKLGNRPTTI
                     LALSILVLSAAITVAGQQFGPSTGMMAAFAFMLPMLMLGVGFSFLLGPATSMALSAFG
                     ERAGTAAAMLGFIQMSGASVLAGLVQQTNLTAPYAVALVMGVFPIGLLLMMALSRFDH
                     WHQEQLAGEH"
     gene            complement(225584..226417)
                     /locus_tag="SBAL_RS00985"
                     /old_locus_tag="Sbal_0197"
     CDS             complement(225584..226417)
                     /locus_tag="SBAL_RS00985"
                     /old_locus_tag="Sbal_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845470.1"
                     /db_xref="GI:500171045"
                     /translation="MHKRLISIAVVFGLLSTNTFAATDKAYQHDANINYGASSEAFSD
                     GGWSADYRYYSTPVSQDSAPYALSGFLAQTSNFGGKYSFNDDIDSYGVNGEYVFASKW
                     FVGANYFNLDSNFYDANTYGMNLGYYFNATSAVYASYSSSDGDYDAGLSAKGNSDTDA
                     FGIGIRSFIPLQSTAGIDLQANVYYSQSDNTLANGPNGQYNNSNNSTTVNLAADWYIT
                     RAWSIGANYSIQDDEDPYGINTAYHWRITDLISARAGIAKSLEPDWDGVDISLSLNGR
                     F"
     gene            226642..227265
                     /locus_tag="SBAL_RS00990"
                     /old_locus_tag="Sbal_0198"
     CDS             226642..227265
                     /locus_tag="SBAL_RS00990"
                     /old_locus_tag="Sbal_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845471.1"
                     /db_xref="GI:500171046"
                     /translation="MPRFYCAICRYPLNACLCASVQPISPMTQLVVLQHPSEVEHKKN
                     SVRVLSLVVAETQVYVGESEADFNGLREHLTACNKPIYLVYPSEQSVSVEQQPINPDC
                     VLLLLDGTWRKAFKMLQLNPWLTQYPAVHLAEGYESRYRIRKSSRSDSLSTLEACAYM
                     LSALDPRLDVQPLMTAFDAMVELRIKAMPSTVQARYQNSNKPNCETK"
     gene            complement(227527..229647)
                     /locus_tag="SBAL_RS00995"
                     /old_locus_tag="Sbal_0199"
     CDS             complement(227527..229647)
                     /locus_tag="SBAL_RS00995"
                     /old_locus_tag="Sbal_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011845472.1"
                     /db_xref="GI:500171047"
                     /translation="MIRWQHLLKKLSTDDPVLQEKLSLWQAHPHKTPLALIQGFSFIS
                     ANQAALGYFEAEYDAFVNATPYDFSPRIQSSGRNSVEYAREMILEAIAGKNVEFNWLH
                     LSQVGNELPTRVYLYRCYLQQQPVVLVEFQALNRRNQLRATISDGFAHIPKEILSTTL
                     EESAEAVYITDTDDHILAVNKAMCRICGYSAEQLISKTPEFLELKSHHLGEETECQIA
                     LKQRGFWQGETWKKRSDGSNFPAWQSSRKIITEDGDHYNVNIFSDISTKKLLETQLTT
                     RAMYDTLTGLPNRFHLKQILNKALEKLKTDPLTLGALMFLDLNGFKNINDSFGHSMGD
                     RVLQLVAARLEAGCIEKADIARMGGDEFTLVLQDCSCKDEIQLFAEQILSLFESPFEI
                     EGQKFFLGTSIGIALFPTHSDKAGQLISLADTAMYCAKKSLPHLVFYDKAMSQAAELK
                     LQLINSLRHAHSLKQFTLAYQAIVDLHTNQTIAAEALLRWQKSPTEYYDAADFVPLLE
                     ETGLIVSIGQWVLEQACVQAALWRAHNQADFRISVNVSPLQLEHLDFIDQVINALEMA
                     NLPAEALILEITESALLRQPEQARLTLNRIKALGVSIAIDDFGTGLSSLSRLGTLPID
                     SVKIDAEFALRLNEVSGQKLCNAIVQLAQALDIHFVAEGIETQQQRDIMTDMGQGFAQ
                     GFLFGYPSSVDNFTQTFLTEKHIA"
     gene            229941..230312
                     /locus_tag="SBAL_RS01000"
                     /old_locus_tag="Sbal_0200"
     CDS             229941..230312
                     /locus_tag="SBAL_RS01000"
                     /old_locus_tag="Sbal_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620550.1"
                     /db_xref="GI:504433448"
                     /translation="MAHLSKVLISKMLMPLILISSVYFAVANAAESPKPKLTLEQRAD
                     KARIDSQRLEQAQLEKARQATKETAEREDKIKQQSQTNDWEAQQKLKAQKQFDERESR
                     EQKYLREAKEAAAKERKIPKP"
     gene            230423..231073
                     /locus_tag="SBAL_RS01005"
                     /old_locus_tag="Sbal_0201"
     CDS             230423..231073
                     /locus_tag="SBAL_RS01005"
                     /old_locus_tag="Sbal_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,
                     4-benzoquinol methylase"
                     /protein_id="WP_014620551.1"
                     /db_xref="GI:504433449"
                     /translation="MNICPLCHGTELLVYHQDKKRDYHQCQICQLVSVPPEFYLSAEA
                     EKAEYDKHENRADDLGYQTFLNRTLEPLLSRVSTSAKGLDFGCGEGKALSMMAKARGY
                     QIDNYDLYYANNPEALARQYDFITLTEVIEHVSDAAGLLAQLDRLLKPNGILAVMTKR
                     VQDQTAFTRWHYKNDPTHINFYAEATFEWLAHHYGWRLEIIDKDVVFLYKEMHKVN"
     gene            complement(231159..231488)
                     /locus_tag="SBAL_RS01010"
                     /old_locus_tag="Sbal_0202"
     CDS             complement(231159..231488)
                     /locus_tag="SBAL_RS01010"
                     /old_locus_tag="Sbal_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_011845475.1"
                     /db_xref="GI:500171050"
                     /translation="MMVVIFEVVPNPGCQERYLEIAADLKSSLSEIAGFISIERFQSM
                     VNPERLLSLSFWENEAAVQAWRRQIYHREAQTQGHEQLFADYRLRVAEVVRDYGMFDR
                     AQAPRSN"
     gene            complement(231485..231868)
                     /locus_tag="SBAL_RS01015"
                     /old_locus_tag="Sbal_0203"
     CDS             complement(231485..231868)
                     /locus_tag="SBAL_RS01015"
                     /old_locus_tag="Sbal_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NIPSNAP family protein"
                     /protein_id="WP_011845476.1"
                     /db_xref="GI:500171051"
                     /translation="MQLKPLAHKPMAPNTMKITCFIEYKIDPFKLEQFAQYAENWGDI
                     IPVYGGELLGYFLPHEGTNDTAFGLISFDSLAHYERYRYKLKTEAAGKANFQLAKQGE
                     FILSEKRSFLKPIAKTYQRAAETKL"
     gene            231933..232652
                     /locus_tag="SBAL_RS01020"
                     /old_locus_tag="Sbal_0204"
     CDS             231933..232652
                     /locus_tag="SBAL_RS01020"
                     /old_locus_tag="Sbal_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_014620552.1"
                     /db_xref="GI:504433450"
                     /translation="MEPNIAFIANLIGDAARSRMLIALMGGEALTATELALEADITPQ
                     TASSHLTKLVEGELLLVRKQGRHKYFQLQSRQVAELLESLLNMSAAIANPNVIHGPAD
                     PRLRLARICYDHLAGELGVALYDSLSRQDLIVHEGGETKITAAGMTFFAKRGVEHSLL
                     GAPDDVFDVPKSRQSRRPLCKSCLDWSERRSHLAGVLGQWVLKDILAKGWAEKALDTR
                     ALQFSSRGLKSFRADYGIESK"
     gene            233182..233543
                     /locus_tag="SBAL_RS01025"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            233540..233731
                     /locus_tag="SBAL_RS01030"
                     /old_locus_tag="Sbal_0205"
     CDS             233540..233731
                     /locus_tag="SBAL_RS01030"
                     /old_locus_tag="Sbal_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845478.1"
                     /db_xref="GI:500171053"
                     /translation="MSQFKLELAESELKYVLEGLMALELQMAETCEASDDPDEIADIG
                     NDLIELRLLLNPLKEKAIS"
     gene            234359..235774
                     /locus_tag="SBAL_RS01035"
                     /old_locus_tag="Sbal_0206"
     CDS             234359..235774
                     /locus_tag="SBAL_RS01035"
                     /old_locus_tag="Sbal_0206"
                     /EC_number="3.5.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acyl-L-amino acid amidohydrolase"
                     /protein_id="WP_011845479.1"
                     /db_xref="GI:500171054"
                     /translation="MTLPSVSPSAISKSAIPKAFEFKSFANKAIFSKTLLASALALSF
                     MGAGLNSAQAATNTMPDAAKLAAGVEQKVIDWRRDLHQHPELSNREFRTSKIIEKHLK
                     SLGLEVQTGVAHTGVVAILKGGKLKGGKSGPLIAIRADMDALPVTEVVDLPFASKATD
                     TYRNQKVGVMHACGHDTHVAMLMGVAENLVKVKDSLAGDVMFIFQPAEEGAPDGEEGG
                     AELMLKEGLFAKRKPDQVFGMHVTSSMPSGMIGVRSGPAMASEDSFTIKVKGRQTHGS
                     RPWNGVDPIVAAAQIITNVQTIVSRQVDITKAPAVVSFGAVNGGIRSNIIPDEVELIG
                     TIRTFDQPMRADIKVRLAEMAELSAKTLGASATTEIHPGYPVVVNNPELVASMRPVLA
                     SVVGDKMLIEPGLITGAEDFSYYALEAPGMFFFLGVTPKGTDPETAASNHSPAFYVDE
                     SALKVGVEAMTKVALTALNAQ"
     gene            235912..237243
                     /locus_tag="SBAL_RS01040"
                     /old_locus_tag="Sbal_0207"
     CDS             235912..237243
                     /locus_tag="SBAL_RS01040"
                     /old_locus_tag="Sbal_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_011845480.1"
                     /db_xref="GI:500171055"
                     /translation="MKRTLSALVLAMGLFNPLSQAQATTAEDIKSFTLDNGMKIMVLE
                     DASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGSKKYGPKMFDRTMEAAGGAN
                     NAYTTEDMTVYTDWFPANALETMFDLEADRIANLDINQTMVDSERGVVQSERSTGLEN
                     SNWNALEGEIKGVAFLAHPYSWSVIGHESDIAAWTLEDLVQYHKTYYAPNNAVVVIAG
                     DVKVAQVKALADKYFAPIPAQTPPKAIRTVEPEQKGERRTFVQKASVSTPNVMLAYHI
                     PAATHADFYALDLLSSILSQGNSSRLYQSLVDKQVALEAQTYMPMSVDPNLFYVMGVA
                     TPEVKASTLEQALIEQIDAIATMGVTQQELDKVKNIKLMDFYRSMETINGKANTIGTY
                     EMYFGSYDKLFNAPEAYNKVTPADIQRVAQTYLRKSNRTVAVLAANEEISQ"
     gene            237240..238703
                     /locus_tag="SBAL_RS01045"
                     /old_locus_tag="Sbal_0208"
     CDS             237240..238703
                     /locus_tag="SBAL_RS01045"
                     /old_locus_tag="Sbal_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_011845481.1"
                     /db_xref="GI:500171056"
                     /translation="MKSMAMKSLKMASLGKPSKLMAALALGTSLALAGCATTSAPKRV
                     ETGSFVMPSYDKFVLDNGLTVYLMPQREVPLVTLNAVVRAGAVNDTTAGVAQMTAEGL
                     LLGAAGKSKADIEQQVDFLGASLGAEADKEGSYLSADFMAKDTDVMLGLFSAAMLTPD
                     FDAAEFDKLKQRAIAGLQQDKESPRAVIGRYFDKLVFGAHPYGNAASGNSDSLEQVTV
                     SQLRAFHKSYYQPANTAITVVGDFDVAAMKAKLTQTFGQWKGSEKLVQPDLNQGLPQL
                     TAAKVLLVDKPDAIETTFVIGGLGISRDNPDYVGLTVVNTILGGRFTSWLNDELRVNA
                     GLTYGARSGFSPYTDSGVFTISTFTKTETTQEAIDLALKTYARLWEKGVDQTTLDSAK
                     AYVKGQFPPKFETSGQLAGLLSGMYLYGFDDKFINEFQAKVDGLTLEETQRLVKTYFP
                     QKDLQFVLIGNAAKIAPIAAKYGKVQTVDIKATGFGQ"
     gene            complement(238822..240843)
                     /locus_tag="SBAL_RS01050"
                     /old_locus_tag="Sbal_0209"
     CDS             complement(238822..240843)
                     /locus_tag="SBAL_RS01050"
                     /old_locus_tag="Sbal_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="WP_014620554.1"
                     /db_xref="GI:504433452"
                     /translation="MKKTGILLLCLLMPFSSAFADQGKPLSAELLWQLKRIGSPIVSP
                     TGEHIIAPVTEYDLKADKGSTQLWHFDGKHNRAITAKGLRVSEPVFSPDGKTLAFVSQ
                     RNEDEASQIYLLPMDGPGEAQRLTDIPTGVNSIKWVGKHLYFISNIFPNQSWEEMKTQ
                     LTTDTDNKVSAHQWNALPYSQFDHWLDERRQAHVFRIPAKGGNVENITQPAGHELPRS
                     DQSSASYDVSPNERWIAFNAYGSENKVDPKIDIFLATIGGNKAENLTADNQAPDLNPS
                     FSPNGKTLAFTRQKIPGFYADTSRLMLLDIDSRKLTTLTSDWDRSVSQFSWTPDNKGF
                     YATVEDAATNRIYSIDAKNGKVKAITEATDFSQPAIGKDGELIATNQSFLYPARLVSI
                     NPRNGKIERLENFNDDILKDVDLGTYESVTYKGYQGKDIQMWVHYPAGFDRSKKYPLF
                     MLVHGGPHNAITNGFHFRWNAQTFASWGYVTAWPNFHGSSGFGQEFADSINPDWKTKP
                     LEDVLKAADWFKQQSWIDSDRMVAGGASYGGYLTSIILGQPHPFKALLIHAAVYDMYA
                     QMASDFAVHSTRFGNYWDNPELYKAISPHYFAANFNTPTLVSHGQLDYLVPATQGFEL
                     FHTLQSRHVESRMIYFPDENHWIMKPNNSVYWYNEVKKWMTHFAEPGAR"
     gene            241138..241710
                     /locus_tag="SBAL_RS01055"
                     /old_locus_tag="Sbal_0210"
     CDS             241138..241710
                     /locus_tag="SBAL_RS01055"
                     /old_locus_tag="Sbal_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845483.1"
                     /db_xref="GI:500171058"
                     /translation="MPLKIDRLNLMLVFATLLSVFSSSSVMAAKVSFKEFCPQLVGQW
                     AGDAAKAGEIPRNVAVTGFCSHDQRQLILSVSIGTKAPFSETWWFREQGDQVLLTYYD
                     GVAEDKQQVFSLYRQNGDYSLLGEGVVNARPALIQLLFDAQTQTQTQAQAQNQAGGWQ
                     WTQNIQYLDDDIDRYQLFRGIEMTPVAPSP"
     gene            complement(241753..242217)
                     /locus_tag="SBAL_RS01060"
                     /old_locus_tag="Sbal_0211"
     CDS             complement(241753..242217)
                     /locus_tag="SBAL_RS01060"
                     /old_locus_tag="Sbal_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079682.1"
                     /note="member of the SPOUT superfamily of RNA
                     methyltransferases; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_011845484.1"
                     /db_xref="GI:500171059"
                     /translation="MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDLEEKKL
                     RRAGLDYADLTNVTRHKDFDAFLEAMAGKRIMACTTKGSRPHTELSFAKDDVLLFGPE
                     TRGLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISYEAWRQLDFAGAL"
     gene            242378..243151
                     /locus_tag="SBAL_RS01065"
                     /old_locus_tag="Sbal_0212"
     CDS             242378..243151
                     /locus_tag="SBAL_RS01065"
                     /old_locus_tag="Sbal_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011845485.1"
                     /db_xref="GI:500171060"
                     /translation="MFSHFITLFIFYVLFLQSIFTPAYAADDAVTSAGGKRQMTAYLG
                     EIPGLINADGTGPFVELVKAIDRADPEVEIDIKVFPLSRAMLGVTLGRADFGLPAIRN
                     NAALDALPYRFSSVSFGQVTHVLYTNVDKPITKAMLFDQQQTGRVFTVEAIPDYMPIP
                     AEPSITIKRSLLKLSHGRIDAFVWAQEEADMMLKQLKLHNIHREDFGDFEDVFVIAKG
                     PEGDAVDAYLSRMIELLRQTGELSQIYQTIHLSYNDWQP"
     gene            243278..244135
                     /locus_tag="SBAL_RS01070"
                     /old_locus_tag="Sbal_0213"
     CDS             243278..244135
                     /locus_tag="SBAL_RS01070"
                     /old_locus_tag="Sbal_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845486.1"
                     /db_xref="GI:500171061"
                     /translation="MPFVIALLAPVFWGTTYALVSLYLHDMSPYWVAVWRALPAGILM
                     LMLRPRLPTLVWSKLGLLAFCNIGAFFTLLFIGAYRLPVAVAGTLGATLPLIFLILAW
                     VIDKKRPGMKWLLLGLMGLGGVILLLNPSADLDPIGVLCMLSATTLIAFSSRWMQKWD
                     VGDFLVLTAWQLFLGGLMLIPLAWFMAGPPQLPSLTVVPSLIWLVIANTAIAYWAWLW
                     SMRNLGPEIMGMVALVNPVVAVSLGVIIVGETLDMRQWAGIGVILLSLLLMKLPQNLR
                     LNPFKKVQP"
     gene            244164..245105
                     /locus_tag="SBAL_RS01075"
                     /old_locus_tag="Sbal_0214"
     CDS             244164..245105
                     /locus_tag="SBAL_RS01075"
                     /old_locus_tag="Sbal_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845487.1"
                     /db_xref="GI:500171062"
                     /translation="MLKRLDLNLLPVLEILLEEQSVTAAAARLHLSQSAVSKQLTRLR
                     EVFDDPLFERTAYGLKPTPKALSLAPELRQCLQQLAQFTRPDTFEPALSQRQFRMHLV
                     ETTYSLTFPHFMPSLLAQAPGVSLNCQTWRLDTMDRLLRCDIDLAIGCREWDERSPMH
                     VSHIPDDLCHVELVQDYPVCLMRRDHPALTQEWNLDTFLSYRHLQVAFGGLEHWLLDD
                     VLQLEGRQRDIAVNMTDFQSALTLCEHSDLILCAPSRYAFAVMKSFELQSLPSPIKLI
                     PGAYLLMWHKHFEHDLSHKWLRELIISQVLPSITPRV"
     gene            complement(245089..245970)
                     /locus_tag="SBAL_RS01080"
                     /old_locus_tag="Sbal_0215"
     CDS             complement(245089..245970)
                     /locus_tag="SBAL_RS01080"
                     /old_locus_tag="Sbal_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_011845488.1"
                     /db_xref="GI:500171063"
                     /translation="MKDVALVLEGGGLRAIYTAGVLDAFLQQSLNFNYVIGVSAGAIY
                     PASYVSRQFGRNLQIQQQYLNDKRYMGLRHWLATGNYVNTDFTYRRMAYELLPFDFDT
                     FLNSHTEFKVGAFNCNTGKTDYFGMADFNDHDKLLDVLIASSSLPFMSKPSVINQHHY
                     LDGGIGEPIPLAQSRKDGYARQVVILTQDQHYQKTAMKMNWLARKAYKRYPAVAHALS
                     ERHRVYNQALTELDQAVTSDDAFVIRPALPLNLSRLDRNIDKVTAVYQQGLADGKTVL
                     PALTAWLAAPKEPKPEA"
     gene            complement(246049..247062)
                     /locus_tag="SBAL_RS01085"
                     /old_locus_tag="Sbal_0216"
     CDS             complement(246049..247062)
                     /locus_tag="SBAL_RS01085"
                     /old_locus_tag="Sbal_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845489.1"
                     /db_xref="GI:500171064"
                     /translation="MNKNMIKGMIVFAAIAEKGSMSAAAQQLNLSSSAVSQQVTKLEM
                     DMGISLFHRNTRNLTLTEAGSLFYENCRKVIAIVESTEQKLNNLKGIPSGELKIAAPI
                     GFGGGLLSEPFNYLLAAHPQISLNLLLQDGPIDIVNEGIDLAICIGPLSDSNLIARHL
                     ADWRMLLCASPDYLPMHKIFKHPAELAAFNRINHPCANSETLTHVRNKECFELTSQRI
                     TVNNMQALIQLTLDGLGFAALPEPEVHKYLESGQLVTLLPEWSLNTYSVYSVTSARDK
                     QPAKVKEALNTLSQYFSQANFNPAYHFKQCVQKDGTKGSVTNILPIKPKQASHHADVD
                     HAS"
     gene            247187..249187
                     /locus_tag="SBAL_RS01090"
                     /old_locus_tag="Sbal_0217"
     CDS             247187..249187
                     /locus_tag="SBAL_RS01090"
                     /old_locus_tag="Sbal_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090509.1"
                     /note="YiuR; outer membrane siderophore receptor; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="WP_011845490.1"
                     /db_xref="GI:500171065"
                     /translation="MLLSRKKYLAQVITALCLLPAVPVTNALADTAPDKEKMMERIVV
                     TASGFEQQIRDAPASISVITREDLDNRFYRDLTDAMLEVPGVVITGGADRQDISLRGM
                     GSQYTLILVDGKRQSSRETRTNSDGPGVEGAWTPPLAAIDRIEIVRGPMSSLYGSDAI
                     GGVINIITRKVPNEWQGEVRLDTTLQEKSTSGNVYQSNFFVNGGLIKDLLGMQLYGQY
                     TQREEDNIYGGYRGRDATNLTARFALTPNENHDIMLEVGVSNQELDSSLGKTVTPLAP
                     GEACGRRGCPQSSTTEYENSTISLSHTGRWDFGTSDSYIKHEVFDNKTRKMKITNTDV
                     QSSLITTLGQSHTATFGAAFNHQDLTDETGNQVSNLTDISRRQWSVFSEDEWRIVDNF
                     ALTMGLRLDDDENFGHHVSPRVYGVWGLTDSTTLKGGVSTGFRAPSLRQTVPDWGQVS
                     RGGNMYGNPDLQPETSVNYELGVYSDLTESITASAGVFYNEFKDKITRVACPATQCTD
                     GPNQFGSDPTTYVNIDDAVTQGIELSIDYRIRSNLSFTGNYTYTDSEQKTGAYKGSPL
                     NQLPKHLIQASFNYEPIDNLSTWLRVNYRGEESQPTTGPSSSSFIAPSYTLLDLGANY
                     QLNDSLKFSAGIYNAFDKDITQEEYGYLEDGRRYWLGMTYSF"
     gene            complement(249259..249519)
                     /locus_tag="SBAL_RS01095"
                     /old_locus_tag="Sbal_0218"
     CDS             complement(249259..249519)
                     /locus_tag="SBAL_RS01095"
                     /old_locus_tag="Sbal_0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845491.1"
                     /db_xref="GI:500171066"
                     /translation="MGFNEQEKHALLALKGVGPTVIKRFEEIGISSLQQLAQHEVDDI
                     ANLVASMLRTTCWKNSPQARNAIGAAIELARAHPPAKNSHSY"
     gene            complement(249651..250988)
                     /locus_tag="SBAL_RS01100"
                     /old_locus_tag="Sbal_0219"
     CDS             complement(249651..250988)
                     /locus_tag="SBAL_RS01100"
                     /old_locus_tag="Sbal_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079693.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_006084542.1"
                     /db_xref="GI:493001065"
                     /translation="MSSVIQTLSGAIATPYQANITVPNWMLGSMERVMQYYVDKNLRL
                     DTLSAEMMPAPVEGKKYMLYAHIPFCHTLCSYCTFHRFMFKEDKARAYFISLRKEMEM
                     VKALGYDFESMYIGGGTTTVLEDELARTIEHAKTLFPSIKEVSCESDPQHLDSPGFKQ
                     LKGLVDRMSIGVQSFNDDILKMTDRLDKFGTGQQTFDKIMGAKELFPIINVDLIFGFR
                     GQTDEVIQHDLDMASRLDPRQITTYPLMITHQTRKSVKGKLAAPQADMANQYRQILNS
                     LNGQYNQLSAWAFGKTDDEGFDEYVIDYDEYLGVGSGSFSFLNDTLYVNTFSLRKYQE
                     RIAAGHMGVEQQKNYSKKDVMQYRFLLGMFSGRLSRKYFRDTFGVNLDTALFKEMTSM
                     KLIGAIKNDPRDPDNLIVTDNGKMMGLLMMKEFYSGMDNVRAQLRKPLKPCDM"
     gene            251367..252278
                     /locus_tag="SBAL_RS01105"
                     /old_locus_tag="Sbal_0220"
     CDS             251367..252278
                     /locus_tag="SBAL_RS01105"
                     /old_locus_tag="Sbal_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium transporter"
                     /protein_id="WP_011845492.1"
                     /db_xref="GI:500171067"
                     /translation="MLVNVNRFFPLLALIGAVTAYLMPSWFTELKSAIVPLLVIIMLS
                     MGLTLDLQDFANAFKQKRAVLTGLILQFSVMPLSALLISQLLGLDRELTIGMVLVGSV
                     AGGTASNVVCYLAKGDVALSITMTALSTLAGVVLTPLIIKLLIGEMIDIPFVDMLLSL
                     VKIVLFPVSAGVIINHFFKSLVAKVAPALPLISILAIVMAITIIVALNTNQFDKVGPI
                     ILLAVFLHNGLGLALGYFCCRLLGFNHTVCKTISIEVGLQNSGLATALCIKFFSPISA
                     IPSAIFSIWHNLSGAILAGYWARESQD"
     gene            complement(252351..253742)
                     /locus_tag="SBAL_RS01110"
                     /old_locus_tag="Sbal_0221"
     CDS             complement(252351..253742)
                     /locus_tag="SBAL_RS01110"
                     /old_locus_tag="Sbal_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845493.1"
                     /db_xref="GI:500171068"
                     /translation="MKIFTIATLLLLLTVSFAATAEKSTLEQLFEQQQYDAFLQQAQQ
                     QAAENNADALFLLGKAYHLGRGVTQDNATASQYYEQARALGSARASHNLGSMALDNDR
                     KTQAIPLLEEALARGLKLPTLYNLGRAHSPADPSSRFYLAKAIAAAQRAGSYFGQAFE
                     LQPDNLYLDNASREYLRAYLIAMQSVGSERESLDLPQLRQQAIKWLELGMAADNGTAW
                     TNYGALLLNENDYSGAKAAFLQGAKRQVAIANYHLGSMEERGLGAETDKVQALAYYEK
                     AALAGMEQAKAPAYELLKAQLEYEDDLTKLEQGVARFNALKQQDQYAPISLDSVINRL
                     AWGTFLAQQRQQTISLPTAAKTQLSLQACGLGYNQLHGSTYNIGENSHWRMAAYLTLA
                     DKIALPLEGRVDEHGCASLTIAMTDQLYRLLQQGAVFGLRFPNYTLPLALSRQENILQ
                     LTLMPVETPLPVN"
     gene            complement(254292..255182)
                     /locus_tag="SBAL_RS01115"
                     /old_locus_tag="Sbal_0222"
     CDS             complement(254292..255182)
                     /locus_tag="SBAL_RS01115"
                     /old_locus_tag="Sbal_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845494.1"
                     /db_xref="GI:500171069"
                     /translation="MKTASQTMMSFTLASSALLASYAAQANPVETSREYKLLLDPSHF
                     NYATQSTTANSYLTDAKQAISNAISRNITGSWALTKARQVAFYDTPTSCQLKQLGYIF
                     RDRTSDDKSEVTLKFRSPDRFIADFEDLSSPDNQADTKLEADISTDINNGIRIVYSHS
                     TTTPNTRTLNDMADVNSHFSGFADAYGLSNNLTLAKVGGLTINEYVFEGSEIDLGSID
                     ASLELTLWYTSSPSASQQPVIAEVSFKYKDPNSNYTAKVVQRAKLAFDAMAQLSAWNS
                     TSSLTKTAFIYAAAPNFCSQ"
     gene            complement(255315..256856)
                     /locus_tag="SBAL_RS01120"
                     /old_locus_tag="Sbal_0223"
     CDS             complement(255315..256856)
                     /locus_tag="SBAL_RS01120"
                     /old_locus_tag="Sbal_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845495.1"
                     /db_xref="GI:500171070"
                     /translation="MKNVLVTSGLCLSVLLLSACNSDDKDINSLTTQTTLVGGDSHCW
                     MGGTRTDSGLDSNDNGKLDSNEVVDSSYACNTDLFTDKAVHLPFTVLRDDLDNGAMPG
                     TKFEIRNGGYGSDAAPNPNNPIQFYALTDRGPNADYSGSLGKGKMFPTPDYTPRIGLF
                     ELQTNGTITKIKDILFKRPDGSLITGLPNSSSLGGTGEIPYDAAGEVIRQDMSQPYNA
                     QTNPIKLDDYGLDSEGLAAMDDGSFWVSDEYGPHIVHYSAEGVEIARINPFADDARNL
                     YSLPAEFAHRRANRGMEGLTITPDQSTLVGIMQSTISNPDKSVNNNTLTRIVTINLAT
                     GAIGQYLYQQEIAQNSNSAIVALSNSQFLVLERDAKFFNIDTDVMKHVYKIDISGATD
                     LETVTAQADIAQDAALGLTIKGKTLEQVALSDGWEVLAANGIIPATKSLVLDMAAKTQ
                     YPHDKMEGLWLIDNKRLGVLNDDDFATWSNNNTLEQKYLDSAQSDIDGNTLYIVDDLP
                     LSADK"
     gene            complement(257317..257805)
                     /locus_tag="SBAL_RS01125"
                     /old_locus_tag="Sbal_0224"
     CDS             complement(257317..257805)
                     /locus_tag="SBAL_RS01125"
                     /old_locus_tag="Sbal_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4YBV6.1"
                     /note="CycJ; periplasmic heme chaperone that binds heme
                     transiently via a histidine residue and delivers it to
                     newly synthesized and exported c-type cytochromes;
                     requires the ATP hydrolysis activity of the CcmA protein
                     in order to transfer the heme to the apocytochrome; part
                     of the cytochrome c maturation system; periplasmic protein
                     anchored to the inner membrane; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c-type biogenesis protein CcmE"
                     /protein_id="WP_006079699.1"
                     /db_xref="GI:492986876"
                     /translation="MNPRRKKRLTLAVALIGGVAAITSLLLYALNSNLNLFYTPSEIV
                     HGKTDTGVKPEIGQRIRVGGMVTVGSMVRDPKSLHVQFAVHDSLGGEVLVTYDDLLPD
                     LFREGQGIVAQGVLSADGKLEATEVLAKHDENYMPPEVAEAMGQKHEKLDYSQQKAPD
                     TK"
     gene            complement(257802..258002)
                     /locus_tag="SBAL_RS01130"
                     /old_locus_tag="Sbal_0225"
     CDS             complement(257802..258002)
                     /locus_tag="SBAL_RS01130"
                     /old_locus_tag="Sbal_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmD"
                     /protein_id="WP_006079702.1"
                     /db_xref="GI:492986888"
                     /translation="MQFDSISDFFNMGGYAFYVWLSYGVTFCCLSTLIITSARQKRKV
                     LIEIAKKMDREERLKETRSTKS"
     gene            complement(258002..258748)
                     /locus_tag="SBAL_RS01135"
                     /old_locus_tag="Sbal_0226"
     CDS             complement(258002..258748)
                     /locus_tag="SBAL_RS01135"
                     /old_locus_tag="Sbal_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter permease"
                     /protein_id="WP_006079703.1"
                     /db_xref="GI:492986892"
                     /translation="MWKWLHPYADPERAYKLSGTLFPWFAILAGLFIAVGTTWGLAFA
                     PTDYQQGDSYRIIFIHVPAASMSMAAYMGMATAAFIGLVWQIKLADWAAASIAPIGAV
                     ITFIALFTGAAWGKPMWGAWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARAAG
                     ILAIVGVINIPIIKYSVEWWSSLHQPSTIRITEKSTMSTEMLYPLLINMLGFGLMIGA
                     ITIVRFRAEILARNGMRPWVRELAKAEEVK"
     gene            complement(258750..259436)
                     /locus_tag="SBAL_RS01140"
                     /old_locus_tag="Sbal_0227"
     CDS             complement(258750..259436)
                     /locus_tag="SBAL_RS01140"
                     /old_locus_tag="Sbal_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007644473.1"
                     /note="with CcmABCE is involved in the transport of
                     protoheme IX; CcmB is required for the release of holoCcmE
                     from CcmC; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmB"
                     /protein_id="WP_006079706.1"
                     /db_xref="GI:492986903"
                     /translation="MKRGISFTQAFFTLLQRDLKIAIRHRGDIFNPLLFFIMVVTLFP
                     LGIGPEPQMLARVAPGIIWVAALLASMLSLERLFKADFSDGSLEQMLLSPQPLAILVL
                     AKVLAHWILTGVPLIIIAPLLAVLLNLDGNSYGALISTLALGTPVLSLLGAIGVALTV
                     GLRKGGVLLSLLILPLYIPVLIFATSAIDAAGMNLPYDGQLAIIGAMLVGSLTLAPFA
                     IGASLRVSTN"
     gene            complement(259448..260098)
                     /locus_tag="SBAL_RS01145"
                     /old_locus_tag="Sbal_0228"
     CDS             complement(259448..260098)
                     /locus_tag="SBAL_RS01145"
                     /old_locus_tag="Sbal_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HNQ5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmA"
                     /protein_id="WP_006079707.1"
                     /db_xref="GI:492986908"
                     /translation="MTNITKETTLVSASKLTCIREERILFDELSFDINAGDIVQIEGP
                     NGAGKTSLLRILAGLSRPYAGQTFYRNEDINRCRDEYNEDLLYLGHLAGVKCELTAEE
                     NLNFNLRISGYDDFDTSAILAKVNLTGFEEALAGHLSAGQHRRTALSRLWHSNCKIWI
                     LDEPFTAIDKKGVEELEQLFIQHADNGGCVILTTHQDMGIIKDDRLRKIRLDYRFI"
     gene            260417..260716
                     /locus_tag="SBAL_RS01150"
                     /old_locus_tag="Sbal_0229"
     CDS             260417..260716
                     /locus_tag="SBAL_RS01150"
                     /old_locus_tag="Sbal_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011621040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase"
                     /protein_id="WP_006079708.1"
                     /db_xref="GI:492986911"
                     /translation="MKKLLAMTAVAALTMSVNVSAQEAEAIFNKACTVCHSMGVAGAP
                     KVHNAAEWEPRLAKGIDALLHSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKAQ"
     gene            complement(260780..262033)
                     /locus_tag="SBAL_RS01155"
                     /old_locus_tag="Sbal_0230"
     CDS             complement(260780..262033)
                     /locus_tag="SBAL_RS01155"
                     /old_locus_tag="Sbal_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_011845496.1"
                     /db_xref="GI:500171071"
                     /translation="MTTFWIFIALVMLVGLMLIWIPHFRQQKLLKTEEAGVRKQTNLE
                     LFNERLGVLEKELSEELLDQAEFDALKKELEISLLQDIKEASDDSLVNQIKPKTILWP
                     SIMSVCLIVISGYLYQHLGAFENIETAQQPANPHAGMDTAQIMAQRVQMMEAQVKAEP
                     ENSQVWFSLGHAYVSANQYDKGIAAFDKVMDLVGKHAELLGPKATAMYYKAGQQMTPQ
                     IKAIIDESLAMDAQDPSTLLLVGMDAFFTADYKQAIASWQTILDSDRADVDRAALMNA
                     IETANLRMQSETTGMPNDDTHKQVKASAAKSVNVTISISAELAAKASPEDTIFIFARA
                     TEGPKVPLAATKVSAKSFPVTVTLDDSSGMGGDKKLSDATNVEVIAVLSKHGNIKPQA
                     GDLQGKISTVAVGDTANLVLDTQVQ"
     gene            262434..264413
                     /locus_tag="SBAL_RS01160"
                     /old_locus_tag="Sbal_0231"
     CDS             262434..264413
                     /locus_tag="SBAL_RS01160"
                     /old_locus_tag="Sbal_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079710.1"
                     /note="cytochrome c-type biogenesis protein; required for
                     the transfer of heme to apocytochrome c; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme lyase subunit CcmF"
                     /protein_id="WP_011845497.1"
                     /db_xref="GI:500171072"
                     /translation="MIPELGHFALIIGVAFAFLLISVPLIGVARKDQYLVRYAWPLTY
                     GMFFFITVSVVVLAYSFAVDDFSVAYVAHHSNSQLPIFFKISAVWGGHEGSLLFWVFA
                     LSTWAAAVALFSKGLEEVFTARVLAVLALIVIGFSLFMLLTSSPFERLFPIPAEGRDL
                     NPMLQDVGLIFHPPMLYLGYVGFSVSFAFAIAALMSGRLDSAWARWTRPWTLAAWIFL
                     TGGIALGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALVHSLIVTEKRGAFRNWTV
                     LLSIFAFSLSLLGTFIVRSGVLTSVHSFAADPSRGMFILLLLGLAIGGSLTLFAFRAS
                     EMSSPARFELKSKETMLLVCNVLLTVAAGTVLLGTLYPLLIDALGMGKISVGPPYFNA
                     VFVPIVLVLFGFMGIGPIIRWKKSKAGELRRQLLIPAMVAAAIGIVTPFIVDGVFNTW
                     VAFGIAAASWIILATARAAYNMVKSKEGDISISRMGRSQLGMIFAHLGIAVSVIGATM
                     VSNYSIEKSVRMGPGISQELAGYTFKYLETKNVVGPNYTAVQGQIEVYKGDELLTLLK
                     PDRRQYNVRTMDMTEAGIDWGLFRDLYVTMGDPITSTEFAVRLNYKPFVRWLWFGAIF
                     MMIGGFFAASDKRYRVKVTAAVAPSAEKAKLATAQ"
     gene            264425..264979
                     /locus_tag="SBAL_RS01165"
                     /old_locus_tag="Sbal_0232"
     CDS             264425..264979
                     /locus_tag="SBAL_RS01165"
                     /old_locus_tag="Sbal_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079711.1"
                     /note="cytochrome c-type biogenesis thioredoxin; involved
                     in the reduction of disulfide bonds to allow heme bonding;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_011845498.1"
                     /db_xref="GI:500171073"
                     /translation="MKKLVLFIPLVIFLAMGVFLYKGLFLNPQQLDSALEGKPIPAFQ
                     LERLETPAEIITNEQLKGKVSLLNVWATWCPSCKYEHPFLVMLKRKNLLPIYGINYRD
                     ERAPALEELKRQGDPYNVNIYDKDGRLGLDLGVYGAPESFVVDHNGIIRFRYAGPIDL
                     RVWSETLYPMIQQLQAEAAKDGAS"
     gene            264976..265455
                     /locus_tag="SBAL_RS01170"
                     /old_locus_tag="Sbal_0233"
     CDS             264976..265455
                     /locus_tag="SBAL_RS01170"
                     /old_locus_tag="Sbal_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_006079712.1"
                     /db_xref="GI:492986935"
                     /translation="MRTLTKIIGGLVLLFSMTTAVMATPVDTYEFKTPENQKRGLSLA
                     HELRCPQCQNQNLIDSNSPVARDLRLEVFKMVDEGKGDDEIIEFMTSRYGEFVLYNPK
                     METKTYILWLGPIGLLLMGLVIGFIFIRKQRISGNVPNEISEEDQRELDTLLKRNTK"
     gene            265452..266039
                     /locus_tag="SBAL_RS01175"
                     /old_locus_tag="Sbal_0234"
     CDS             265452..266039
                     /locus_tag="SBAL_RS01175"
                     /old_locus_tag="Sbal_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014357879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="WP_011845499.1"
                     /db_xref="GI:500171074"
                     /translation="MKHKVIKALLLSSLFSLLAGGVAHAYPGMQQATKPMESTVDLIN
                     VLPKTFPIEPVAFNDVDGKAIDFSQFKGKIIMVNMWATWCPPCVRELPAIERLATKFK
                     AEDFVLLPISIDAEGKQQVQPFLNSLGMPNFNSYYDQSQSLGDVFPLDTIPATFILDQ
                     QGQLIAFVRSYVDWDDAKAVSLIQGFIDKGSKKPN"
     gene            266569..268114
                     /locus_tag="SBAL_RS01180"
                     /old_locus_tag="Sbal_R0004"
     rRNA            266569..268114
                     /locus_tag="SBAL_RS01180"
                     /old_locus_tag="Sbal_R0004"
                     /product="16S ribosomal RNA"
     gene            268475..271402
                     /locus_tag="SBAL_RS01185"
                     /old_locus_tag="Sbal_R0005"
     rRNA            268475..271402
                     /locus_tag="SBAL_RS01185"
                     /old_locus_tag="Sbal_R0005"
                     /product="23S ribosomal RNA"
     gene            271523..271638
                     /locus_tag="SBAL_RS01190"
                     /old_locus_tag="Sbal_R0006"
     rRNA            271523..271638
                     /locus_tag="SBAL_RS01190"
                     /old_locus_tag="Sbal_R0006"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            271675..271751
                     /locus_tag="SBAL_RS01195"
                     /old_locus_tag="Sbal_R0007"
     tRNA            271675..271751
                     /locus_tag="SBAL_RS01195"
                     /old_locus_tag="Sbal_R0007"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:271709..271711,aa:Asp,seq:gtc)
     gene            272263..272775
                     /locus_tag="SBAL_RS01200"
                     /old_locus_tag="Sbal_0235"
     CDS             272263..272775
                     /locus_tag="SBAL_RS01200"
                     /old_locus_tag="Sbal_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011715479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845500.1"
                     /db_xref="GI:500171075"
                     /translation="MLYDLTVVQFSKMLKNLSVILEKGECFANLKKVDMAVLLNSRLA
                     PDQFNLIRQVQIACDTAKIGVARLTDNLDTVPKHDDSETTLADLQARISSVLDYLATF
                     KADDFANAATIHVSQPRWEGKYLTGYEFAIEHAIPNIYFHVTTAYAILRHNGVEIGKK
                     DYLGAMPYKS"
     gene            273187..273384
                     /locus_tag="SBAL_RS01205"
                     /old_locus_tag="Sbal_0236"
     CDS             273187..273384
                     /locus_tag="SBAL_RS01205"
                     /old_locus_tag="Sbal_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079715.1"
                     /db_xref="GI:492987024"
                     /translation="MSIESQAVESPTDATTTKSKKAKKAAITSGLRLKDKLTQDTRRR
                     IEILHEQRQLSNRFGVDIEID"
     gene            complement(273490..273957)
                     /locus_tag="SBAL_RS01210"
                     /old_locus_tag="Sbal_0237"
     CDS             complement(273490..273957)
                     /locus_tag="SBAL_RS01210"
                     /old_locus_tag="Sbal_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_006079716.1"
                     /db_xref="GI:492987030"
                     /translation="MKVIDLKSAPQHIPQLAQWHHQEWAHLSSADATVTTLIEQMSEY
                     LSDAAIPKMFICEEANQVMGSSSLTAADMDTRTDLSPWLANVYVNAHYRNKGLGKLLV
                     NAVVDYAKALGLQKIYLFTADKADFYQTLGWSKISREDYMGEMVTIMEYEFKK"
     gene            complement(274088..275404)
                     /locus_tag="SBAL_RS01215"
                     /old_locus_tag="Sbal_0238"
     CDS             complement(274088..275404)
                     /locus_tag="SBAL_RS01215"
                     /old_locus_tag="Sbal_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845501.1"
                     /db_xref="GI:500171076"
                     /translation="MYSLKGYLTRNLLITLTFAMVLLLYFLYQGIQILTQDFVASRLQ
                     HDADSLISALNNHPDGTWAITTDRLPNVYHRVNSGHYFAIQIGEQTLCSRSLFDHNVN
                     MPKLTAGEHHQATDFVGKEHWLMFSQAVIKDDQLVTLWVTEDISELEQTQVQFLAFAS
                     AAVLLTIVILLMSQYQLLKRGFKPLEQMPEAIRQMRTQGQEINPDQMPSEIIPLIEEI
                     DRLVNQLGQRVQRSRNALGNLAHEMKRPLQGLQSYLESLPPEQRSEGSKVLANLHHII
                     ERELKRTKIVGMSTPGRYTVLDDDLAPLIQVMQRIYPDRIINSHYASGLVMPFDRDDL
                     LELLGNLLDNACKHSRKNIEIRIVHQTAPTAGYGIIVSDDGEGVSDAALSIIIERGIR
                     LDESIQGHGLGLSICKDIVDSYQGELSFSHAQQGGLEASVFLPIPS"
     gene            complement(275410..276069)
                     /locus_tag="SBAL_RS01220"
                     /old_locus_tag="Sbal_0239"
     CDS             complement(275410..276069)
                     /locus_tag="SBAL_RS01220"
                     /old_locus_tag="Sbal_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_006079718.1"
                     /db_xref="GI:492987037"
                     /translation="MRLLLIEDDTDLVARLIPALNKAGYTVEHADNGIDGAFLGEEEN
                     FEAVILDLGLPGKPGLQVLGQWRQKGLAMPVLILTARDAWHERVDGLKAGADDYLGKP
                     FHIEELLARLEVLIRRHFGRADNVLQHAGVSLDVDKQAVTNVDGEVIELTKIEYRLLH
                     YLMVNPSKIVSKSELSERIYEEDQIKDSNVIEVYVNRLRQRLGKDYIETRRGQGYRLK
                     E"
     gene            complement(276069..276335)
                     /locus_tag="SBAL_RS01225"
                     /old_locus_tag="Sbal_0240"
     CDS             complement(276069..276335)
                     /locus_tag="SBAL_RS01225"
                     /old_locus_tag="Sbal_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M4"
                     /protein_id="WP_011845502.1"
                     /db_xref="GI:500171077"
                     /translation="MISSPSCDAHDDDLSNKVVEWVKEGKVLPFDTIMQRYESRLKGR
                     LLDLEVEQKHGRIIYELEILRDDGIVYEIKIDAKTGEWLKEKVD"
     gene            complement(276328..276891)
                     /locus_tag="SBAL_RS01230"
                     /old_locus_tag="Sbal_0241"
     CDS             complement(276328..276891)
                     /locus_tag="SBAL_RS01230"
                     /old_locus_tag="Sbal_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_011845503.1"
                     /db_xref="GI:500171078"
                     /translation="MTKQAHPISWFLGSSLTAAALAIGVIGVSLTLTGTGYADDGRGL
                     SRAIPQNAEYTAECGSCHMAYPANLLPADKWRAITANLENHFGDNASLDPQVTARIEE
                     YLVQHAAQNGKVMKNSTPLLAGAGPQKITEQAFFIRKHDEIPRRMVQDNPKVGSFSQC
                     SNCHNLAEKGIFDEDTVNIPGFGRWDD"
     gene            complement(276981..277427)
                     /locus_tag="SBAL_RS01235"
                     /old_locus_tag="Sbal_0242"
     CDS             complement(276981..277427)
                     /locus_tag="SBAL_RS01235"
                     /old_locus_tag="Sbal_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C nitrate reductase"
                     /protein_id="WP_011845504.1"
                     /db_xref="GI:500171079"
                     /translation="MNRLTRHTNKSRLAIVAISTLLLTSLSVSAANSKVQSLPLSAER
                     IGTQLQSYQAQGAGPFTAAAGQKLWLQDMDGRSCASCHTAKVTDMGMHQNTRKSIDPM
                     APSITADRLTDSAKIEKWFTRNCNWTFKRDCTPQEKGDALLWLSLQ"
     gene            complement(277481..278068)
                     /locus_tag="SBAL_RS01240"
                     /old_locus_tag="Sbal_0243"
     CDS             complement(277481..278068)
                     /locus_tag="SBAL_RS01240"
                     /old_locus_tag="Sbal_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_011845505.1"
                     /db_xref="GI:500171080"
                     /translation="MSSNTLQTIKVWDLLIRIFHWSLVGFFTLAYLTEGEDEWMTIHS
                     YAGYSILILLVFRLLWGVIGTHNARFSNFITRPKEVLVYLKGLITGKAKDYIGHNPAG
                     AMMIVALIASIAITGFSGMALYATDGHGPLATSFFATWPEGAIKEVHEFFANFTVFLV
                     VIHVGGVIVSSLLHKENLVRAMVTGKKQRPVEQED"
     gene            278289..278744
                     /locus_tag="SBAL_RS01245"
                     /old_locus_tag="Sbal_0244"
     CDS             278289..278744
                     /locus_tag="SBAL_RS01245"
                     /old_locus_tag="Sbal_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845506.1"
                     /db_xref="GI:500171081"
                     /translation="MSTAVIRAFISRNPSRKSFFIYAVLLFLTEVLIALYAPAGFIRG
                     FVGDVLVVILLFCMVRAVVSPVEKAAAKNTGDGIKRLFQTPWLAFAVLLFAFAIEFGQ
                     YWGLVDKLGLGGNRLARIVIGSHFDPLDLVAYFVGYLILLGCYWKSRQP"
     gene            278812..279324
                     /locus_tag="SBAL_RS01250"
                     /old_locus_tag="Sbal_0245"
     CDS             278812..279324
                     /locus_tag="SBAL_RS01250"
                     /old_locus_tag="Sbal_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845507.1"
                     /db_xref="GI:500171082"
                     /translation="MQPITAFSLLTARTDGLELNPLKMPLYFNGQHTHTFIAGLVIEG
                     QYRCVLPNKTSGYLVITSFDCPFEESTEFSLLDEAFKLIATTSLAQMYDSFLLHSHWP
                     IADNRLRLHYYGQFVLDLVISAGSSWLTARPKLKLIEVVNPQSDPQTAAAMAELAQRL
                     AAIEKSLMWD"
     gene            complement(279310..280233)
                     /locus_tag="SBAL_RS01255"
                     /old_locus_tag="Sbal_0246"
     CDS             complement(279310..280233)
                     /locus_tag="SBAL_RS01255"
                     /old_locus_tag="Sbal_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845508.1"
                     /db_xref="GI:500171083"
                     /translation="MQDRLQAMQIFMRVAELQSFTQASASLGLSKTHVSNVVAQFETF
                     LGARLLQRTTRTVRLTQDGQSCYERCKSLLAEFQELESLFQLQAEQVSGRLRVDMSTG
                     IARNLVLPKLAEFIEQYPHIELELSSTDRKVDVIAEGFDCVIRVGSVQQEGLIAKKMG
                     HFKMLNCVSPAYIAKYGKPESLEDLTLHNHKLVHYVSQLGGTDSGFEYQDPHTHQANL
                     TIQLPKLITVNNADAYSSACLAGLGIIQVPSIGVAKYLHTGELVEILQNYPAPPMPVS
                     LLYPHRRHLSKRLQVFMAWLNQQMTPFLVPH"
     gene            280372..281133
                     /locus_tag="SBAL_RS01260"
                     /old_locus_tag="Sbal_0247"
     CDS             280372..281133
                     /locus_tag="SBAL_RS01260"
                     /old_locus_tag="Sbal_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_011845509.1"
                     /db_xref="GI:500171084"
                     /translation="MNTTPIALITGASRGLGKNTAQKLAAQGIDIILTYQTNAAAAAE
                     VVAEIEWLGRKAVALPLDVSDSGSFAEFAIQVSTVLAQTWQRESFNYLINNAGIGIHV
                     PMAETSIEQFDTLMNIHVKGPFFLTQTLLPQLMDGGSIVNISTGLTRFAIPGFGAYAT
                     MKGAVETMTKYWAKELGSRGIRVNVLAPGAIETDFGGGAVRDNEQMNQFLAQQTALGR
                     VGLPDDIGGAISALLSPAAAWINAQRIEASGGMFL"
     gene            complement(281372..282892)
                     /locus_tag="SBAL_RS01265"
                     /old_locus_tag="Sbal_0248"
     CDS             complement(281372..282892)
                     /locus_tag="SBAL_RS01265"
                     /old_locus_tag="Sbal_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074108.1"
                     /note="catalyzes the oxidation of acetaldehyde,
                     benzaldehyde, propionaldehyde and other aldehydes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_006079725.1"
                     /db_xref="GI:492987064"
                     /translation="MIYAQPGTAGAIVNFKEKYANFIGGKWVAPVNGKYFDNRSPVNG
                     QNFCQIPRSDAQDIELALDAAHAAKEAWGKTSVTERSNLLLRIADRVEQNLEYLAVAE
                     TWENGKAVRETLNADLPLFVDHFRYFAGCIRAQEGSAADIDGNTVSYHFPEPLGVVGQ
                     IIPWNFPLLMAAWKIAPALAAGNCVVLKPAEQTPVSILVLLELIEDLLPAGILNVVNG
                     FGAEAGQALATSKRIAKLAFTGSTEIGYHILKCAAESLIPSTVELGGKSPNVFFADVM
                     DHEDEYLNKAVEGMLLAFFNQGEVCTCPSRVLVQESIFDRFIEKVLARAQTIKQGDPL
                     DTDTQVGAQASKEQFDKILSYLAIGKAEGAEVLLGGTLCQLDGGQSEGYYISPTIMKG
                     HNKMRIFQEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNTAQRMGRGIQ
                     AGRVWINCYHAYPAHAAFGGYKKSGIGRETHKMMLNHYQNTKNLLVSYDVNPLGFF"
     gene            283274..285232
                     /locus_tag="SBAL_RS01270"
                     /old_locus_tag="Sbal_0249"
     CDS             283274..285232
                     /locus_tag="SBAL_RS01270"
                     /old_locus_tag="Sbal_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_011845510.1"
                     /db_xref="GI:500171085"
                     /translation="MAVKPHLPSTQAWLADSWQRSIGAGLSEFQLPQELRLDASELKQ
                     KHEQYQMLIALVQSHALPLFNQLMAHSNSRLLLSDAEGYVLRHWGVSRYSTKLADVAL
                     DIGVNWLEQHKGTNAIGTALTAKQAVSVVGEQHFIRQNRFMSCTACPIFSPQGEMLGV
                     INITSEQQRHTQQTLMLVSSLAQQVETALLCHLPDSRYRIDLAAQPNLLNSGWQGIVI
                     ADSDGRIVGCNPMAKQLLSHAKVGDSVEQYLGDNWSRAGGFNQHLDLHLQTQPLNIPS
                     IKSRVATSNKSLNQLGVRFRDPQLERAWQHANKVITKQIPLLVLGETGVGKEQFVKKL
                     HAQSARRTEHLVAVNCAALPAELVESELFGYQAGAFTGANRTGFIGKIRQAHGGFLFL
                     DEIGEMPLAAQSRLLRVLQEREVVPVGSNQSFKVDIQIIAATHMDLEQQVAQGLFRQD
                     LFYRLNGLQVRLPALRERQDIERIIHKLHRKHRIAPQEICPELLGLLMQHDWPGNLRE
                     LDNLMQVACLMAEGDDTLTWQHLPDYLAQKLACEPLKVDPLNAQLLNTQLLNEEQPLG
                     EEVKTGQNSASHPLAGKVVSGKVTSGNIAVQPTANAVQSDSLHEAIYSNVLQAYQACG
                     GNVSQCAKRLGISRNALYRRLKQMGLKG"
     gene            285583..286563
                     /locus_tag="SBAL_RS01275"
                     /old_locus_tag="Sbal_0250"
     CDS             285583..286563
                     /locus_tag="SBAL_RS01275"
                     /old_locus_tag="Sbal_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_011845511.1"
                     /db_xref="GI:500171086"
                     /translation="MFDALLLTQEDKRTFAQVSQITEADLPEGEVLVEVAYSSLNYKD
                     GLAVTGAGKIIRQFPMVPGIDFAGVVCESTDARYQVGDQVILTGWGVGENHWGGMAQK
                     ARVKADWLVPMPQGCDAAKAMMIGTAGLTAMLCVQALQQAGITPQSGDILVTGASGGV
                     GSVAVTLLANAGYRVVACSGRVEQNAPLLRELGAAEVIDRSELEQDAKPLEAQRWAGV
                     VDTVGNKILAKALAQMQYGGAAAICGLAGGFALPTTVMPFILRGVSLLGIDSVSCPFE
                     KRKAAWEAVIKALPAHFYQQACQQISLAEVPDFANQIIQGQVTGRVLVKL"
     gene            286883..287368
                     /locus_tag="SBAL_RS01280"
                     /old_locus_tag="Sbal_0251"
     CDS             286883..287368
                     /locus_tag="SBAL_RS01280"
                     /old_locus_tag="Sbal_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavocytochrome c"
                     /protein_id="WP_011845512.1"
                     /db_xref="GI:500171087"
                     /translation="MSNANLLGRRNFIKGLGAATGVAMVSPVMAVSERADGIKWDKEI
                     EILIVGSGFAGLAAAIEATRKGAKDIHIFEQMSYFGGNSAINGGLFAAPGTPMQKKEG
                     VEDSVEKMVADQIASGRGIADESLLRHVASHAVFFKIVVTLCLKIKLHLLRLLLVPYL
                     G"
     gene            complement(287322..288371)
                     /locus_tag="SBAL_RS01285"
                     /old_locus_tag="Sbal_0252"
     CDS             complement(287322..288371)
                     /locus_tag="SBAL_RS01285"
                     /old_locus_tag="Sbal_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011789366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011840006.1"
                     /db_xref="GI:500165390"
                     /translation="MPERIALIALIQEAYTQGARLYKACAETGLSKRTYRRWYREGQV
                     QADLRPTAARPEPANKLEEHERQQILSVCNQAEYASLPPSQIVPTLLDNGIYIASESS
                     FYRVLNAHGQLNHRGRTQATVNRSKPLSYRADGPNQVWSWDITYLASTVKGQFYYLYL
                     FEDIYSRKIVGYEVHEQENGEYAAALIQRSLLREQCFNTPLVLHSDNGAPMKSLTMKA
                     KLEELGITASLSRPRVSNDNPFSESLFKTLKYRPQWPASGFSCLATAREWVEKFVSWY
                     NDEHKHSQLNFVSPGQRHALQDGAILAKRKKVLEAAKERKPMRWSTEIRNCEAVGAVT
                     LNPDKAPVEGVINAA"
     gene            complement(288377..288877)
                     /locus_tag="SBAL_RS01290"
                     /old_locus_tag="Sbal_0253"
     CDS             complement(288377..288877)
                     /locus_tag="SBAL_RS01290"
                     /old_locus_tag="Sbal_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011840005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011840005.1"
                     /db_xref="GI:500165389"
                     /translation="MARYSPERKEAILKKLLPPHNLTVAEVAREEGIAVQTLYHWRDI
                     ARKEGRPVPGKTLTADDWSAEAKFAVLIETAPLSEAEISQYCREKGLYREQVQQWKLE
                     CLSGFQTSEVQTKTIKQQAKADKAEIKSLQRELRYKEKALAEAAALLVLRKKLNVLWG
                     DDSEES"
     gene            <288953..290077
                     /locus_tag="SBAL_RS01295"
                     /old_locus_tag="Sbal_0254"
     CDS             <288953..290077
                     /locus_tag="SBAL_RS01295"
                     /old_locus_tag="Sbal_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845513.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041409045.1"
                     /db_xref="GI:752761927"
                     /translation="HAVEALQMTLDAGSEYHPYLQQLGGHSVARTYQTSVSCGAGITQ
                     PLLKECYRIGVQTHNRSKFEGFLLGEKGNVVGVKMRENYHFGEDQPGKVLNIRAKRGV
                     IMATGGFAQNIDLRMAQDPTLTSEVGCTNIPGATGEGMLEMFRLGAVPVHLAHIQSGP
                     WASPDEGGFGYVSNYSIYNFPHSIAVNCLTGKRFMNEIADRKTRADAELACRDAKGEP
                     LPPILITSYKDSKQHPNTAKVIKYNVGWKFDTLETLAKHFDVPLKALEAQIKEYNGYV
                     KTGDDKQFGKNMSKAKDKYLEAPFTVVRLWPKVHYCQGGVQVTTKAEVKDSLTGMPIL
                     GLYAAGEVCGGIHGVSRLGSCSIPECMVMGMTAARSIMNA"
     gene            290106..290459
                     /locus_tag="SBAL_RS01300"
                     /old_locus_tag="Sbal_0255"
     CDS             290106..290459
                     /locus_tag="SBAL_RS01300"
                     /old_locus_tag="Sbal_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014620558.1"
                     /db_xref="GI:504433456"
                     /translation="MNKLNIVFALVLGCLPMLSAQAVELRDYHKAVIGNDCKACHDNG
                     IKQFPSDQACLKCHNIEDLALKTARNDEDKWQNPHNNLHYGKELPCQECHGEHKAKQP
                     LCSDCHTFKYDKHKE"
     gene            290835..292079
                     /locus_tag="SBAL_RS01305"
                     /old_locus_tag="Sbal_0256"
     CDS             290835..292079
                     /locus_tag="SBAL_RS01305"
                     /old_locus_tag="Sbal_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011920089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845515.1"
                     /db_xref="GI:500171090"
                     /translation="MKKTIVALSLLSANGAMAADLPNFLDQSDIDNAQFKCLGEPIKY
                     SKADQKYVDTLWDETLSYLKAYAIALTNGENSHCLNSDEAMIDSTLGGQKMCIMDRRD
                     MKLMVKNIYQVINNADKAKQCFGAREEVNWIYNPGGELTQNSPVAQHFKRTTFGEFFK
                     TKVTNKEVKKLGKIFTENFYKMVTGGEVKMPSAFPYDISANALPNLWAAAGWFPMYAE
                     ESKRNDKNFDNIRGGYAYAEIFGHWGLLRIDEINGEKVGAEVGMTVQSVNTLYPYHNH
                     AISEIYYNMRVPACTNQFKSFAVRADSPLVKTVKQDTTMRRVQFDAAKHNGHTMWLAG
                     SYDQDPLMYFHQNTIHAFDIDGSCEAKPEERAIVSVWARSNAHDKRNDYGTTLLCESA
                     QNPGTPANKDEVIQCDLTHLKW"
     gene            292166..293296
                     /locus_tag="SBAL_RS01310"
                     /old_locus_tag="Sbal_0257"
     CDS             292166..293296
                     /locus_tag="SBAL_RS01310"
                     /old_locus_tag="Sbal_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041409047.1"
                     /db_xref="GI:752761929"
                     /translation="MMKKLNLSFVAALISMALAAGMVQAQEQQDGINVAGTVRVNYAY
                     KDYSESSKDKGGDFAFDMAAIKFNGKLGEWGLASEYRFYDGWQALRYGYGFYELNPEW
                     QLQFGVNQVPFGNPGFISNSFWFGVPYYLGFEDDYDLGIKAIYSSGAWGTEMAFYKNA
                     EYGAGRSDRYSTDLYSGLVNGTEYHNEETNQLNLRQTYEISYEGGETRFGGSVEYGQI
                     YNSKTGNNGDRYALAIHMDSNYQGWALQLQVMQYEYDAADAIDNNKIAVAAYNWQYEI
                     ASKAQAYSINLAKNIVTDWGSLKFYNDFGIVTPDVADKGYDTSYQNVTGCAISAGPTY
                     TMIDFIMGKNMYASTRDNGHVGLPEMGDSWDKRVNINFGYYF"
     gene            complement(293385..294251)
                     /locus_tag="SBAL_RS01315"
                     /old_locus_tag="Sbal_0258"
     CDS             complement(293385..294251)
                     /locus_tag="SBAL_RS01315"
                     /old_locus_tag="Sbal_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845517.1"
                     /db_xref="GI:500171092"
                     /translation="MLKIELLESFIAVAECGNMSKAADKVCRTQSTLSLQIKKLEEVV
                     GQSLLLRDNKGTTLTESGSTLLNYAYKMMQLNSQAIHDLKDCQNREIIRLGVPTDYIK
                     FYLNSCLLEFIREFTCIELVIDTDVSGNLFKRLQQGEFDLIVATHWQAPVNGELLFSR
                     RFHWAAAKNGQAHKRSTVPMALYPENCPIRAQVFANHQLSMRPINVLLSTPSPQALCM
                     AVENDLAIAPIAEFRTNEHMQILDPHEHGLPPLPIFNESLYLNPETQTEATMQLITLI
                     KANVEHLSDTID"
     gene            294374..295027
                     /locus_tag="SBAL_RS01320"
                     /old_locus_tag="Sbal_0259"
     CDS             294374..295027
                     /locus_tag="SBAL_RS01320"
                     /old_locus_tag="Sbal_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_011845518.1"
                     /db_xref="GI:500171093"
                     /translation="MSSWEQRSHYLIEVAQRSLIGHKTFDLCRSHLVAASQISKGTIY
                     NHFTTEADLVVAVACAEYEEWLAAAKRDMQRYPDPLTRFLYHHCYRLHQMLSQQRYVI
                     ERVMPNQALLLQATDSYRQRFEKISTEYNHWNRLTISEIGDIPGFNRAELVKDYLRGA
                     MINSDDANRQADDVQLYCQFSYALSQLMGHSDKRIPTKPAFVHWLSHLPSTSAISAV"
     gene            complement(295011..296387)
                     /locus_tag="SBAL_RS01325"
                     /old_locus_tag="Sbal_0260"
     CDS             complement(295011..296387)
                     /locus_tag="SBAL_RS01325"
                     /old_locus_tag="Sbal_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845519.1"
                     /db_xref="GI:500171094"
                     /translation="MASITAVSTVPNRLFIKLLLGFWLCSSLIIALVGLLPLLQQSHD
                     RAPLPPHLEKVLSTIAQRIQENPALLESDFLRRWERHRDMEGKPLRVYLVNSQGQVVN
                     THRVSRGVRSFMLMADEEKQPISHQFKDELVFGPFQFNLGAETYSLYGRLPDNHPRPW
                     FFFFAENKLLTLSLAIFLSGLLCGLLAWHLGKALNSLKKSANALAEGDLSNRVDKSTT
                     QRNDEIGQLATAFNSMADSIEAMVNNQQRLMGDISHELRTPLTRLQLSLALARKKGQQ
                     TAETERIGYEAEQLEKLISELLELSRVKLSTNETKVHLGLAESLSQVLDDAEFEAEQQ
                     GKTITIDIDEEIELAHFPKSLSRAIENLLRNAIRYAASDIHLQASATADQVQITIKDD
                     GPGIDAAELDAIFKPFYRPDSARQRESGGWGLGLAITEAAITAHKGKIKAENRKPTGL
                     EVTITLPK"
     gene            complement(296375..297061)
                     /locus_tag="SBAL_RS01330"
                     /old_locus_tag="Sbal_0261"
     CDS             complement(296375..297061)
                     /locus_tag="SBAL_RS01330"
                     /old_locus_tag="Sbal_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086517.1"
                     /note="response regulator in two-component regulatory
                     system with CpxA; part of the envelope stress response
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011845520.1"
                     /db_xref="GI:500171095"
                     /translation="MSRILLIDDDLGLSELLGQLLELEGFQLTLAYDGKQGLDLALSA
                     DYDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTARGDEIDRVVGLEIGADDYLPKP
                     FNDRELIARIRAIIRRSNLTTQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
                     TLLHTLALHAGELMNKEELNEKVLGKKLMPFDRSLDMHLSNLRKKLPERGDGRPRVKT
                     IRGKGYIWLP"
     gene            297442..297966
                     /locus_tag="SBAL_RS01335"
                     /old_locus_tag="Sbal_0262"
     CDS             297442..297966
                     /locus_tag="SBAL_RS01335"
                     /old_locus_tag="Sbal_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845521.1"
                     /db_xref="GI:500171096"
                     /translation="MKTLSPLKASLFAILASSAVFATTVNAEPMDGGCDFSRSEFHKG
                     DRMMGDRMEHGGRHMDQGGMHRMFEGLDLTDAQKADIKKLFADQKAARADSRPTKEQR
                     LAHRTEMQALMTAPNFDEVQAKALMSAQQEQRQAQAIERMKLHNQIYNLLTLEQQAKF
                     KARFEAQAGKEPRG"
     gene            298018..298908
                     /gene="fieF"
                     /locus_tag="SBAL_RS01340"
                     /old_locus_tag="Sbal_0263"
                     /gene_synonym="yiiP"
     CDS             298018..298908
                     /gene="fieF"
                     /locus_tag="SBAL_RS01340"
                     /old_locus_tag="Sbal_0263"
                     /gene_synonym="yiiP"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086520.1"
                     /note="member of cation diffusion facilitator family; CDF;
                     membrane-bound; induced by both zinc and iron, but does
                     not induce resistance to zinc; can transport zinc(II) in a
                     proton-dependent manner; instead this protein induces iron
                     resistance; forms dimers; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_011845522.1"
                     /db_xref="GI:500171097"
                     /translation="MTQTSQYDFWVKLASRASVATALILILIKMFAWLYSGSASMLAS
                     LTDSFADALASIINFIAIRYALVPPDHDHRYGHGKAEPLASLAQSAFIMGSAFLLLFY
                     GGERLLTPVPVENATIGVVVSVIAIIMTLALVTLQKRALAATKSTVVEADSLHYKSDL
                     FLNGAVLLALVLSQYGWWWADGLFAVMIAFYIGHQAFGLGYRSIQALLDRELDEETRQ
                     QITQIAMEDPRVQGLHDLRTRQAGKTVFIQFHLELDGNLSLNEAHSIADTTGIKVKAA
                     FEDAEVIIHQDPVKSEVNET"
     gene            299583..300141
                     /locus_tag="SBAL_RS01345"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(300279..301691)
                     /gene="glnG"
                     /locus_tag="SBAL_RS01350"
                     /old_locus_tag="Sbal_0266"
     CDS             complement(300279..301691)
                     /gene="glnG"
                     /locus_tag="SBAL_RS01350"
                     /old_locus_tag="Sbal_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079736.1"
                     /note="response regulator of a two-component regulatory
                     system involved in the activation of nitrogen assimilation
                     genes; interacts with sigma-54; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="WP_006079736.1"
                     /db_xref="GI:492987127"
                     /translation="MRISEQVWILDDDSSIRWVLEKALQGAKLSTASFAAAESLWQAL
                     EISQPHVIVSDIRMPGTDGLSLLERLQVHYPHIPVIIMTAHSDLDSAVSAYQAGAFEY
                     LPKPFDIDEAISLVERALTHATEQSPAPAQEAQVKTPEIIGEAPAMQEVFRAIGRLSR
                     SSISVLINGQSGTGKELVAGALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAF
                     TGAANVRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHNAVQVDVR
                     IIAATHQDLELLVQKGGFREDLFHRLNVIRVHLPPLSQRREDIPQLATHFLASAAKEI
                     GVETKIMTKETAVKLSQLPWPGNVRQLENTCRWLTVMASGQEILPQDLPPELLKDPVS
                     VTHTAKGSQDWQSALTEWIDQKLSEGNSDLLTEVQPAFERILLETALRHTQGHKQEAA
                     KRLGWGRNTLTRKLKELSMD"
     gene            complement(301730..302776)
                     /gene="glnL"
                     /locus_tag="SBAL_RS01355"
                     /old_locus_tag="Sbal_0267"
     CDS             complement(301730..302776)
                     /gene="glnL"
                     /locus_tag="SBAL_RS01355"
                     /old_locus_tag="Sbal_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586497.1"
                     /note="sensory histidine kinase in two-component
                     regulatory system with GlnG; acts as a signal transducer
                     which responds to the nitrogen level of cell and modulates
                     the activity of ntrC by phosphorylation/dephosphorylation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="WP_011845524.1"
                     /db_xref="GI:500171099"
                     /translation="MDKETLLNHLVTAVLVIDKDLKPCYANAAAEQLLGVGSHRLVEQ
                     ALPEHYQILGVEAQLLRDAVAAGQGLTVNTAALVTLDGQHHTVDLTLIPLDDEAELSL
                     LELRQVDQQRRIHQQLSQDAQQQAAQFLVRNLAHEIKNPLGGLRGAAQLLSRELDDPA
                     LKEFTTLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHQVVQKVYKLVEMALPANIQLK
                     RDYDPSIPDIEMDPDQMQQAVLNILQNAVQALEHTGGEILLRTRTQHQVTIGSQRHKL
                     VLTLSIIDNGPGIPPELMDTLFYPMVTGREQGSGLGLSIAHNIARLHSGRIDCLSSAG
                     HTEFIISLPILGAK"
     gene            complement(302930..303436)
                     /locus_tag="SBAL_RS01360"
                     /old_locus_tag="Sbal_0268"
     CDS             complement(302930..303436)
                     /locus_tag="SBAL_RS01360"
                     /old_locus_tag="Sbal_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845525.1"
                     /db_xref="GI:500171100"
                     /translation="MRSLTLIGLVLFSMLAQATVYKWVDKDGKVHYSDEPQPNAQVVE
                     LKEKTLNQIALPLPKTDSNNANQAIESIQYQVNITSPAEEETVRDNNGDFDVVATITP
                     ELKSQYLMALKLDGNPVGQPQIGGTFKLKNIDRGEHTLVVDALTQNGKVFASSSPRKI
                     FLHQAAKR"
     gene            complement(303630..304256)
                     /locus_tag="SBAL_RS01365"
                     /old_locus_tag="Sbal_0269"
     CDS             complement(303630..304256)
                     /locus_tag="SBAL_RS01365"
                     /old_locus_tag="Sbal_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_011845526.1"
                     /db_xref="GI:500171101"
                     /translation="MITLHHLNKSRSKRIIWLLEELGQPYQIKSYQRDSQTFLAPPEL
                     KQIHPLGKSPVIEMDGQVIAESGAITEYLIEKYAADTLAPARDSADYVDYLQWLHFAE
                     SSAMLPLLLRMFVQKDGCKTNFLEGYAAIEVSKISHYFNDMLAGKTYLVTDKLTGADI
                     MMSFVVELLANSGDLEKFEHIQRYATQLSQHAAWVKASEIEKQLDASV"
     gene            complement(304392..305084)
                     /locus_tag="SBAL_RS01370"
                     /old_locus_tag="Sbal_0270"
     CDS             complement(304392..305084)
                     /locus_tag="SBAL_RS01370"
                     /old_locus_tag="Sbal_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylallyltransferase"
                     /protein_id="WP_011982143.1"
                     /db_xref="GI:500728573"
                     /translation="MKMNILMVLTSHDKLGDTGLKTGFWLEEFASPFYEFKDKGFDIT
                     LASPLGGQPPLDPKSDEPDFQTEATARFSKDPEAQALLANTTRLSEINAADYDAVFYP
                     GGHGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAALLHPKASDGKPLVSGKRVTG
                     FSNSEEEAVQLTHIVPFLVEDMLQKNGGTYVKGDDWTSFVVADGHLITGQNPGSSEAV
                     AQAIVAQLNARG"
     gene            complement(305162..306319)
                     /locus_tag="SBAL_RS01375"
                     /old_locus_tag="Sbal_0271"
     CDS             complement(305162..306319)
                     /locus_tag="SBAL_RS01375"
                     /old_locus_tag="Sbal_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_011845528.1"
                     /db_xref="GI:500171103"
                     /translation="MLNFNYYNPTRIRFGKDTIAEIDTLVPSDAKVMILFGGSSARKT
                     GTLDEVKQSLGNRFIVEFDGIEPNPTYETLMKAVAQVREQKIDFLLAVGGGSVIDGTK
                     FVAAAAVFEGEPWDILTSWGAKVTQAMPFGSVLTLPATGSEMNNASVVTRKSLQAKLP
                     FRNDLVYPQFSILDPTKTFTLPERQVANGVVDAFVHITEQYLTYPVNAAVQDRFAEGL
                     LQTLIELGPQVLVQPEDYDIRANLMWVATMALNGTIGVGVPHDWATHMIGHELTALYD
                     IDHARTLAIVLPALLQCTKEAKREKLLQYADRVWHINTGTDDERIDAAIAKTKAFFEA
                     MGIPTHLSAYDLDASHVDTVVKQLELHGMVALGEHGNINPAMSRDILTLAL"
     gene            complement(306503..307099)
                     /locus_tag="SBAL_RS01380"
                     /old_locus_tag="Sbal_0272"
     CDS             complement(306503..307099)
                     /locus_tag="SBAL_RS01380"
                     /old_locus_tag="Sbal_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_006086531.1"
                     /db_xref="GI:493005350"
                     /translation="MKIETQSTRQHILDIGYKLIVRKGFSSVGLSLLLQAAEVPKGSF
                     YHYFKSKEQFGEALITDYFEKYQLDLDALFNDSTLTGYQRLMQYWQQWLHVQADGCVD
                     QKCLVVKLSAEVADLSEAMRVALLKGSAGIIDRLTTCVQVGINDSSIAEQDPQSTAEM
                     LYHMWLGASLMNKLGHSPAALERALVTTKAILTPKTAL"
     gene            complement(307387..307698)
                     /locus_tag="SBAL_RS01385"
                     /old_locus_tag="Sbal_0273"
     CDS             complement(307387..307698)
                     /locus_tag="SBAL_RS01385"
                     /old_locus_tag="Sbal_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8E465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845529.1"
                     /db_xref="GI:500171104"
                     /translation="MSLLEQVSVSKKANIYFDGRVASRSVFFADGSKQTLGVVQPGEY
                     EFSTSQGEIMEVISGRFEVLLPETTTWQEFSEGTQFELAANVSFKIRNTAIAEYCCSY
                     L"
     gene            308057..310012
                     /locus_tag="SBAL_RS01390"
                     /old_locus_tag="Sbal_0274"
     CDS             308057..310012
                     /locus_tag="SBAL_RS01390"
                     /old_locus_tag="Sbal_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011845530.1"
                     /db_xref="GI:500171105"
                     /translation="MGFTRKIQLISLLIVLLPLIFATAIVTYIARDELFAEAQSRLVA
                     VREIKQRQIVGMFQDFSDNLQAVSAVIASQKSLDTISDLDETLKLLNKSLGFYDLFII
                     RDDGTVFYTAAKESDFGTNLRTGPYHDSGLAQLFNKALGSTGTVLLQDFSAYAPSNGQ
                     PAAFIGQSIQFNQQRLVVAAQVSIDRINRVMQIREGMGQSGETYLIGPNNRMRSDSFL
                     DPNNRTVTASFAGTVAQNGVDTLAVKEALAGKTGVMQVNDYNHNPVLSAYSPVVELGL
                     RWGLMAEIDVSEIAAPAYRMLFIGLFVCVAALVLAFAAAKLVTGFVLKPLGGEPEDMC
                     NLTSMIASGDLTHNLPHVQTDNHLMSWLARMQTKLKEIISQLVGVGHELESAAEQNSA
                     AMTQADCSIQMQAKETDMLATAVEEMSYAAAEISTNTLKSSDEVSACTHSSEILSQNL
                     ASTRKSLKVTLSSFATIHQQVGSLEADSQKIGSVLAVINAIAEQTNLLSLNAAIEAAR
                     AGEHGRGFAVVADEVRQLAVKVQLATQDIGQVLKGIQQQSGVLALHSVTCTTEASKTA
                     EDADGMQAAVDDIALRLETLKALMIQTATAAEEQTTVSATIAQGIAGLSVAAEENSAA
                     ISQVAASTRSLLGLANQLGLTTAQFKV"
     gene            complement(310152..312266)
                     /locus_tag="SBAL_RS01395"
                     /old_locus_tag="Sbal_0275"
     CDS             complement(310152..312266)
                     /locus_tag="SBAL_RS01395"
                     /old_locus_tag="Sbal_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011845531.1"
                     /db_xref="GI:500171106"
                     /translation="MDKPITQPPQTLKLIGETEAGKRLELKQYFNQTWALYESLFDLI
                     QEDSAYYLKAEPLRHPLIFYFGHTATFYINKLKLGKFLDERVNDNFESMFAIGVDEMS
                     WDDLNEQHYPWPNVPEVRSYRQQVNAVVNRVIDEMPLALPITQNSPAWIILMGIEHER
                     IHLETSSVIIRQLPLEHVAPNSLWAACQDFTAAEANSLLAVKGQKVTLGKTEQDQTYG
                     WDNEYGHKIFNVVDFKASKFLVSNQEYLAFVEAGGYRSPQFWNEEGQAWLAYTQAQMP
                     RFWRLKQDKWWQRNLAEEIPLPLNWPVEVNQLEAKAFCNWKTEQNQSNIRLLTEAEWY
                     ILRENVPADAPDWHEVPGNITLAYYASSCPVNRFEHNGFFDIVGNVWQWTETAIDGFN
                     GFAVHPLYDDFSTPTFDGKHNLIKGGSWISTGNEAIASSRYAFRRHFYQHAGFRYVES
                     TQNPAQMAEVNVYETDELISQYLEFHYGAEYFGVANFCVNGVQQALSEIQLTHTAKAL
                     DIGCSVGRASFELAKVFDHVDGIDFSARFIQQAYALTEQGEKRYTIRTEGDLQEFKSA
                     SLAKLGYELEAKKVNFMQGDACNLKPLYTGYDLVYASNLIDRLNDPKHFLTSIAQRIN
                     QGGYLVIASPYTWLEDYTPKDKWLGGVKVKGENFTTLDGLTETLIGQFELVAVKEIPF
                     VIRETKRKFQHSVSEMTIWRKR"
     gene            312629..313024
                     /locus_tag="SBAL_RS01400"
                     /old_locus_tag="Sbal_0276"
     CDS             312629..313024
                     /locus_tag="SBAL_RS01400"
                     /old_locus_tag="Sbal_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845532.1"
                     /db_xref="GI:500171107"
                     /translation="MTINALWIPAWYELDQSIVVGVTEEFVFHKTVANEALTFYSGAK
                     GSDAAKATGTISAIKHNVLGDIESVDAQGLDYTLVLQDGRRLLVNAEENPGLIYEWVD
                     DSWQPSDMVITDWTLAVQFASLSPLTPIK"
     gene            complement(313065..313247)
                     /locus_tag="SBAL_RS01405"
                     /old_locus_tag="Sbal_0277"
     CDS             complement(313065..313247)
                     /locus_tag="SBAL_RS01405"
                     /old_locus_tag="Sbal_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079747.1"
                     /db_xref="GI:492987182"
                     /translation="MLMERWDTAEEKAEQLRRYQLCLDEFNELDFHDVYVAEIKKEYQ
                     QLAELVKVQSTSDPER"
     gene            313607..314458
                     /locus_tag="SBAL_RS01410"
                     /old_locus_tag="Sbal_0278"
     CDS             313607..314458
                     /locus_tag="SBAL_RS01410"
                     /old_locus_tag="Sbal_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_011845534.1"
                     /db_xref="GI:500171109"
                     /translation="MANILLVANLNCDRILLLDKPLKTGGRFHYQDGGQRLGGGGANT
                     GLGLVWAGHSVALVSQVGRDDMGDWLIAEASTQGLDCRLVQRRAGNTCEMLLVMTPDG
                     ERTIIRPQRPIFELSVPPKWQPWDALYFNTSAEGSVSWAKTALEHCLVVAQLAKDDRQ
                     RPCHILLASMSDIQGRCDGASWEYGKSIGGEGLRYFIVTDGINGAKVYTHDQVQDVAA
                     IPATVVDTTGAGDAYAAGLIHSLCTGQSITEAMAEGAVWAAFAVATDSSIPGEALKQY
                     LEAKQIA"
     gene            314776..316236
                     /locus_tag="SBAL_RS01415"
                     /old_locus_tag="Sbal_0279"
     CDS             314776..316236
                     /locus_tag="SBAL_RS01415"
                     /old_locus_tag="Sbal_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_006079749.1"
                     /db_xref="GI:492987192"
                     /translation="MGNNAWNDKNKFIWLLSVLLLVAFLVTSGISYKVAHDSLSQQIE
                     SNTLPLTSDNIYSEIQQDLLRPIFISSLMAQDTFVRDWTLSHEQEPEKLIRYLKEIQE
                     KYDTVTSFFVSEKSRHYYHSTGILKQIQDVEPDDAWYFRVRSLPESEHYEVNIDADTA
                     DRSKTTVFVNYKVFDFEGKFIGVTGVGLAVEKVKSLIELYQKRYNRRVFFTDRQGNVT
                     LHGDEYDGADSLQTSPGLENLATRILTSPSAAFSYQRNGKTVYLNSRLVPEFKWYLIV
                     EQEDAPQERELLNTFWGNLGLSLMVTLGILFISNMTLGRYQRKLEVMASTDKLTGAAN
                     RQVFDEYFRQALDKAKLAQSPISILLLDIDHFKKVNDSYGHGIGDLVLKTMTNMLRGA
                     LQQQDILCRWGGEEFLILLPGMDLTRAAELAEQIRELIFQREIKVNGLHISITASIGV
                     AEHQAQEPAEDLIKRADLALYQAKEAGRNQVVLNHS"
     gene            316372..317061
                     /locus_tag="SBAL_RS01420"
                     /old_locus_tag="Sbal_0280"
     CDS             316372..317061
                     /locus_tag="SBAL_RS01420"
                     /old_locus_tag="Sbal_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor sulfurase"
                     /protein_id="WP_011845535.1"
                     /db_xref="GI:500171110"
                     /translation="MSKLLINKLSGLYLGTYLQEMAGVATGIDGKQAAQQLLVHVSHV
                     EGDAQADPKHHGGLDRVLHHFPREHYGQYRRWDLITQLEDAPSMGENISTVGLNETQV
                     NIGDILQIGAVTVQVTQPRSPCFKLNLQFGHKEFALAMQQSQLCGWFYRVLTPGIIQL
                     NDKIELIERRTDISVAEAMALYFSPTFNASGYDRLACCEGLAQSWVNSLQRRLASQTV
                     EDWQMRLYQSY"
     gene            317371..317727
                     /locus_tag="SBAL_RS01425"
                     /old_locus_tag="Sbal_0281"
     CDS             317371..317727
                     /locus_tag="SBAL_RS01425"
                     /old_locus_tag="Sbal_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079751.1"
                     /db_xref="GI:492987199"
                     /translation="MIEPVTKSDKDFGLLVYASSFVGYLVPLGSILGPLIIWLMKREE
                     SAFVDQCGRSCLNFKLSLLIYVIISGVLALVGIGFIFLAILGIFDLVCTVLAIIKASE
                     GKVYKYPLTIKFIAMD"
     gene            complement(317803..319719)
                     /locus_tag="SBAL_RS01430"
                     /old_locus_tag="Sbal_0282"
     CDS             complement(317803..319719)
                     /locus_tag="SBAL_RS01430"
                     /old_locus_tag="Sbal_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_006086544.1"
                     /db_xref="GI:493005374"
                     /translation="MIFNNLTIKQKILLTVTFAVLLSTILVGVLSQRSAKNVVQQRML
                     GSELPSLMMQIRNKIDLDISTLMNAAEQLASSRMLLQWLEDGRPQAQETQVVAQLKDI
                     TRQYKLAQASYADRQTAAYYTQDGFLRVLTPAQDGWFFGYRDSGQERMLNVFTEANGE
                     VKLFINYQQPNGRGLVGLAKSLDDMVRLLSSFKIEETGFVYLVDAKGEVKLHPDTSQI
                     GKSNLSNLYKDANSSALLNRGDFNLINTKINGENMLVASSYIASMDWYLVAQVPEAEV
                     FALLTEAAYQILIWTLLIAAGFIVLAIVVAGSVSRPIAQVAAMFRDIGEGEGDLRQRL
                     PVNGEDEIAQLAKGFNSFISKIQDSVIEVAQTSEQLGFSAKDVSNQAQQTLEDSHEQK
                     DRTMMVVTAINEMGATVNEIASNAAQAAVAARDADTEASSGQVVVTRARDTINQLSKD
                     VGQVGEVIESLATHTKSIGGILDVIRAISEQTNLLALNAAIEAARAGEAGRGFAVVAD
                     EVRNLASRTAASTNEVQGMIDKLQSEASRAVNAMAQSRTRSHEGVVAVDEASKSLIGI
                     SDRIGLISDMNIQVAAATEEQSTVVEDINRNVTEINDITQRTANTAQAAAQASLALNQ
                     LSHRLDTLVAKFKV"
     gene            complement(320077..321726)
                     /locus_tag="SBAL_RS01435"
                     /old_locus_tag="Sbal_0283"
     CDS             complement(320077..321726)
                     /locus_tag="SBAL_RS01435"
                     /old_locus_tag="Sbal_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /protein_id="WP_006079753.1"
                     /db_xref="GI:492987205"
                     /translation="MERESMEFDVVIVGAGPAGLATACRLMQISQDSGKEITVCVVEK
                     GSEVGAHILSGAVFEPKVLDELFSDWREKDAPVKTAVTHDEIYLLSSATDGRVMPNAF
                     VPKTMHNDGNFIISVGNLSRWLANRAEELGVEIFPGFAASELLFNVDNSVKGILIGDM
                     GVGADGEPKDSFMPGMELHAKYTVFSEGCRGHLGKQLIEKYHLDNGKTPQHYGLGFKE
                     IWKVPAEQHEQGKVVHTGGWPLTEGASGGGFLYHMEDNQIAVGLIIDLNYKNPHLSPF
                     DEFQRYKTHPVIAKYLTGGERLSYGARAITKGGLNSLPKMSFPGGLIIGCNAGTLNFA
                     KIKGTHTAMKSGIVAAETLGKAMMAGVEGGKDLDCYQTHIEESWLHEELHKSRNFGPA
                     MHKFGTYLGGAFNYIDQNWFGGKFPITLRDEHPDYAQMASVSAYSKIDYPKPDGKLSF
                     DKLSSVYLSSTYHEEDQPCHLRLKDSSIPLGINLTQFNEPAQRYCPAGVYEIVEEAGQ
                     PKFVINAQNCIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
     gene            322095..323075
                     /gene="moaA"
                     /locus_tag="SBAL_RS01440"
                     /old_locus_tag="Sbal_0284"
     CDS             322095..323075
                     /gene="moaA"
                     /locus_tag="SBAL_RS01440"
                     /old_locus_tag="Sbal_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787641.1"
                     /note="together with moaC, is involved in the conversion
                     of a guanosine derivative (GXP) into molybdopterin
                     precursor Z; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="WP_041408291.1"
                     /db_xref="GI:752761173"
                     /translation="MSQLQDSFGRKFHYLRMSVTDVCNFKCSYCLPDGYHPDGKPKFL
                     SLNEIANLVSAFSQVGTQKIRITGGEPTLRKDFTDIIRVVADNPRIHTIATTTNGYRL
                     EKHAKEWFDAGLRRINVSVDSLDPKMFYQITGENKFDEVMRGIDAALSAGFERVKINA
                     VLLKGLNDKDLPRFLHWIKNTPIDLRFIELMETGLGREYFEAHHLAGADIKAQLLADG
                     WQLDTPSADDGPAQNFSRSDYQGRIGLIMPYATNFCASCNRLRVSAKGKLHLCLFTES
                     GVDLRDLLQHSSQQAELIERLHGQLAQKKATHYLHQGITGVTQHLASIGG"
     gene            323172..323648
                     /gene="moaC"
                     /locus_tag="SBAL_RS01445"
                     /old_locus_tag="Sbal_0285"
     CDS             323172..323648
                     /gene="moaC"
                     /locus_tag="SBAL_RS01445"
                     /old_locus_tag="Sbal_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8E942.1"
                     /note="MoaC; along with MoaA is involved in conversion of
                     a guanosine derivative into molybdopterin precursor Z;
                     involved in molybdenum cofactor biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin monophosphate synthase
                     accessory protein"
                     /protein_id="WP_006079755.1"
                     /db_xref="GI:492987237"
                     /translation="MSNVFTHINADGNAHMVDVTEKAVTEREARAEAFIEMASTTLEM
                     IMSGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVDLEAQPEHNRVRITS
                     LCKLSGKTGVEMEALTAASVAALTIYDMCKAVQKDMVISQVRLLEKRGGKSGHFKV"
     gene            323765..324016
                     /gene="moaD"
                     /locus_tag="SBAL_RS01450"
                     /old_locus_tag="Sbal_0286"
     CDS             323765..324016
                     /gene="moaD"
                     /locus_tag="SBAL_RS01450"
                     /old_locus_tag="Sbal_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079756.1"
                     /note="catalyzes the conversion of molybdopterin precursor
                     Z into molybdopterin; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase small subunit"
                     /protein_id="WP_006079756.1"
                     /db_xref="GI:492987240"
                     /translation="MINVLFFAQVRELLGTAKLSLEASEQTQTAEALRATLAATDDKW
                     AKVLTSDKLLVAVNQTISQWDTPVNDGDEVAFFPPVTGG"
     gene            324018..324485
                     /locus_tag="SBAL_RS01455"
                     /old_locus_tag="Sbal_0287"
     CDS             324018..324485
                     /locus_tag="SBAL_RS01455"
                     /old_locus_tag="Sbal_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin guanine dinucleotide biosynthesis
                     protein MoaE"
                     /protein_id="WP_006079757.1"
                     /db_xref="GI:492987246"
                     /translation="MRLLPAVRVQEVDFSVTDEYRQLAQDDSDGAVVTFVGKVRDFND
                     GAAVTDLTLEHYPGMTEAVLEQIVVEARSRWPLNKVTVIHRVGTMALGEQIVFIGVTS
                     AHRKAAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAKLWQHKD"
     gene            324563..325363
                     /locus_tag="SBAL_RS01460"
                     /old_locus_tag="Sbal_0288"
     CDS             324563..325363
                     /locus_tag="SBAL_RS01460"
                     /old_locus_tag="Sbal_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011845538.1"
                     /db_xref="GI:500171113"
                     /translation="MQSLTRFFHALGFALLFCLAVVPSTSRAADNAPIPAIAAAANIK
                     FALDDIVKNFTAETGLKVRVSYGSSGNFVAQIQHGAPFEMLQSADERYIAELNKVGFT
                     QGEGVQYAVGRLALVAPKNSPLALDIELNGLKALLTAGQLERFAIANPDHAPYGERAR
                     ELLKKLGLWDELQTKLILGENASQAAQFAISGSTQGGIIPLSLAIAPQFQALGHYLAL
                     PSDLHGPLNQRMALMPKASSTAERFYQYLQSDAARAVFTQYGFGLPVS"
     gene            325372..326052
                     /locus_tag="SBAL_RS01465"
                     /old_locus_tag="Sbal_0289"
     CDS             325372..326052
                     /locus_tag="SBAL_RS01465"
                     /old_locus_tag="Sbal_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="WP_011845539.1"
                     /db_xref="GI:500171114"
                     /translation="MDWQALWLSVKLSSITVLVLIPLAILAGRALAYRQFVGKSWVEA
                     LIMVPLVLPPTVIGYYLLVGLGSQSWLGQWIEQLTGQQLVFHFSGLVIASVFVNIPFA
                     VQPIQRAFEAVPNDVRDAAACCGMSRLKILLKIELPMVWPGVLTALVLCFSHVLGEFG
                     VVLMMGGNIAGETKTISISIYDSVQAFDFNAAGTMSLVLLLFAVTALALTTSLSRRLG
                     GQRGANHR"
     gene            326033..327136
                     /locus_tag="SBAL_RS01470"
                     /old_locus_tag="Sbal_0290"
     CDS             326033..327136
                     /locus_tag="SBAL_RS01470"
                     /old_locus_tag="Sbal_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011845540.1"
                     /db_xref="GI:500171115"
                     /translation="MAQIIADLQCQIQNHKHIKLNADFRCKAGEVLAVVGPSGGGKTT
                     LLRMIAGLNHPDTGQIYFGERPWFDDKALIALSPQQRHIGYMPQHFGLFPNLTALENV
                     VAGLDHIPKSERIVRAKDWLERVNLQGLPDRLPAHLSGGQRQRVALARALAREPSVLL
                     LDEPFSAVDRETRERLYLELARLKEQLLCPVIMVTHDLNEALLLADSMILISQGKMLQ
                     QGAPFEVLSRPRNEAVARQMGLRNIFDGEVVFQDSTKDLTWLKFGEQLIACDYGKDRA
                     VGSKVRWVIPNQGIRFNSISNGRLCRSFNKLDVTIDAMLVMGESVRLICYVTGTQLQL
                     NTEVSLHFAQKLALTKGMQTTVALKSEQIHILE"
     gene            327806..328327
                     /locus_tag="SBAL_RS01475"
                     /old_locus_tag="Sbal_0292"
     CDS             327806..328327
                     /locus_tag="SBAL_RS01475"
                     /old_locus_tag="Sbal_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845542.1"
                     /db_xref="GI:500171117"
                     /translation="MRLWLLGFMLVSGVATATQSMYSMFAGGDYVPPLSVMQQIEKGF
                     SGVIAEFNMEEQEGELVYQFELINPLANSITRFEYRARDGKLLKQKASKVSADDLGEV
                     EATRLIAAKDQTFSGLIAKATKDHKAFLTEAKLDHDLGISYLELKLLDDTGKFKLAFD
                     VENLRPLPLLKWD"
     gene            328388..329065
                     /locus_tag="SBAL_RS01480"
                     /old_locus_tag="Sbal_0293"
     CDS             328388..329065
                     /locus_tag="SBAL_RS01480"
                     /old_locus_tag="Sbal_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_006079763.1"
                     /db_xref="GI:492987277"
                     /translation="MKILLVEDDATTIDYIVKGFLEQGHNIETASDGHQGLSLATSSQ
                     YDLVILDRMLPQLDGLKLLAALRATGNQTPVLILSALAHVDERVKGLRAGGDDYMTKP
                     FAFSELLVRAEKLMHRGQSVPVTTDLVVGGLKMELLTRNVTLDGQELMLQPKEFQLLK
                     YLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAG
                     YRLRQRH"
     gene            329115..330371
                     /locus_tag="SBAL_RS01485"
                     /old_locus_tag="Sbal_0294"
     CDS             329115..330371
                     /locus_tag="SBAL_RS01485"
                     /old_locus_tag="Sbal_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_006079764.1"
                     /db_xref="GI:492987281"
                     /translation="MTVIIGALLFALYRQLIIEQQYQVTQYLESETQRYQQLALTVDR
                     RSFAAQIRAADPQTALIAWRNSYDMVGALSFMPEGMPMLPQTRDFPILTGGPDKLHIL
                     TGGLVMTRYGPVLIATRTDNLATLIDKFISAAATAVMLTIVLTLALGYLFSKAILRRL
                     VQYNRLSEQIERGHYDTRLPLSWRQDEFDMLALQFNNVLDILENNLMAVRGATDNIAH
                     DLRTPLSHIRIGLEELASKPSDEISEGCAILTEELDHCLATFDAMLSLTRIEEGQQTL
                     DLQELSLAQLCTDLLDMADAVAESNEQTLSLSLLADHKVFGDKYLLFQALYNLVDNAM
                     KYSGQGARIEIIQSGPQIQIRDNGPGIPDDSKERVFERLVRLDPSRHLQGTGLGLSMV
                     KAILSRHNAKINLTDNHPGLVVTIKF"
     gene            330405..331097
                     /locus_tag="SBAL_RS01490"
                     /old_locus_tag="Sbal_0295"
     CDS             330405..331097
                     /locus_tag="SBAL_RS01490"
                     /old_locus_tag="Sbal_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridine synthase"
                     /protein_id="WP_011845543.1"
                     /db_xref="GI:500171118"
                     /translation="MYRIIADEADFIVISKSAKVHFHSQDGTAGVVAQAEQDLGIKLF
                     AVHRLDTPTSGLLILAKSAVAAKQFTELFTAHKVQKYYLALAKGKPKKKQGWVIGDMA
                     KSRRSMFKLLRTKENPAITQFFSLSVSEGLRLYLLKPHSGKTHQLRVALASLGVPILG
                     DDLYGGMAADRCYLHAYCLHFRYGDEATGWRDYAYRDVPTQGEHFAAEGVIEALVEWF
                     EPNTLAWPAKGD"
     gene            complement(331125..332294)
                     /locus_tag="SBAL_RS01495"
                     /old_locus_tag="Sbal_0296"
     CDS             complement(331125..332294)
                     /locus_tag="SBAL_RS01495"
                     /old_locus_tag="Sbal_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photolyase"
                     /protein_id="WP_011845544.1"
                     /db_xref="GI:500171119"
                     /translation="MIFDPQALLLIKFICLLASTAAVAWGLIAKPLQIATQASMRFSL
                     ANLFVLLGIILNSQRSEASSYLFWFCSDMAILFGFILLRWGTKALFRLSPSVKSDLFL
                     LAITASVMLSVPPNFSSERTLAVVFSACAALIFTMLTRDNYQAIKRDTGNRVAIAMVM
                     PLVAMVGIFIIRIFIALLSPEESPMFIAMHTHEAIPVLWFYVFLTLLINIVMIGNAMT
                     RLVSKIRMLAERDQLTGLWNRRAMHKFLNNIHQRWLRDNVPYSMILLDLDHFKEINDQ
                     YGHDAGDLALLTAARLFGSVLRENDALCRHGGEEFLVILPATDAPAARAVAEKLHQVL
                     KDNSFIWQGVTIKIHASLGYATIYQGCQPDKLLIQADQAMYRAKSEGRDRICQAC"
     gene            332558..332725
                     /locus_tag="SBAL_RS01500"
                     /old_locus_tag="Sbal_0297"
     CDS             332558..332725
                     /locus_tag="SBAL_RS01500"
                     /old_locus_tag="Sbal_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006079767.1"
                     /db_xref="GI:492987291"
                     /translation="MDTNKLLLVIIAILLPPVAVFLKAGAGKDLLINIVLCLLFWFPG
                     LLHALWVVTKA"
     gene            complement(332798..334975)
                     /locus_tag="SBAL_RS01505"
                     /old_locus_tag="Sbal_0298"
     CDS             complement(332798..334975)
                     /locus_tag="SBAL_RS01505"
                     /old_locus_tag="Sbal_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011845545.1"
                     /db_xref="GI:500171120"
                     /translation="MTFKTSFVALAVFAALSQSAAAQDAPDSSSNNKNKDIEKITVTA
                     SRMDKSPSSIPNTVTIIDRAQLEEQFRTTKDLSTIIGNLAPSFSPSRQKMSNTGETLR
                     GRPPLIMIDGVPQSNPLRSGGRSGQTIDPAMIERIEIIHGANAMHGLGAQGGIINYIT
                     KKPTGDSEQVASFDVTVPDSMKSNGLSFGASYAFSGESEFIDMIGSVSYRNNGVYYDA
                     NHNVVGVDTTQGESMDSQSTDFFIKLGHNFDESRLELMVNHYTADNNGDWMPVAGDKP
                     NGVPTGAVKETQPWEAANNQVTTTSLTYTHANIGGQQLNLQLFNQDFKAVYGGGCFDS
                     FYDPSFEGSDQVIQCGVGSKGESLYYEQSRNASVKWGLKSSLIAKDIAGSGIDAAYGV
                     DLFRDTTEQDLVKTGFSWVPESTYDNVAPYLQLDYDLIENLTLSTGVRYEHAELSVDD
                     YKTLWGAGNKQIAGGSATFDETLFNVGISYKITPDIRVYTSYNQGFGMPDIGRILRDG
                     KSFPGDNPNIDDSLALTPIVTDNVEVGADYQGKYLSAKFAYYRSATDFGSRLALNGDG
                     FYDVKREKSMIEGIEANVTAYLTSNDDLGMNIAIQQGEYDSNGDNKVDTDLDGANISP
                     NRINLFWTHNFDNDMSTRVQANYYMDRDFKNAAGNKYAEFDGYTTVDASFSMPLYTGT
                     LSLGLQNLFNKDYFNYYSQTMGTNDRYFKGMGRTATIGYTLPF"
     gene            335369..335605
                     /locus_tag="SBAL_RS01510"
                     /old_locus_tag="Sbal_0299"
     CDS             335369..335605
                     /locus_tag="SBAL_RS01510"
                     /old_locus_tag="Sbal_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845546.1"
                     /db_xref="GI:500171121"
                     /translation="MSGVQVEGYNRAPLSRIRIGALMNRKKKINQTLKSKAKKANAKL
                     QSSNKPKYIAKADREASAAVADTESYTVDSVIVV"
     gene            complement(335664..336176)
                     /locus_tag="SBAL_RS01515"
                     /old_locus_tag="Sbal_0300"
     CDS             complement(335664..336176)
                     /locus_tag="SBAL_RS01515"
                     /old_locus_tag="Sbal_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845547.1"
                     /db_xref="GI:500171122"
                     /translation="MKLTYVGLALSLLLLGGYLIPESPVIPVKGASSKDWNSQTFWYE
                     PWGPSGVHKGIDIFAAKNTAMIAPTPMLIFYRGDFFKGGNVVVGLGPKWQIHYFAHLA
                     QIESATGLIAYQGETLGTVGDTGNAQGKPPHLHYSILSLLPKPWLIDTSTQGYKKAFY
                     QNPISYLEAR"
     gene            complement(336216..336818)
                     /locus_tag="SBAL_RS01520"
                     /old_locus_tag="Sbal_0301"
     CDS             complement(336216..336818)
                     /locus_tag="SBAL_RS01520"
                     /old_locus_tag="Sbal_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845548.1"
                     /db_xref="GI:500171123"
                     /translation="MVALMSVLTWLKKHLHSAFHGNSTLERQADLAAIFHPAQMPDID
                     LPTNQAYPLVTPILQADIYAYQVHGLLTLEGKQTLDTLIGNAGFAVLPEHAASFNGLL
                     THRSRATSLQLNQYADFAGICVSLISNDKALLEQLIAFKSTLPHPWESFPDVDPDTLG
                     SLQGNIDFWCNYFWRPYWLSLSAAERLQYPVNWQEFSDFH"
     gene            complement(337294..338637)
                     /locus_tag="SBAL_RS01525"
                     /old_locus_tag="Sbal_0302"
     CDS             complement(337294..338637)
                     /locus_tag="SBAL_RS01525"
                     /old_locus_tag="Sbal_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074061.1"
                     /note="functions in anaerobic transport of
                     C4-dicarboxylate compounds such as fumarate; similar to
                     DcuA; DcuA and DcuB function as independent and mutually
                     redundant C4-dicarboxylate (aspartate, malate, fumarate
                     and succinate) transporters; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_006086569.1"
                     /db_xref="GI:493005414"
                     /translation="MILMEFIVVLSCLLLGTRYGGMGLGLISGIGLFLLIFVFGLAPG
                     QPPVQVMLTILAVIGCAAVLQTAGGLDVMMQFAERLLRRHPQYITILAPLTTWTLTFL
                     CGTGHVVYTMFPIISDIALKKNIRPERPMAVASVASQMAICASPVSVAVVSMVSILAS
                     QQGVGRAYNLLEILMVSVPASLCGVMAAALWSLRRGKDLDKDEEFQERIQDPVQRAFI
                     YDKSETLLNQRFPKEAYWATGIFFAAIAAVVLLGSFSELRPAFEVKGKTTLLSMNLVI
                     QMMMLIAGAFILMTCKVKPTNISNGPVFKAGMVAIFSVFGVAWMSDTFFISHMDVLKE
                     NLSHVVQSQPWTYALVLFLISKLVNSQAAALTAIAPMGLALGVDPKLLIAFLPASYGY
                     FVLPTYPSDLACIGFDRSGTTKIGKFIINHSFIIPGFIGVGTASTVGYLLATALL"
     gene            338903..340081
                     /locus_tag="SBAL_RS01530"
                     /old_locus_tag="Sbal_0303"
     CDS             338903..340081
                     /locus_tag="SBAL_RS01530"
                     /old_locus_tag="Sbal_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845549.1"
                     /db_xref="GI:500171124"
                     /translation="MKPATFNTEAFDDWIRSRFVELNSELEQLYYQQTDRANVLDIGA
                     EAKLALESEGRELITALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPSRETTS
                     PLAEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPAEKLFVDYNTKGI
                     LAYKRAADALLKIQPLGISHPICHDLLRVAKQALQDVIESNTQLFNRLDTDRFFYCVR
                     PYYKPYRVGSVIYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQ
                     ILRECMRRPNLMDDFLQAKDSANQTWYQENLRLFIEVCELHGETAIQHHNELVTKYIA
                     EPSTSMEQQHLAKVTASGPPLHVLLGSLERLRDRRAAAQRSDIRTRYYEIKKLKESLR
                     "
     gene            340086..341207
                     /locus_tag="SBAL_RS01535"
                     /old_locus_tag="Sbal_0304"
     CDS             340086..341207
                     /locus_tag="SBAL_RS01535"
                     /old_locus_tag="Sbal_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class V aminotransferase"
                     /protein_id="WP_011845550.1"
                     /db_xref="GI:500171125"
                     /translation="MFEDFKKDFYLAGPGYLLNHSVGRPLKSTEQVFKEAFFAPWQES
                     GREPWGQWLSVIDDFTFALSKLFNGHQKDFCPQVNLSSALTKIVMSLDRLNREHAVVL
                     MSEIDFPSMGFALKKALPASCEVRFIPKGLDVTDPNVWDAHISRDVDLVFVSHAYSNT
                     GQQAPLANIFTIARERGCLSLVDVAQSAGIIPLDLARLQPDFLIGSSVKWLCGGPGAA
                     YLWVNPAILESCQPKDVGWFSHENPFEFDIHDFRYQHSAMRFWGGTPSIAPYAIAAHS
                     IHYLAGLGIPLLRKCNQQLIDAVAQELEHEFVSPRDVEKRSGTLILQFGEQQHQIMTA
                     FANANISVDARSMGIRISPHIYNNMADIKLLLDVIKANR"
     gene            complement(341270..342466)
                     /locus_tag="SBAL_RS01540"
                     /old_locus_tag="Sbal_0305"
     CDS             complement(341270..342466)
                     /locus_tag="SBAL_RS01540"
                     /old_locus_tag="Sbal_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="WP_011845551.1"
                     /db_xref="GI:500171126"
                     /translation="MWQKIKPYKDSIVLLTALLLGGVLGVGLPELALKLKPLGQIFLN
                     LLFMIIVPLVAISVTSSIARMTDLKKLGALLVSIMAVSIVMAIIPAVGIIGLALFFDP
                     AQGVTLDLNQTISDTAGTMDFVGLLTTNDFSGLLSKSNILALIIMSVIAGIAIGQSGE
                     DGRKVSALLDSFNTVIMKIVSIIMVAAPVGLGAYFASTMASQDPQLVITFARAVGLFM
                     VACFIYLTVGSTFYAWLGGGTQGVKQFWRFALEPAVTALGTTSSLATLPVTLRTALKM
                     GIKPEIADISLPLLVNLNKGGASIITALKIVFIYSLLRLDFTVDVFMVTILISVLSAF
                     IIGGVPGGAFLGEIFIVTTLGLPMETIPILVVIGAITDAPSTVINVVHDLNACQIIER
                     LNRKRL"
     gene            complement(342727..344136)
                     /gene="glnA"
                     /locus_tag="SBAL_RS01545"
                     /old_locus_tag="Sbal_0306"
     CDS             complement(342727..344136)
                     /gene="glnA"
                     /locus_tag="SBAL_RS01545"
                     /old_locus_tag="Sbal_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011074057.1"
                     /note="forms a homododecamer; forms glutamine from ammonia
                     and glutamate with the conversion of ATP to ADP and
                     phosphate; also functions in the assimilation of ammonia;
                     highly regulated protein controlled by the
                     addition/removal of adenylyl groups by adenylyltransferase
                     from specific tyrosine residues; addition of adenylyl
                     groups results in inactivation of the enzyme; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_006079778.1"
                     /db_xref="GI:492987327"
                     /translation="MSVESVLKQLEELEVKFVDLRFTDTKGKEQHVSIPSHQVDADFF
                     EDGKMFDGSSIAGWKGINESDMVLMPDPTTFVLDPFTEETTALIRCDILEPGTMTGYD
                     RDPRSIAKKAEAYLISTGIADTVLIGPEPEFFLFDDVRFGTDMSGCFVKIDAKEAAWN
                     SGTSYEGGNTGHRPFTKGGYFPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAG
                     QNEIATRFNTLTKKADEIQILKYVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLA
                     KDGVNLFAGDKYAGLSETALYYIGGIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLA
                     YSARNRSASIRIPVVPSPKGRRIEARFPDPHANPYLGFAALLMAGLDGIQNKIHPGEA
                     MDKDLYDLPPEEAAEIPQVATSLENALENLQADHEFLTKGGVFSEDFIQSYIVLKTAE
                     AERVARTTHPLEFEMYYSL"
     gene            345160..346971
                     /locus_tag="SBAL_RS01550"
                     /old_locus_tag="Sbal_0307"
     CDS             345160..346971
                     /locus_tag="SBAL_RS01550"
                     /old_locus_tag="Sbal_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_012196535.1"
                     /db_xref="GI:501151712"
                     /translation="MLENLRNIAIIAHVDHGKTTLVDKLLSQSGTLATRGEATERVMD
                     SNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAV
                     DGPMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDF
                     PIVYASALNGFATLDPDVASDDMTPLFQTIVEKVSFPDADAEGSFQMQISQIDYNSYV
                     GVIGIGRIKRGSVKTNQQVTIIGADGKTRNGKMGQVLGYMGLDRTEVEIANAGDIVAI
                     TGLGELKISDTICAVGAVEAMPALTVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILER
                     LQTELVHNVALRVEETESPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVILKTI
                     DGELCEPYETLTVDVEEEDQGTVIEKLGTRKAEMKDMQLDGKGRVRIDFIIPSRGLIG
                     FQTEFLTATSGTGLIYHSFDHYGPHKGGDIGQRANGVLISNATGKALTFALFGLQDRG
                     RLFIGHAAEVYEGQVVGIHARSNDLTVNCLKGKQLTNMRASGTDEAQVLTTPITMTLE
                     QALEFIDDDELVEVTPKNIRVRKRHLTENDRKRFNRA"
     gene            complement(347260..348282)
                     /locus_tag="SBAL_RS01555"
                     /old_locus_tag="Sbal_0308"
     CDS             complement(347260..348282)
                     /locus_tag="SBAL_RS01555"
                     /old_locus_tag="Sbal_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photolyase"
                     /protein_id="WP_011845553.1"
                     /db_xref="GI:500171128"
                     /translation="MRPNRQQLIRSLFDEYIEMYSSRDNRLTHRFSENFSGYAGSSDL
                     LVNNRKEWMRITRQDFAQVPERIHIEMLDLSLQDLADNLVVVTAFFHIHLPIPNPMLS
                     RETARLVLIFRLEHKDWMIAHSGISIPYGLAHKGEIYPIAQLEERNVELESMIKARTC
                     ELAEANRQLEILSNTDSLTNIGNRRLFDMMLQTEWSRGQRSNSSLALIMLDIDHFKQF
                     NDHYGHLAGDDCLKQLASTLSQSGRRAGELVARYGGEEFVILLPNIDKQTVLDTAQHI
                     HQLIQAIAIPHADTDLGIVPVSAGVAYLQPSNQQNALELVRQADAALYRAKSAGRNCI
                     RVMNEK"
     gene            complement(348471..350363)
                     /locus_tag="SBAL_RS01560"
                     /old_locus_tag="Sbal_0309"
     CDS             complement(348471..350363)
                     /locus_tag="SBAL_RS01560"
                     /old_locus_tag="Sbal_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="WP_011845554.1"
                     /db_xref="GI:500171129"
                     /translation="MKQSKFRSVLFLYISMLFILNCSRIANYIVYRDYYKETLDLLTV
                     IFTSFRFDIMTTGYVMLIPTLLILVPGSGRIATFIKGMGLKLGLIMLLLSTLALIGDF
                     IYFGVVNRHTFSDLPLLMTETSFVLPFLVKDHLALTILSFAIIILAIIFLIKKYQLFF
                     HNNQKHRTLASQISVFIIAIPVLILFLRGLNLHGKPLGIIDAYKNQSEQQANLILNGI
                     YTGGKGTTQIFKRTDYNFFSSEEIKQHLNKTEDEAYKYPFLSQFPENTPNGRNLVIIL
                     VEALSYAYIDGLSGSDYKVTPFLDELSKKAEVYDNFYAAAQRSNLGVQASLFGLPPLE
                     SVGYIGGGLELSRLTKIGNIAQAHGYQTQMLQSSKRDSIRLDSIANYAGFQQYLGRSD
                     IPITRTDYPDPDGAQFGWDYEMLMKTLELANKKTQPFISFSFTGTTHMPYVETPKHLQ
                     VYPYGQDTFTDFLNTVRYTDEALKAFFAEASKQDWYENTTFMILADHTLFNTKNPGLE
                     SAFHIPLWIYRPGQNITPKRHKILASQLDILPTAFDLLGFNDEFASVGRSLYRERKPY
                     SIVVKGDLLGAFTNSGNFLIAGDKIISESDNADFIESQAPQYAEQLKLEFQLSQQAVL
                     NNTWVK"
     gene            complement(350447..351661)
                     /locus_tag="SBAL_RS01565"
                     /old_locus_tag="Sbal_0310"
     CDS             complement(350447..351661)
                     /locus_tag="SBAL_RS01565"
                     /old_locus_tag="Sbal_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011845555.1"
                     /db_xref="GI:500171130"
                     /translation="MTFIESLTLMLALMYLASLSYWSGQKWGAAATLLLSVGAVAISL
                     YWPLALGLIIALPLALLGHKFAPDSFKGEIKINTLRQGTQHVLALSLLLVAVQYTINT
                     ILLKQGITPWLMRPDVVDAFLPIAGGIELKAIVSLNLWDQTHPAAAVMLAAVLLTGLL
                     CKRAFCGWACPLGLAGEYLYAFRKRFIKSELTPPAWLDWPMRMLKYLLLLGLCYIVIG
                     MPAQSIPNYLEGNYHKIADLKMALFFLTPSLITLLVFALILALAAWRRQGFCRYLCPY
                     GAILGILSFASPLKIRRDSQHCLIEAKGMKCDKCSRACPANIIVHTKTTVRSDECQAC
                     MRCVAACPKSAALGLGLKSGHRLGHKGLLALVLIALFILPLGAYLAGFWHSQTPDNIR
                     MELIQVIDRVGH"
     gene            351736..351924
                     /locus_tag="SBAL_RS01570"
     CDS             351736..351924
                     /locus_tag="SBAL_RS01570"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037392254.1"
                     /db_xref="GI:739533846"
                     /translation="MKLCDRSKIGAINPLKRAIAHKAKCFGLAQKKKGLQGGEMSNVT
                     THRQVKGKYGSLDVYISK"
     gene            352029..353033
                     /locus_tag="SBAL_RS01575"
                     /old_locus_tag="Sbal_0311"
     CDS             352029..353033
                     /locus_tag="SBAL_RS01575"
                     /old_locus_tag="Sbal_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxobutyrate oxidase"
                     /protein_id="WP_011845556.1"
                     /db_xref="GI:500171131"
                     /translation="MEQLPILNLSDWHAGGQSRHAFITKLADAARRIGFFYLTGHGIE
                     LARQQQVLLLARDFFALPLADKLAVKMTNTPHFRGYTRLQGELTLGKPDLREQFDIMQ
                     EETANPPRSDVPKWSQLQGPNQWPSQLPQMKTILLEWQQDLADTSVALLKALAVALEQ
                     SETAFDATIDAGPYQHMKLIRYPNANGETSGQGVGAHKDPGYLTLVLQDKQSGLEVQT
                     DEGWLSIPPLEGAFVVNIGELLELASNGYLKATYHRVTSPPAGVERYSCAFFMAAQLN
                     ATVPLLPLPEYLARQALGPASDPLNPLFHQVGQNVLKGRLRSHPDVAKAHYASFANAI
                     "
     gene            353052..354212
                     /locus_tag="SBAL_RS01580"
                     /old_locus_tag="Sbal_0312"
     CDS             353052..354212
                     /locus_tag="SBAL_RS01580"
                     /old_locus_tag="Sbal_0312"
                     /EC_number="4.4.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086582.1"
                     /note="catalyzes the formation of methanethiol and
                     2-ocobutanoate from L-methionine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine gamma-lyase"
                     /protein_id="WP_011845557.1"
                     /db_xref="GI:500171132"
                     /translation="MQFKTKLLHTHHTAENSTGALTTPIYQSSTFAYGSAEDGRARFA
                     GEQPGFIYSRMANPTVQALEHQLSLLEGADEALVVASGMAAISSIFYALASQGDEIAF
                     IDPVYGGTAAFLIQTLTRAGITVRRYQDDDHLLSEISPETKIILFEPITNPTLKVSDY
                     RKVKLAAERVGAITICDNTFLTPYLFKPLEHGIDIVMHSATKYLSGHGDLIAGVVAGR
                     KALMQPIRTIALKHIGAAIGPQEAYLLQRGLRTLALRMDAHLAGAAKVADFLASHPSV
                     AKVYYPGLSQDPGHQVLSETINAFGGMVSIELEGGFSRAAQFLDNLNLFTQAVSLGDL
                     ESLACHPASTTHAAMDVASRLASGVNDNLIRLSIGVEDPQDLIADLEQALAI"
     gene            complement(354475..355128)
                     /locus_tag="SBAL_RS01585"
                     /old_locus_tag="Sbal_0313"
     CDS             complement(354475..355128)
                     /locus_tag="SBAL_RS01585"
                     /old_locus_tag="Sbal_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair ATPase"
                     /protein_id="WP_006079785.1"
                     /db_xref="GI:492987345"
                     /translation="MKRLITSGLIAASLLLSGCQSAYYGAMEKVGYHKRDIMVDRVKD
                     AKESQEDAQKEFSSALEEMQALLNHDGGNLEKAYNKAKDEYESAQSAADNVSNRIKKV
                     EDVAEALFDEWQDEIGEISKASLRRNSEAKLKETRRAYEQLIKSMHRAESKMPPILTA
                     MKDNMLYLKHNLNAQAIGAIKGEFASLQTDISGLIKEMNKSINESNKFIESLEKSKS"
     gene            complement(355158..355379)
                     /locus_tag="SBAL_RS01590"
                     /old_locus_tag="Sbal_0314"
     CDS             complement(355158..355379)
                     /locus_tag="SBAL_RS01590"
                     /old_locus_tag="Sbal_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079786.1"
                     /db_xref="GI:492987349"
                     /translation="MSQQGSAGNVISAIASLFFPGLGQLLQGRIMAALLFFIITVVGY
                     ALWWLIVPAVIGAIFHLWSIIDAARFKAD"
     gene            355461..356432
                     /locus_tag="SBAL_RS01595"
                     /old_locus_tag="Sbal_0315"
     CDS             355461..356432
                     /locus_tag="SBAL_RS01595"
                     /old_locus_tag="Sbal_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZD5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006086585.1"
                     /db_xref="GI:493005438"
                     /translation="MTKKIELAQIRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVT
                     LLSLVPMVAVTMSMLSAFPVFKGIRGQIEGFVYENFLPAAGDTVQVYINEFVGNASKG
                     TAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVAFSMYWMVLTLGPVLVGASLV
                     ASSYVISLKVFEAEALSGMLPIFIARLPMLFSVAAFLLLYMVVPNQKVKFLHALLGAI
                     VAALLFELGKKGFALYVTQFPSYEAIYGALATIPIVFVWVYLSWMIVLLGAEITAAMP
                     EYLDYESSSDDETALNAKPLADASQGDSSSVLTSAEVTALKAVAKSE"
     gene            356469..357422
                     /locus_tag="SBAL_RS01600"
                     /old_locus_tag="Sbal_0316"
     CDS             356469..357422
                     /locus_tag="SBAL_RS01600"
                     /old_locus_tag="Sbal_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011845558.1"
                     /db_xref="GI:500171133"
                     /translation="MSESFPPFIRRDWFSVGNGQQLHLAQYGNPQGIPLLYLHGGPGA
                     GCDIGDLALFNGEQYWILLLDQRGSGQSLPFGDLAHNHLNGLICDMEAIRLALGIERW
                     CLAGGSFGATLGLIYSGLFPERVIAQVLWALFIPSKEGIDWLYGADGAAKLQPAAYRL
                     FSGNAPVAPSLAELLDSYHQGLASADENLRHHFARRWVQWELKLAGARLVLPRQLPDP
                     VLALADIELHFARHDYFNAMTVLQRVTPRVKARSVLLQGMQDAICPAALLRDFLAGLE
                     HAITIQSVADGGHMLNSESLFLAVTAEIHAMWSWIHQREIQ"
     gene            357419..358024
                     /locus_tag="SBAL_RS01605"
                     /old_locus_tag="Sbal_0317"
     CDS             357419..358024
                     /locus_tag="SBAL_RS01605"
                     /old_locus_tag="Sbal_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845559.1"
                     /db_xref="GI:500171134"
                     /translation="MKTLLISACLLGLTACAATAPSQTSAIDPVVAQEVVSAPVAPKV
                     VQLGGLTNDAAAERLYQALINANYLATKVAPTKVAVQFGDNQFLLEPSINSAGIDRIL
                     MNRFYAVHPQLQASQELPVVIGTLNQKLNFAKFVLLDQGAVIQIQGTVTFADRVEIEE
                     LRRFMLWTNGGLAQVAQSLPDGIDQYIRPIPLMQQMVPVKP"
     gene            358042..358479
                     /locus_tag="SBAL_RS01610"
                     /old_locus_tag="Sbal_0318"
     CDS             358042..358479
                     /locus_tag="SBAL_RS01610"
                     /old_locus_tag="Sbal_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4Y2G8.1"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminoacyl-tRNA deacylase"
                     /protein_id="WP_011845560.1"
                     /db_xref="GI:500171135"
                     /translation="MIALIQRVSRASVVVDNQTIGAIDKGLLVLLGVEQEDTREKMEK
                     LATKVMSYRMFSDENGKMNLNLEQVGGSLLVVSQFTLAADTGRGLRPSFSGAGTPDQA
                     LALYEEFVAFCRAKGVTTETGQFGADMQVSLVNDGPVTFNLQV"
     gene            358639..359091
                     /locus_tag="SBAL_RS01615"
                     /old_locus_tag="Sbal_0319"
     CDS             358639..359091
                     /locus_tag="SBAL_RS01615"
                     /old_locus_tag="Sbal_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_006086590.1"
                     /db_xref="GI:493005443"
                     /translation="MDELLTQLLIQLRQTWHSTIPVSEFMQIAPLDYSEGEFRVTAPI
                     APNINLHQTMFAGSIYTLMTLTGWGAVWLNQQLAGVAGDIVLADAHIRYLAPVTCDPV
                     VTVQWPTVDLSPLQRGRRVKVKLAVQLYCDAKLCAVFEGLYVSAPKAS"
     gene            359251..359847
                     /locus_tag="SBAL_RS01620"
                     /old_locus_tag="Sbal_0320"
     CDS             359251..359847
                     /locus_tag="SBAL_RS01620"
                     /old_locus_tag="Sbal_0320"
                     /EC_number="3.1.4.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8E4C0.1"
                     /note="FMN-dependent; requires NADH; catalyzes the
                     cleavage of azo bond in aromatic azo compounds; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent NADH-azoreductase"
                     /protein_id="WP_011845561.1"
                     /db_xref="GI:500171136"
                     /translation="MSKVLILKSSILGGYSQSAVLIDHLASHWETQGAAITVRDLGGK
                     DVLPMVDGEIASGLRGGAELSARQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPTQ
                     LKNWIDFIARAGVTFTYTETGPKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLG
                     FIGITNVEVVYAEALNMGPEAHDKGMSEAKHSIEQLKA"
     gene            complement(360001..360186)
                     /locus_tag="SBAL_RS01625"
                     /old_locus_tag="Sbal_0321"
     CDS             complement(360001..360186)
                     /locus_tag="SBAL_RS01625"
                     /old_locus_tag="Sbal_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845562.1"
                     /db_xref="GI:500171137"
                     /translation="MHKTNHAKALQFEATQVNPAEKPHETERPARFSISRNRDQASTK
                     VRYVETSTLTKGCSLCE"
     gene            complement(360262..360585)
                     /locus_tag="SBAL_RS01630"
                     /old_locus_tag="Sbal_0322"
     CDS             complement(360262..360585)
                     /locus_tag="SBAL_RS01630"
                     /old_locus_tag="Sbal_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_011845563.1"
                     /db_xref="GI:500171138"
                     /translation="MFQSLLAKLSGSQSGEKCWQLIEQGARVIDVRSPEEFASGHLPQ
                     AINVPLPTLDQWLHQVDNKQHPFVLYCGAGIRAQKGCDILKANGFGCVVNGGSLKDLV
                     CCQPS"
     gene            complement(360731..361306)
                     /locus_tag="SBAL_RS01635"
                     /old_locus_tag="Sbal_0323"
     CDS             complement(360731..361306)
                     /locus_tag="SBAL_RS01635"
                     /old_locus_tag="Sbal_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011845564.1"
                     /db_xref="GI:500171139"
                     /translation="MQTINSYLATTLKALRNQKGWSLDKAAQETGVSKAMIGQIERGE
                     SSPTIATLWKIASGFNFSLSTFLEPTPQSQGAVFRKPDELRQQPATDGMLVASLFPFE
                     DRFGFEMFELTLLPNYERLSEPHEAGVTEHVIVLSGTMEVLVDGQWQTLKQGEAVRFA
                     ADKPHGYRNLNDQAVVFHDIIHYQRGSESSL"
     gene            361433..362620
                     /locus_tag="SBAL_RS01640"
                     /old_locus_tag="Sbal_0324"
     CDS             361433..362620
                     /locus_tag="SBAL_RS01640"
                     /old_locus_tag="Sbal_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845565.1"
                     /db_xref="GI:500171140"
                     /translation="MWREAGSLSKISAGFIAVLVGYSSSAVIIFQAAEAVGATPAQIS
                     SWLWALGVGMGVTSIGLSLYYKNPILTAWSTPGAALMVTSLGGLSINQAIGAFLVSSI
                     LITLCGVAGWMDKLIRIMPQSVASAMLAGILLQFGLGLFQAMQTQLSLILIMLLVFVV
                     VKPFAPRYIILLTLLVGIGMSFQLDLLKLDAVQLQLAMPVWTMPEFSLASVIGVALPL
                     FVVTMASQNMPGVAALHGNGYRPPISPLITSTGLIGVILAPFGGFAFNLSAITAAICM
                     GKEADPNPATRYWAAVWGGVFYFITGLLGATVVGLFSAFPKELVLAIAGLALLGTIAN
                     SLTAALAKTEDREVAVITFLVTASGFSVLGIGSAFWGLLLGFIIHWWNGHRTATVVKR
                     ANT"
     gene            complement(362673..363152)
                     /locus_tag="SBAL_RS01645"
                     /old_locus_tag="Sbal_0325"
     CDS             complement(362673..363152)
                     /locus_tag="SBAL_RS01645"
                     /old_locus_tag="Sbal_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_041409048.1"
                     /db_xref="GI:752761930"
                     /translation="MKATMKATMKITLDDLKGPEIAALLQEHLNDMRATSPPESVHAL
                     DLDGLRQPNIHFWTLWDGNNLAGCGALKWLDAEHAEIKSMRTAAPYKQQGIASKILQH
                     LINDAKTAGVKRLSLETGSMDFFNPARLLYSKFGFEICDPFDGYQLDPNSVFMTKKI"
     gene            363163..363384
                     /locus_tag="SBAL_RS01650"
     CDS             363163..363384
                     /locus_tag="SBAL_RS01650"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041408831.1"
                     /db_xref="GI:752761713"
                     /translation="MAVRCSLLFWLIHNGGIALLSVCQCAAVDKQILSHKMLIKAKVV
                     GLPPLLFEHESTKEDCSSYSFCFYFYKLP"
     gene            complement(363680..364423)
                     /locus_tag="SBAL_RS01655"
                     /old_locus_tag="Sbal_0326"
     CDS             complement(363680..364423)
                     /locus_tag="SBAL_RS01655"
                     /old_locus_tag="Sbal_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845567.1"
                     /db_xref="GI:500171142"
                     /translation="MKPLFAGMLLSISLLTAPLFAKEYTVETYQEVFKGDNEFKQKQA
                     IESLSLAGLSDPAIYDALEAKLLASLPQATEKNAIDYSAWLVKGLAYSGNDKYSETIN
                     SIVNGNYHKKLKKYASQANENLAQYKKWNTILGDKSQYAADQSQQNNAFANALRSDDL
                     ELMRLAAKRIMDDRQYDDFILAVLSNELKTPRLMADDKLAIDTYANMAKALASSGNAD
                     YRDVIENIATTSSNRKLQKYAASYLKKFY"
     gene            complement(364452..365711)
                     /locus_tag="SBAL_RS01660"
                     /old_locus_tag="Sbal_0327"
     CDS             complement(364452..365711)
                     /locus_tag="SBAL_RS01660"
                     /old_locus_tag="Sbal_0327"
                     /EC_number="2.3.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586546.1"
                     /note="FabB; beta-ketoacyl-ACP synthase I, KASI; catalyzes
                     a condensation reaction in fatty acid biosynthesis:
                     addition of an acyl acceptor of two carbons from
                     malonyl-ACP; required for the elongation of short-chain
                     unsaturated acyl-ACP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_011845568.1"
                     /db_xref="GI:500171143"
                     /translation="MSEATNQTRLGKRVVITGVGGITALGHDWPTIAASLKAQKNCVV
                     TMNDWDRYDGLNTRLAAPITDFEVPSHYSRKKIRSMGKVSIMATRASELALLDAGLLD
                     DPIVSSGEMGIAYGSSTGSTDPITAFGDMLKTGDMSGITATSYIRMMAHTTAVNVGVF
                     FGLKGRIHTTSSACTSGSQGIGYAYEAIKYGQQTLMLAGGGEELCPTEAVVFDTLFAT
                     STKNSTPELTPRPFDADRDGLVIGEGACTLVLEELEHAKARGAKIYAELVGFGTNSDG
                     QHVTQPNAQTMEIAIRLALKDAQLEPSAIGYVNAHGTATDRGDIAESHATQAVFGADT
                     PISSLKSYTGHTLGACGALEAWVSIEMMNAGWFAPTLNLKNIDPQCADLDYIRNELRP
                     IDTDYVMSNNFAFGGINTSLIFKRWTR"
     gene            complement(365712..366437)
                     /gene="fabG"
                     /locus_tag="SBAL_RS01665"
                     /old_locus_tag="Sbal_0328"
     CDS             complement(365712..366437)
                     /gene="fabG"
                     /locus_tag="SBAL_RS01665"
                     /old_locus_tag="Sbal_0328"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011627449.1"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_011845569.1"
                     /db_xref="GI:500171144"
                     /translation="MNNRVLVTGSSRGIGKAIALKLAQAGFDIALHYHSNQTAADDTA
                     TQIRALGVNVSLLKFDVADRATVKAAIEADIEANGAYYGVILNAGINRDTAFPAMTES
                     EWDSVIHTNLDGFYNVIHPCVMPMVQGRKGGRIITLASVSGIAGNRGQVNYSASKAGI
                     IGATKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVEQLVPMRRMGKPNEIAALA
                     AFLMSDDAAYITRQVISVNGGMI"
     gene            complement(366625..367158)
                     /locus_tag="SBAL_RS01670"
                     /old_locus_tag="Sbal_0329"
     CDS             complement(366625..367158)
                     /locus_tag="SBAL_RS01670"
                     /old_locus_tag="Sbal_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester dehydrase"
                     /protein_id="WP_014620562.1"
                     /db_xref="GI:504433460"
                     /translation="MPFIQFNLPFAEQDIADFIPHRAPMILVDKIISYQRDTLVTEVT
                     ITTQSPYFDDKHKAVPNYVGIEYMAQSIAALAGVEAKLRNDKIRVGFLLGSRKLALHA
                     KQYELGRTYRTQVNRLYQEESGLAVFDCQIYLLPEAGSDQEKILVATANVNVFQPQDT
                     QAYLDGNQDAGNRSLGH"
     gene            complement(367163..368383)
                     /locus_tag="SBAL_RS01675"
                     /old_locus_tag="Sbal_0330"
     CDS             complement(367163..368383)
                     /locus_tag="SBAL_RS01675"
                     /old_locus_tag="Sbal_0330"
                     /EC_number="2.3.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_011845571.1"
                     /db_xref="GI:500171146"
                     /translation="MVKKRYAMMNRVAITQIGLCTPLGQDPQQVLDRLIAGDTSAMQR
                     SDTLLFEHPTLVAPVTAALPAIPAKLIQFDCRNNQLLLCAAQQITATIEQAKRDLGHA
                     RIGVVLGTSTSGISKGEAALSYRNQHGHFPADYHYFQQELGSTSDFLRQYFELDGPCY
                     TISTACSSSAKVFASAKRLLSANLCDMVIVGGVDSLCQLTVNGFNALESVSKGHCNPF
                     SINRDGINIGEGAALFVLTAGESDVMLAGIGESSDAHHISAPHPEGAGAITAMQAALQ
                     DANIAAQDIGYINLHGTATPKNDAMESRAVVEVFGANTPPCSSTKPLVGHTLGAAGAI
                     EAAFCYLLLSTHNHDQALPPHQWDGQIDPQDPSIALVERHQVAAKGTLNYVMSNSFAF
                     GGSNASLIFCRNEA"
     gene            complement(368412..369200)
                     /locus_tag="SBAL_RS01680"
                     /old_locus_tag="Sbal_0331"
     CDS             complement(368412..369200)
                     /locus_tag="SBAL_RS01680"
                     /old_locus_tag="Sbal_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845572.1"
                     /db_xref="GI:500171147"
                     /translation="MSLNLNAKWLAITTLLLASLGLTGCSELLLRQTCVGLAKDMRYC
                     LAPLPHNFAPATDKPLTQPRIKPTTEPTTKPAIMASQQTDSNTGVFSPQSFSQKVSIK
                     VGKESHELLTQLELEGERMTLVGLAPLGQALFTLVYDGNTLSSEQSVLLGDNFKAEYL
                     MAMMQLIYWPEQSIRAHLEGGHLVTGLCDTVEGNQSDTLVDTRMNTIPCRQIYSQDTL
                     ISKSALQTHVVQIRYQQNVGDALWQAHISLTMPQAKFELEIEPI"
     gene            complement(369205..370494)
                     /locus_tag="SBAL_RS01685"
                     /old_locus_tag="Sbal_0332"
     CDS             complement(369205..370494)
                     /locus_tag="SBAL_RS01685"
                     /old_locus_tag="Sbal_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_011845573.1"
                     /db_xref="GI:500171148"
                     /translation="MSTQVHDLSAIPNSLDVDVAIIGAGPSGAIAASLLHQQGKRVLV
                     LEKQHFPRFSIGESLLPCCMQFIEEAGMLDALNAAGFQHKNGAAFRRNGTYTTFDFTD
                     KFTPGPGTTFQVQRASFDKLLADTAQSQGVDIRYGETVEAIDLTENPRLTVRNEQGEL
                     YQINAQYVLDASGFGRVLPRLLNLESPSCLPPRSAIFTHVEDNISDASFDRNKILISV
                     HPEHKDIWYWLIPFSNGRCSLGVVAEPQLLERLPGSLEQQLMSIVNEEPGLKALLANA
                     KVVQECATLKGYSANVSRLATDKFALLGNAGEFLDPVFSSGVTIAMQSASMAAKCLTK
                     QLNGETVDWQADYSTPLMQGVNAFRTYVQAWYDGRFQDVIFYEEPNERIKQMICSILA
                     GYAWDTNNPFVKDSERRLNMIVELCRNPAATPAFAEV"
     gene            complement(370518..373040)
                     /locus_tag="SBAL_RS01690"
                     /old_locus_tag="Sbal_0333"
     CDS             complement(370518..373040)
                     /locus_tag="SBAL_RS01690"
                     /old_locus_tag="Sbal_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845574.1"
                     /db_xref="GI:500171149"
                     /translation="MASNFAARANQALMQSSPKWRLAIWLLLMLSASLWTLQLWQNGA
                     RVQSDILAMLPHLQQDKLTERALNQVEATLADQVYIALVAKDETTAIAAAKLLMQKLE
                     ADLVARGKQGALTDIRSADMQLGEALGQFYFPHRFKLLTEPQAKALANQDIGSLIEAA
                     TAQLYNAFSYANSNLLAQDPLLLFPANLLTLAPSSKVRASQGILLANQGDNVAAVVMA
                     KGRESAFNPNAQLAQMTALTQGLDAVKQSYPDITVLKAGALFHALAATQTAKSEISIL
                     GLASLLGVIALVWLAFRSVMPLLLAIVTISSGLLLAVTFTLSVFGELHLLTLVFGTSL
                     IGIAIDYSFHFYCERLSDSERSAKATVAYIFPTVTLAFITSALAYVGIGLAPFPGMQQ
                     VAIFCAAGLLGAYLTLILAYPLLASSRLPEGSRPLALAGTYLASLTQLSKRFTTPLGM
                     GMFALVILVWCLVGVTKLTVDDDIRHLQQSPASVTEPENQLRQLLSGGTDNQFLLVRA
                     PNEEALLQQLERVSPMLDTAITNQELGNYVSLSRYLPSHQKQDTAYHLQGKIYQTQID
                     TVLTSLGLDENLKPELQAAYLAAKTDYITPAAFFTLGAGKQLAPLWLAPLWLAPNGKA
                     TDYGAINDGDTLNDDGASADQGADYGAIVLLGGIQQIDALKARFAHDGSVQLIDKVAD
                     ISAVMGHYRLLTLKLLALALGIALLLFSLNFGFKKAAVVVAVPALAALLTLATLGLTG
                     SPLSLFHALALILVFGIGIDYSLFFASAQNHGKAVMMAVFMSACSTLLAFGLLAFSQT
                     QAIHYFGLTLSLGIGFTFLLSPLILTTTLALTTNQLLTTKKS"
     gene            complement(373043..373813)
                     /locus_tag="SBAL_RS01695"
                     /old_locus_tag="Sbal_0334"
     CDS             complement(373043..373813)
                     /locus_tag="SBAL_RS01695"
                     /old_locus_tag="Sbal_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845575.1"
                     /db_xref="GI:500171150"
                     /translation="MNSVLAKSSALTKCALFLCLAFALISLPLKAETLAAPGAYQTLF
                     SQSADTAQLVALSQKLNLGETVRGHFVQSRQLKVLKKPLISQGQFIFDKEQGLIWQQI
                     KPFESLLILKDKQLIQRDSQGRVQISKADASASAAVMGDLLPSLVRAMLGGNISGLSE
                     NFELHFLITDKLNTEKLSPDGQWQLGLTPKDPLMKKAIANMVLEGSDVLQSLVLLSAA
                     PNVTPQDMTRIDFSALSQGTLSEAELAQYALALEASKP"
     gene            complement(373813..374244)
                     /locus_tag="SBAL_RS01700"
                     /old_locus_tag="Sbal_0335"
     CDS             complement(373813..374244)
                     /locus_tag="SBAL_RS01700"
                     /old_locus_tag="Sbal_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011918521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_006086613.1"
                     /db_xref="GI:493005480"
                     /translation="MKSLLTIDMEMQIPFHDVDSMGITWHGNYLRYFEIARCKLLDEL
                     GYNYRQMQASNYAWPIIDLQIKYVKASTFEQKITVRAELVEWENRLKINYQIRDVETG
                     ARITKGYTIQAAVDMSTQELCFVTPEVFRDKIATLLAKVED"
     gene            complement(374241..375815)
                     /locus_tag="SBAL_RS01705"
                     /old_locus_tag="Sbal_0336"
     CDS             complement(374241..375815)
                     /locus_tag="SBAL_RS01705"
                     /old_locus_tag="Sbal_0336"
                     /EC_number="4.3.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="WP_011845576.1"
                     /db_xref="GI:500171151"
                     /translation="MSHTKAADSESQSDLQTVEFGRQFLTLEQVVAVAKGAPVKLCDD
                     ADYQEYIQKGARFIDSLLHEEGVVYGVTTGYGDSCTVNVSLDLVHELPLHLTRFHGCG
                     LGETLSIMQARAVMACRLNSLAIGKSGVTYELLKRIETLLNLNIVPVIPEEGSVGASG
                     DLTPLSYLAAVLVGEREVIYQGERQATQDVYAKLNITPHVLRPKEGLALMNGTAVMTA
                     LACLAFDRAQYLARLSSRITAMASLTLKGNSNHFDEILFAAKPHPGQNQIATWIREDL
                     NHHEHPRNSDRLQDRYSIRCAPHIIGVLQDALPFMRQFIETEVNSANDNPIVDGEGEH
                     ILHGGHFYGGHIAFAMDSLKNTVANLADLIDRQMALVMDPKFNNGLPANLSGSTGPRR
                     AINHGFKAVQIGVSAWTAEALKHTMPASVFSRSTECHNQDKVSMGTIAARDCMRVLQL
                     TEQVAAAALLAMTQGIGLRIAQNELSEASLTPSLAKTLAQVRADFETLIEDRPLETVL
                     RQTIAKIQAGEWEVCR"
     gene            complement(375812..377671)
                     /locus_tag="SBAL_RS01710"
                     /old_locus_tag="Sbal_0337"
     CDS             complement(375812..377671)
                     /locus_tag="SBAL_RS01710"
                     /old_locus_tag="Sbal_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_011845577.1"
                     /db_xref="GI:500171152"
                     /translation="MLTPPSDLVESAHIKLALVIPNYNHSAAIAQTLAELAQFNLPCY
                     LIDDGSNDETRYLLQSLAQTYPWVTLLLHPYNRGKGAAVMTGLRRAYRDGFSHALQVD
                     ADGQHNLADIPAMLARAQAKPDALISGKPEYDESVPKGRLYGRYLTHFWVWVETLSFN
                     IQDSMCGFRVYPLAATERLLCQQALTERMDFDIEILVKLYWQGVEILFQPTKVIYPEG
                     GVSHFQGVADNVRITKLHTKLFFGMLKRLPWLLKRKSQQQTVQNSHCSSATSSTSATH
                     WSGMKERGSYWGIKLLAESYRFGGHWLCRAIMYPVICYFFLTGKVTREASLDFLRRVQ
                     KLEPQHPKLNQPVGWRDSLNHFLAFGNAALDRIDAWCDRIELSQVDFPDRQVLADQLE
                     SGKGAVLLVSHLGNLELCRAISIHQRKVKVNVMVLTNHAENFNKVVKQLNPDSTLNLI
                     QVTELNPATSMLLQQKIEDGELVVIAGDRTSSNTQGRVMYAPFMGQDAAFPQGPFILA
                     GLLDCPVFLMFCLREQGRYRVHLERFAETLKGPRAGRMDRLQQAVNRYSERLEYFARR
                     EPLQWFNFFDFWRKDNELQRTPSHLVQPNPLPTTSASSPIPDQDHKTDRTQHS"
     gene            complement(377665..378069)
                     /locus_tag="SBAL_RS01715"
                     /old_locus_tag="Sbal_0338"
     CDS             complement(377665..378069)
                     /locus_tag="SBAL_RS01715"
                     /old_locus_tag="Sbal_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester dehydrase"
                     /protein_id="WP_011845578.1"
                     /db_xref="GI:500171153"
                     /translation="MIKSSLPPILHSDIGIDNIELRLLVAADLEYFNGHFPEQAVLPG
                     VTQLDWAVRLGCQHFGYSEAVANLEVLKFQQLILPGQEVTLSISNNAAKAKLTFAYID
                     GENRYASGRIAFDSTPVNSKSATNNGDEASPC"
     gene            complement(378062..379426)
                     /locus_tag="SBAL_RS01720"
                     /old_locus_tag="Sbal_0339"
     CDS             complement(378062..379426)
                     /locus_tag="SBAL_RS01720"
                     /old_locus_tag="Sbal_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_011845579.1"
                     /db_xref="GI:500171154"
                     /translation="MTQLLKNWLTQGPFAQQLISFNHHDIVTGALFTNQVAYFYEQLL
                     AAPEKKWLLASDTSDLFAVGLCAALLAGKEIILPPNTQTGTLSELTHQFDGILSDKPL
                     CECQAFVLLKKELSLPNKPWPASEAIGELVLFTSGSSGEPKAIRKTLEQLDVEVSVLE
                     HTFAEHLPHCSVVSTVSHQHIYGLLFKILWPLAASRPFLSEQIEYPETLSYYTALLPN
                     LCLISSPAQLSRLPKALEHERQLRSPSLVFSSGGPLSFAAAKGVNQCYGHLPIEIFGS
                     TETGGIAYRRQHEADEPWQVFDRISIDQDPTDGALLLKSPYLADDEWLRCEDKIEPTE
                     NGQFRLKGRLDRIVKIEEKRLSLAQMETLMSSHAYVEQAALVVLPQFKSQLGAVVTLS
                     ELGKNVLQEQGKLSINNALKAHLLTQFERVTLPRRWRYPDILPLNTQGKRVTAQLVEL
                     FDHD"
     gene            complement(379423..379971)
                     /locus_tag="SBAL_RS01725"
                     /old_locus_tag="Sbal_0340"
     CDS             complement(379423..379971)
                     /locus_tag="SBAL_RS01725"
                     /old_locus_tag="Sbal_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845580.1"
                     /db_xref="GI:500171155"
                     /translation="MRALLQVLTALTLLAYPVAVYFGLNYLPAGTIALVLCVLLIVRL
                     MLQKQKVKTLVLPLLVGIALTAGSYLAKRSDWLLYYPVVINLTMLALFSYSLHTGPCM
                     IESLARLKEPDLPDEAIPYLKKVTLLWCGLFILNGSMAAYTAGFTSLATWTLYNGLIA
                     YVLMGLLLGGEWLYRSFWLKKT"
     gene            complement(379971..380219)
                     /locus_tag="SBAL_RS01730"
                     /old_locus_tag="Sbal_0341"
     CDS             complement(379971..380219)
                     /locus_tag="SBAL_RS01730"
                     /old_locus_tag="Sbal_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_006079822.1"
                     /db_xref="GI:492987410"
                     /translation="MQNREQILAMLTTILVDEFEIEAEAITPEANLYEELDLDSIDAV
                     DLVIKLQQLTGKKIQPDEFKSVRTVNDVVNAIEGLVKD"
     gene            complement(380229..380483)
                     /locus_tag="SBAL_RS01735"
                     /old_locus_tag="Sbal_0342"
     CDS             complement(380229..380483)
                     /locus_tag="SBAL_RS01735"
                     /old_locus_tag="Sbal_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_006079824.1"
                     /db_xref="GI:492987412"
                     /translation="MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDAL
                     ELGLAIKKKFDVKIEANSDATKAHFHSVASLASFIESQRP"
     gene            complement(380467..381342)
                     /locus_tag="SBAL_RS01740"
                     /old_locus_tag="Sbal_0343"
     CDS             complement(380467..381342)
                     /locus_tag="SBAL_RS01740"
                     /old_locus_tag="Sbal_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol acyltransferase"
                     /protein_id="WP_014620563.1"
                     /db_xref="GI:504433461"
                     /translation="MFDTAHSHDAAKGYEDSMHNAAYTLPETRRAGLNYVPRWLGGVS
                     CYIAFGLGGLLSSLTILPLLRFWPGTPEARIIRVQKAVHLMFKGFVAMLTWAGVIHVS
                     THRAQQLHDARGVIVIANHPSLVDVVVLISLMPNAGCIVKQGLWRNPFLRGVVSCAGY
                     IPNRGAELMLEDCREVLARGTNLIIFPEGTRTVVGATINDFARGAANIALRAEADILP
                     VVLRTNVRGLTKEQPWYEIPRQTMGMAVEIGATVSYQKYQAALGEHAKMARQLTRDLE
                     HYYKQQLENNYELKQ"
     gene            complement(381335..382069)
                     /locus_tag="SBAL_RS01745"
                     /old_locus_tag="Sbal_0344"
     CDS             complement(381335..382069)
                     /locus_tag="SBAL_RS01745"
                     /old_locus_tag="Sbal_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845582.1"
                     /db_xref="GI:500171157"
                     /translation="MQLTFSILSWGAWAPQYQHPQSWQTWCKNSAELNLDTPQSDTTA
                     PALKHVPAMQRRRFSRLTKMMLEVSFQCEMPANCRSIFASRHGELQRTIGLLEDIIAK
                     QPLSPLGFSQSVHNTASGIFGIVTANIAPSTSVAAGTETLSQAMVEAFAQLHQSPEPL
                     LLVFGDDPVPPVYDEFTQEFELPLALGLQLAPFDAPASVKLTVSRISESSALNPLTYG
                     ALLHALATAQNISGCLSQLHWKLEHV"
     gene            complement(382425..383321)
                     /locus_tag="SBAL_RS01750"
                     /old_locus_tag="Sbal_0345"
     CDS             complement(382425..383321)
                     /locus_tag="SBAL_RS01750"
                     /old_locus_tag="Sbal_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079828.1"
                     /db_xref="GI:492987416"
                     /translation="MQVNQDDRITPQETSSSSNRFALFAIVLVVLLSAGGYYYYSGDS
                     DSPKLIPNAPIVLPETPPSEPMTLESAPEPETTETTPAVTETNTNSTEAPAVTEPEVV
                     AEPVPALAESDAFVQQKALAIIDNNVLGSALVQQDLARQFVVFVDNLAQGELTRKVSP
                     LKGPEKHFSVSEITNKVYLNPEGFHRYDAYVDSIAKMDEQTLMVTYKQMTPMLEEAFT
                     ELGYSNAKFNDRMLQAIKILLAAPIIEDPIELSSISVNYQFVDPNLEALPSAQKLLIR
                     MGPENTRKLKVALRKLENQLAQ"
     gene            complement(383520..385595)
                     /locus_tag="SBAL_RS01755"
                     /old_locus_tag="Sbal_0346"
     CDS             complement(383520..385595)
                     /locus_tag="SBAL_RS01755"
                     /old_locus_tag="Sbal_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079829.1"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_014620564.1"
                     /db_xref="GI:504433462"
                     /translation="MQQLDLVPITDLKGVAKKVAEKLAKLGITTVQDLLFHLPLRYED
                     RTQIYPIAALMPGSYGTIEAEIQSTQIIQGRKRMLVCNVRDDTGSLSLRFFNFSVAQR
                     NAMQNGLMIRAYGEVRRGGHQAEIVHPEYKVVYPGEDVHLSDTLTPIYPTTEGLKQAS
                     WLKLTEQALVLLEDGGLTELLPPQLQPNNISLKQALQTLHRPPAGISQFDLELGQHPA
                     QQRLVQEELLAHNLSMLRLRQRSNLDAAVTMQATGQLLNPFLAALPFKPTGAQQRVVA
                     DIGKDLEKPHPMMRLVQGDVGSGKTLVAAMAALQAIENGYQVAMMAPTELLAEQHATN
                     FAAWFEPLGLKVGWLAGKLKGKVRAQSLADIESGAAQMVIGTHAIFQQHVVFSKLALI
                     IIDEQHRFGVHQRLGLREKGVSQGFHPHQLIMTATPIPRTLAMTAYADLDTSIIDELP
                     PGRTPVTTVAIADSRRNEVLERVRNAVITDKRQAYWVCTLIEESEVLECQAAEDTAEE
                     LRLALPELNIGLVHGRLKSAEKQQIMADFKAGIIHLLVATTVIEVGVDVPNSSLMIIE
                     NPERLGLAQLHQLRGRVGRGAIASHCVLLYKAPLSHTATQRLSVLRQSNDGFIIAQKD
                     LEIRGPGEVLGTKQTGLAELKIADLVRDQALIPHIQKLANHVMAQAPEKVDAIILRWL
                     GHKQHYVQA"
     gene            complement(385780..386376)
                     /locus_tag="SBAL_RS01760"
                     /old_locus_tag="Sbal_0347"
     CDS             complement(385780..386376)
                     /locus_tag="SBAL_RS01760"
                     /old_locus_tag="Sbal_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011845584.1"
                     /db_xref="GI:500171159"
                     /translation="MKILLAEDQAMVRGALAALLTLAGGFNITQASDGDEALSLLKQQ
                     SFDLLLTDIEMPGRTGLELAAWLKDQHSQTKVVVITTFGRAGYIKRAIEAGVGGFLLK
                     DAPSETLVNAIQQVMAGKRVIDPELAMMAIGDVDPLNDKERRALRLASEGKSTADIAE
                     TLFIAEGTVRNYLSEAIAKLNASNRIDAARIAKQKGWL"
     gene            complement(386376..387455)
                     /locus_tag="SBAL_RS01765"
                     /old_locus_tag="Sbal_0348"
     CDS             complement(386376..387455)
                     /locus_tag="SBAL_RS01765"
                     /old_locus_tag="Sbal_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845585.1"
                     /db_xref="GI:500171160"
                     /translation="MISTHLQLERKLAWVYLINLVFYLIPLAINAYPAWKIALSFAVL
                     IPFIASYFWAYKCNQNSAYRPILMMVAIATAITPINPGSISLFTFAAFFIGFFYPLRT
                     CLLAIAALIGLLFALNEIYDFNSYYFPLYGSGLVLGVGMFGVAERRRHQHKLKEQQST
                     QEISTLAAMVERERIARDLHDIMGHSLSSIALKAELAEKLLAKQEYQLATIQLNELGQ
                     IARESLSQIRHTVSDYKHKVLADSVTQLCKLLREKGISVELTGNIPKLPARMESQLGL
                     IVTELVNNILRHSGASQCIIDFIQQADRLVVEVKDNGPSKPIAEGNGLTGIRERLDSL
                     GGSLSYNLEQGYAFTVSLPLQGATD"
     gene            complement(387540..388244)
                     /locus_tag="SBAL_RS01770"
                     /old_locus_tag="Sbal_0349"
     CDS             complement(387540..388244)
                     /locus_tag="SBAL_RS01770"
                     /old_locus_tag="Sbal_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845586.1"
                     /db_xref="GI:500171161"
                     /translation="MKTLLIVSSLALISSHAFAASPSNANITSIDAASNSMNLAQLQQ
                     LSASTQDYDKAYANYRLAISANVMGQKVLASSALTNAQTALEALDTSQADAESLALLS
                     SVYGMQIALDNSKGATLGMKSAKAIANAEQLEPQNPRVALVKAIAAYNTPAMFGGSMQ
                     NAKTLATTAIERFAQPCDDICWGEAEAYTWRGLAKQELGDSQGASEDWQQAIKVQADY
                     GWAKFLLQQNQQLSAN"
     gene            complement(388459..389403)
                     /locus_tag="SBAL_RS01775"
                     /old_locus_tag="Sbal_0350"
     CDS             complement(388459..389403)
                     /locus_tag="SBAL_RS01775"
                     /old_locus_tag="Sbal_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:calcium antiporter"
                     /protein_id="WP_006079835.1"
                     /db_xref="GI:492987423"
                     /translation="MLITLSIIGGFIILTLGAEALVRGASAIALRLGITPLIIGLTIV
                     AFGTSAPELAVSVKSALAGNSGIALGNVIGSNIANIGLILAITALIRPIQVQSQVVKR
                     DIPLMILASMLFWGLLLDGELSLIDGVVLLSLLVGYLTFSYISSKNSKNEEEIEAGPN
                     NPLLSGLFILVGISMLVGGGILFVNGAVDLAKTFGVSEVIIGLTIVAIGTSMPELVTS
                     VIAALKGQSDIAIGNVVGSNLFNILGILGVTAIVHPVSSLGFQPFDFMVMLALAIVIL
                     PFAWTGLRIGRREGSVLLLTYLGYMGYLINQASAQALV"
     gene            complement(389583..391247)
                     /locus_tag="SBAL_RS01780"
                     /old_locus_tag="Sbal_0351"
     CDS             complement(389583..391247)
                     /locus_tag="SBAL_RS01780"
                     /old_locus_tag="Sbal_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="WP_011845587.1"
                     /db_xref="GI:500171162"
                     /translation="MDTAIKTPIEMLAHWAKTQGDQVYLRQPIKGQFLDFTWAEVQEK
                     VQQLAGALQHLGLERGDKIAVLSKNCAEWFITDLALMHGGYVSVPIYPTANTDTIRYV
                     LQHSGAKAIFLGKLDHWADQEAGVGGELLRLAMPYDTMPAQYQWEQLLKLGYPLVDAP
                     LPTPDQVMTLIYTSGSTGQPKGAIQTFASYGWTCQAVVRDLRTDGNDRLLSYLPLAHI
                     TERVAIEGSSFYSGSVVAFVESLDSFVADVQRAKPTVFFSVPRLWSLFQKNIIDKIGV
                     SKLNLLLKIPLISSLVKHKIHKGLGLNHCRLLGSGSAPIPPSLIHWYHSIGLNICEAW
                     GMTENCAYSIINYPFDARKIGTVGRPVEDCQIRQGEDGELLLKSPGLMTAYYQQPEAT
                     AAAFDADGFFHTGDLCSIDADGCVTITGRVKDNFKTAKGKYVAPVPIERKLAQDPHVE
                     LICVIGSGLPHPVALVQLSEGANLQAREEVRTSLKATLDSVNPHLESHEHVDAIIVVS
                     DPWTIENDVLTPTLKIKRHVLEKAFSERVDGIRGAQVRWEDELTQK"
     gene            complement(391475..391858)
                     /locus_tag="SBAL_RS01785"
                     /old_locus_tag="Sbal_0352"
     CDS             complement(391475..391858)
                     /locus_tag="SBAL_RS01785"
                     /old_locus_tag="Sbal_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease"
                     /protein_id="WP_006079838.1"
                     /db_xref="GI:492987426"
                     /translation="MAEKIIIATENAPAAIGTYSQAVKVGSTVYLSGQIPLVPSTMQI
                     VSDDFEAQVVQVFENLTAVCTAAGGSINDIVKLNIFLIDLSHFAKVNEIMSRYFSQPY
                     PARAAIGVKQLPKDSQVEMDGVMEL"
     gene            complement(391884..393989)
                     /locus_tag="SBAL_RS01790"
                     /old_locus_tag="Sbal_0353"
     CDS             complement(391884..393989)
                     /locus_tag="SBAL_RS01790"
                     /old_locus_tag="Sbal_0353"
                     /EC_number="2.7.6.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase"
                     /protein_id="WP_011845588.1"
                     /db_xref="GI:500171163"
                     /translation="MYLFEGLKESASGYLEPEQVELLKQAYQIARDAHEGQMRTSGEP
                     YITHPVAVAHILADMRLDHETLMAALLHDTIEDTHVTKDDLAELFGVAVAELVEGVSK
                     LDKLKFRDKKEAQAENFRKMMMAMTQDIRVILIKLADRTHNMRTLGALRPDKRRRIAR
                     ETLEIYAPIANRLGIHNIKTELEDLGFQAYYPMRYRVLKEVVKAARGNRKELIQGIEA
                     AVYTRLNDAGIPGKVKGREKNLYSIYNKMQSKELQFQEVMDIYAFRVIVDSIDTCYRV
                     LGAMHGLYKPRPGRFKDYIAIPKANGYQSLHTSLFGPHGVPVEIQIRTEDMDQMADKG
                     VAAHWAYKGGAQTGQGTTTQVRARKWMQSLLELQQSASTSFEFVENVKTELFPEEIYV
                     FTPEGRILELPVNATAVDFAYEVHTDVGNTCVGARVNRQAYPLSQPLISGQTVEIITA
                     KGARPNAAWLNFVVTGKARAKIRQVLKSLKGDDAIALGRRLLNHALGKTKLDSIPPEQ
                     IEKVIRDTKHTTLDSLLADIGLGNAMSIVIAQRLIGDNLENQESRDGHMMPIRGAEGM
                     LVTFANCCRPIPGDAVIAHVSQGKGLVVHMENCANIRGYQGEPDKYIPVQWDNVEGVD
                     YQANLRVEIVNHQGALAKITSIIAAECSNIHNLSTEERDGRVYLINLRISVKDRIHLA
                     NVMRRIRVLPEVLRTSRNR"
     gene            complement(394035..394313)
                     /gene="rpoZ"
                     /locus_tag="SBAL_RS01795"
                     /old_locus_tag="Sbal_0354"
     CDS             complement(394035..394313)
                     /gene="rpoZ"
                     /locus_tag="SBAL_RS01795"
                     /old_locus_tag="Sbal_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HE39.1"
                     /note="Promotes RNA polymerase assembly; latches the N-
                     and C-terminal regions of the beta' subunit thereby
                     facilitating its interaction with the beta and alpha
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_006079841.1"
                     /db_xref="GI:492987429"
                     /translation="MARVTVEDAVEQIGNRFDMILVAARRARQIAVQGKDPMVEEMND
                     KPTVIALREIELGLVNAHTLDADERQTVREREAAEIAAVSAIAEGRSL"
     gene            complement(394363..394995)
                     /locus_tag="SBAL_RS01800"
                     /old_locus_tag="Sbal_0355"
     CDS             complement(394363..394995)
                     /locus_tag="SBAL_RS01800"
                     /old_locus_tag="Sbal_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_006079843.1"
                     /db_xref="GI:492987431"
                     /translation="MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAP
                     RPGEVDGQHYHFVNVEQFKALIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLD
                     IDWQGAEQVKAVMPDAVGVFILPPSKAELERRLTGRGQDSSDVIASRMAQAVSEMSHY
                     KEYDFIIVNDDFDTALADLRAIIRSQRLTCASQIHAQNDMLNDLLAGQLS"
     gene            395248..396894
                     /locus_tag="SBAL_RS01805"
                     /old_locus_tag="Sbal_0356"
     CDS             395248..396894
                     /locus_tag="SBAL_RS01805"
                     /old_locus_tag="Sbal_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845589.1"
                     /db_xref="GI:500171164"
                     /translation="MLLKSLFCLHGRDSRPRFVAISVGVYVCIALAAAAFGANFLMYL
                     LALLGLPLLGLASLRRLADADKSKGLIGVFLLPLFIFIGLLTADVHIALIGLSLVLAA
                     GLTFWGWRFPAPTIVDYRYGYFGPELDAPTSQAMPRRRVEPTIVPKAAAKEIETQDVA
                     ARQAAKSTAHIQAQPQVERHEPHVEQSHAQAISAATASEPEVDLSAHVEPIASEPIVA
                     ESTVAEPIVASTMSAADAELEAQRQDELRFDALTRMTQNPADFVVPDSHADFRPANAS
                     RIEQTNIDLVDVDVANVDLKHVDFNAAQLDPAERSTEPGWRFAAEEDDEPDSFNDRDH
                     AEEVRQRRAEAKDSGSMTELFRGLFEFLAPLKRFFVLPKIKLPKLERRYWRPAGIGCG
                     VVVVLALVWGLWPNGDAETGDGAEVVTVNAIAPYAGERVTLALPDGFSVALEDDILIM
                     RWLGEKGKAQNLWSLATAKGDKTCSLLSFNNGTDYRPVTVDLKADSATEARFTPLDTQ
                     AIIVDLARRGSISLCGYKFSLKGSQAILEQNRTFGDYIAR"
     gene            397099..397971
                     /locus_tag="SBAL_RS01810"
                     /old_locus_tag="Sbal_0357"
     CDS             397099..397971
                     /locus_tag="SBAL_RS01810"
                     /old_locus_tag="Sbal_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845590.1"
                     /db_xref="GI:500171165"
                     /translation="MNTELTLVIMAAGLGSRFGGDKQLAALGPAGEPMLVLSIMSAIR
                     SGFQRAVLVIRPELETELTEILTRFLPADFAYHFCYQALTDLPEAAQLADISHRLKPW
                     GTAHALWSARHLVKGPMAVINADDFYGDSAFASLAKGLSMRPTEWMMVAYPIELTLSE
                     HGGVNRGLCQVENGQLKSVAEWLNIAEQAGELVGDGPQGHASLPPASLVSMTCWGFSP
                     SIFDVIKRELTEFIGQQDQQPKSECYLPAIVQAGIEQGLPVYVDVACEPWLGVTYPQD
                     TVWVKQKLTELLSD"
     gene            397964..399028
                     /locus_tag="SBAL_RS01815"
                     /old_locus_tag="Sbal_0358"
     CDS             397964..399028
                     /locus_tag="SBAL_RS01815"
                     /old_locus_tag="Sbal_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_011845591.1"
                     /db_xref="GI:500171166"
                     /translation="MIKLIRQSVLPHFGIEAAEAKISALGNGHINDTLLVRWPAGELV
                     LQRINTEVFKTPNALVSNADKISHHLCAKSLQQQYGLKVVSPCLTREGELAIDLGEQG
                     FWRAISYLPHSLSIEVVKSEQEAEMAAKAFGHFASALSDFDATQLEDVIPQFHHLPGR
                     MALLQQAAELDSQHRLDLCRHWVDYALSQQALLDELAEISPKLPLRICHNDTKINNML
                     FDKRDMSSMAIIDLDTCMKGHLMYDFGDMVRTFCSPEEEDSTALDKVEVRQDIFAAIC
                     RGYLSELGDVLTEDEKRSLWLGARVICLMIGVRFLTDYLNGDVYFHIHREGHNLDRAA
                     NQFTLYQSLLDQETVLKAHF"
     gene            399211..400626
                     /locus_tag="SBAL_RS01820"
                     /old_locus_tag="Sbal_0359"
     CDS             399211..400626
                     /locus_tag="SBAL_RS01820"
                     /old_locus_tag="Sbal_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011845592.1"
                     /db_xref="GI:500171167"
                     /translation="MDSPVAQPLVTCSRRSERNSWLRCTLRRSQQEAVASSMMTATSD
                     NFFNAYAIFLGASLAQMGFVTGLPQLFGAISQLLSVWLASHFSRRTFIVFCAAFQACV
                     VLAMGALAAFGPEHAVWIFIALAVGYHGFINLIQPHWRAWMGSIVPERRRGTFFAART
                     RLTMGASLSVFFIGGGILTLTDSMQMAWLGFSLLFSIAAMGRFVSAWLLLQMHDPDPR
                     EPKQRGIFLQTIGHFREAWKDKVFRQYSLFVASMQGMVAISAPFFAVYMLEGLKFTYL
                     EFVFASVASIATQFVTLRFWGRFSDQFGNRLVMIITSCMIPSLPLMWLFSDNYLYILA
                     IQAFSGLAWSGFTLSTANYLYDIRPFRSDFATYAALQAALSAACVFVGAILGGTIASH
                     AADFLVWSGWDSVLSSPIFVVFLVSTVLRALVTLWFIPRSVEPKLRPRPQLLQLIFRI
                     RGFNAISGVSLDWLTVVKRRK"
     gene            complement(400639..401556)
                     /locus_tag="SBAL_RS01825"
                     /old_locus_tag="Sbal_0360"
     CDS             complement(400639..401556)
                     /locus_tag="SBAL_RS01825"
                     /old_locus_tag="Sbal_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845593.1"
                     /db_xref="GI:500171168"
                     /translation="MPDNANNSPITTHVQPTGNAKHTGHSQVATPDEMNPEQSSTLSS
                     EQASVEKQKVFIIGLPRTGTTSVSVALLEQGLKVAHMAFTKQAFMLADAISDVPCFSD
                     YRQLDGLFPQAKFVYLDREMAKWVPSMQMLLGKMLPHLEAKSGRFHPIMKRSFRHTFA
                     IDKVADPVDEAHLIACYQRHQNEVLAYFHGREDFITLDISHAGSLSRLLQFLGLTTDC
                     PTLGQVTDRAFSDSQIKSAPSQISQEGTSQAKAAVQPQPVNTSEHGLDFPKLNAGTHV
                     AAWHEYKHPNKVNSNSAGPQSRKFFDYTL"
     gene            402200..403315
                     /locus_tag="SBAL_RS01830"
                     /old_locus_tag="Sbal_0361"
     CDS             402200..403315
                     /locus_tag="SBAL_RS01830"
                     /old_locus_tag="Sbal_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_011845594.1"
                     /db_xref="GI:500171169"
                     /translation="MWIWQQADWPKFHWNTSSIDALLRQVYFNQGQLLGKQMLSHDDS
                     LLTSDAALDTLLANIIHSSAIEGEKLNAASVRSSLAKKLGVTEDKPYPTTAQTDGLAD
                     IMLDALKNLETELTLERILGWHQQLFPQGYTLFNPVIGGTLRGDTPMQVVSGRIDKPT
                     VHFEAPSRATLDAELSQFIEWFNASRQDLGLDPLIRAAITHLWFVTLHPLDDGNGRIT
                     RLLTDLALAQAEKRSIRFYAMSVSILARRQAYYDILESTQRGDVDITPWLVWFFETLN
                     DCLLNAMADVSRTLSKTQYWQSVDQSLLSQEQAKVLNRMLDGDFELGINSSQYQKVAK
                     VSRATATRHLAQMVEQRFLVKADAGGRSTRYLLPSGK"
     gene            403540..406707
                     /locus_tag="SBAL_RS01835"
                     /old_locus_tag="Sbal_0362"
     CDS             403540..406707
                     /locus_tag="SBAL_RS01835"
                     /old_locus_tag="Sbal_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction endonuclease subunit R"
                     /protein_id="WP_011845595.1"
                     /db_xref="GI:500171170"
                     /translation="MEQVGIYEKLITQLVEKRLDKDIFFVGERKLEVAEASIWLSRFL
                     TKVIEYVINSVPADENQVINQISLANRLVMWLKEHINDDDFIDENLIDSQGRILTALF
                     NKQNPIATDLPKYTAAIFPLTGLTQSELFCGSNAGLSLESELKREIRSSDKIYWLVSF
                     IKWAGIRIFKNELEEFTRSGKELRIITTSYMGATDAKAVEFLASLPNTQVKLSYNTKR
                     ERLHAKSYLFLRNTGFHTGYIGSSNLSHSALTSGLEWNLKITTQEIPHIIEKSLSTFE
                     TYWESNEFELFSGDASSKEKLNNALKEAKGSGTESSSFHFDIKPFAHQREILEQLAVE
                     RSVHGRFKNLIVAATGTGKTIISAFDFARFYKLHPDANFLFVAHRQEILQQALSAYRG
                     VLKNNQFGELWVAEHKPNSYKHLFASIQSLNLQLDNLPLAADFYDYIVIDEVHHVAAS
                     SYRGLLAHFEPTILLGLTATPERHDGVDILADFCGVIAAEIRLPEAINQRHLCPFQYF
                     AIDDETDLRKLNWSRGRYDVAELSNLYTHNEQRVTRIIRSLAETVTDIGNIKALAFCV
                     TKEHAEFMAKKFNLDGISADVLTSDNSSERQQKRQSLVSGKLSILCVVDIFNEGVDIP
                     EVDTLLFLRPTESLTIFLQQLGRGLRLTDDKQCCTILDFVGNSRDEYDFSQKFRALVG
                     KTNQSIKDEILNDFPHLPLGCRIELEEKAQSMILRNISRATLNANRLTSLIASYKHQT
                     NLPLTLGNFLRLNPQVTLEDVYRIKINGQCGWTLLVEAIQGNQIAGPTAQSDLAKAYY
                     RAINFHLLSCTSLSYLIFIKQLCQNDFVFNGLDPIQNQFALMCHYNFWDKSGTALNVN
                     SLAASLLMLRNKPLQEELLAVLAILINRIHHQEMDLELALPSALKVHSRYTREQILAA
                     IGASTFTAKSPSREGVLAIHEQNLECLFVTLNKSEKQFSPTTMYHDYAISEHLFHWQS
                     QNSARPERGRGLSYIEQQKLGKTVLLFVREQSKDENGRTMGFVNFGKVHYVSHNGSQP
                     MNVTWRLEQPIPDVMWHDAAKLAVG"
     gene            complement(406711..407607)
                     /locus_tag="SBAL_RS01840"
                     /old_locus_tag="Sbal_0363"
     CDS             complement(406711..407607)
                     /locus_tag="SBAL_RS01840"
                     /old_locus_tag="Sbal_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845596.1"
                     /db_xref="GI:500171171"
                     /translation="MEHFSALPIFVTVVECGSFSLASQKLGLSKSAVSKRITLLEQSL
                     GIQLLHRTTRSLSLTEAGARYFDYVRPAVKLAADGLDAISELQQAPQGSLRIAVPMVF
                     GRLYIAPLIPEFLRRYPKIQLQMQMDDKTTDLIAGGFDLAIRIGELPDSSLIARKIAP
                     CLSVICASPEYLARHTVPHTPQQLSQHNCLFYSYFRDGVEWTFLSPQGPTRIQPNGNY
                     QVNNSDAIHQATLDGLGIANLPHFMVEADLQTGRLQALLTDHPLPEHGIYAVYPQRKY
                     LPTKVSVLIEFLMEKLAERLGK"
     gene            407847..408584
                     /locus_tag="SBAL_RS01845"
                     /old_locus_tag="Sbal_0364"
     CDS             407847..408584
                     /locus_tag="SBAL_RS01845"
                     /old_locus_tag="Sbal_0364"
                     /EC_number="3.1.3.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982212.1"
                     /note="manganese-dependent 5'-nucleotidase; specific for
                     5'-UMP, 5'-dUMP, and 5'-dTMP; member of haloacid
                     dehalogenase (HAD)-like hydrolase superfamily; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dUMP phosphatase"
                     /protein_id="WP_011845597.1"
                     /db_xref="GI:500171172"
                     /translation="MPLNGMGMGFSYFVRKRVPMSLPYQWILFDADETLFYFDALKGL
                     KLMFSEFGVDFTQADFDEYQLVNKPLWVDYQDGKITAAELQTIRFEPWAAKLAVTAMT
                     LNSAFLSAMAEICSPLPGARELLAALQGKAKLGIITNGFTELQTVRLERTGLQHHFDI
                     LVISEKVGIAKPDVGIFEHAFELMGYPERETVLMVGDNPHSDIQGGINAGIHTCWYNV
                     HGHDVPAGITPHYQVSSHQELHSLLFG"
     gene            complement(408619..409257)
                     /locus_tag="SBAL_RS01850"
                     /old_locus_tag="Sbal_0365"
     CDS             complement(408619..409257)
                     /locus_tag="SBAL_RS01850"
                     /old_locus_tag="Sbal_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug MFS transporter"
                     /protein_id="WP_011845598.1"
                     /db_xref="GI:500171173"
                     /translation="MAAAKIPLFYDDREHAEKIIYELSLHEDLSLIKKRLKLGDYQLK
                     DWIIERKTLPDLVQSLCDGRLFSQVARLAQSPNHTALLIEGCTQDIACYQIRREALIG
                     ALCSITINFYIPILRSLSQAETAKILYFCANQLNRREHELTLTGRKPKRTKNQQLFIL
                     QSLPEVGPKLANKLLCHFASVEAVVTASEEALMQVGGIGKNKASKIREVLTR"
     gene            409439..410572
                     /locus_tag="SBAL_RS01855"
                     /old_locus_tag="Sbal_0366"
     CDS             409439..410572
                     /locus_tag="SBAL_RS01855"
                     /old_locus_tag="Sbal_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845599.1"
                     /db_xref="GI:500171174"
                     /translation="MSEYQYYRFECVNSSLSVPQRNRLRNISSRAEITSHSFCVQYHY
                     GDLSADPEALMMVFFDIGFYYTNWGQVNAYLKLPAGTIPSDFKAINADFYVSFVENKQ
                     NQLLIFTLEDDYRYRDDESAESFMLHLVALRTELLTGDYRALYFHWLSQANDDMALEP
                     LPLIAFDFQQLTQAQLAFTTLFDIPLPSIRALHLLLQSMPAHVPQTTVLTAQQQVAKL
                     TDAEKDALLCRLFDEGKIFAADAYALLRTQETPIEYSHWVTVASLHPFWHVAEKEVMQ
                     EDRMAEAERLARETLLRNEHLEAVYKAHQSHWDSAFEEAARGCASGYDNASRTLQVLF
                     DAYQLKQSSSEFKQNFDVFISKNKQRKALIKRLEPLQKIMLSL"
     gene            410962..411243
                     /locus_tag="SBAL_RS01860"
                     /old_locus_tag="Sbal_0367"
     CDS             410962..411243
                     /locus_tag="SBAL_RS01860"
                     /old_locus_tag="Sbal_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011845600.1"
                     /db_xref="GI:500171175"
                     /translation="MKVTNAKQLSTYLKDARLNAHLTQSKVASKVGIRQDTVSSFELN
                     PDSTKLETLFKIFSALNLELDIKVRNPQLVDERRHDDATVPEQEWREEW"
     gene            complement(411479..412342)
                     /locus_tag="SBAL_RS01865"
                     /old_locus_tag="Sbal_0369"
     CDS             complement(411479..412342)
                     /locus_tag="SBAL_RS01865"
                     /old_locus_tag="Sbal_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011494780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079861.1"
                     /db_xref="GI:492987450"
                     /translation="MIQSMTAYARIEHKAQWGTASWEIRSVNQRYLETYLRLPEQFRS
                     FEPVLRDRLRKRLSRGKVEVNLRYELADNSNNELQLNQALAKQLLGAANWLKQEAGQG
                     DVNLTDILRWPGVLASGEQDMDAIGADLMTAFDSAIDQFIEARGREGEAIKDMLLSRL
                     DGVSEQIAVVREHMPTVMLYQREKLTNRLAEIKGELDPARIEQEMVLLAQKQDVAEEM
                     DRLEAHVAEARRILKKGGSEGRRLDFMMQEFNRESNTLASKSISTEITSAAVELKVLI
                     EQMREQIQNVE"
     gene            412880..413593
                     /gene="rph"
                     /locus_tag="SBAL_RS01870"
                     /old_locus_tag="Sbal_0370"
     CDS             412880..413593
                     /gene="rph"
                     /locus_tag="SBAL_RS01870"
                     /old_locus_tag="Sbal_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q07WF3.1"
                     /note="RNase PH; tRNA nucleotidyltransferase; forms
                     hexamers in Bacillus subtilis; phosphoroltic 3'-5'
                     exoribonuclease; involved in maturation of tRNA precursors
                     and removes terminal nucleotides near CCA acceptor arms of
                     mature tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="WP_006079862.1"
                     /db_xref="GI:492987451"
                     /translation="MRPSNRTPAQTRPITITRQFTAHAEGSVLVEFGETKVLCTASFT
                     EGVPRFLKGQGQGWVTAEYGMLPRSTHSRMDREAARGKQSGRTQEIQRLIGRALRACV
                     DMKALGENTIVIDCDVIQADGGTRTASITGACVALVDALNWARGKGIIKSNPLKFLIA
                     AVSVGIYKGEAISDLEYIEDSAAETDMNVVMTETGKIIEIQGTAEGEPFSHEELLELL
                     ALAKNSIREIVDVQKAALN"
     gene            413770..414411
                     /gene="pyrE"
                     /locus_tag="SBAL_RS01875"
                     /old_locus_tag="Sbal_0371"
     CDS             413770..414411
                     /gene="pyrE"
                     /locus_tag="SBAL_RS01875"
                     /old_locus_tag="Sbal_0371"
                     /EC_number="2.4.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011624899.1"
                     /note="involved in fifth step of pyrimidine biosynthesis;
                     converts orotidine 5'-phosphate and diphosphate to orotate
                     and 5-phospho-alpha-D-ribose 1-diphosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="WP_011845601.1"
                     /db_xref="GI:500171176"
                     /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRISPYFFNAGLFNTGR
                     DLARLGRFYAAALVDSGIDFDLLFGPAYKGIPIATTTAVALCEHHDIDIPYCFNRKEK
                     KDHGEGGSLVGSELKGRVMLVDDVITAGTAIRESMEIIEAHKAQLAGVLIALDRQEKG
                     KGELSAIQEVERDFGCGIVAIIKLADLISYLSEKPGMEVQLAAVSQYREQYGI"
     gene            complement(414589..415239)
                     /gene="folE"
                     /locus_tag="SBAL_RS01880"
                     /old_locus_tag="Sbal_0372"
     CDS             complement(414589..415239)
                     /gene="folE"
                     /locus_tag="SBAL_RS01880"
                     /old_locus_tag="Sbal_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZJ1.1"
                     /note="involved in the first step of tetrahydrofolate
                     biosynthesis; catalyzes the formation of formate and
                     2-amino-4-hydroxy-6-(erythro-1,2,
                     3-trihydroxypropyl)dihydropteridine triphosphate from GTP
                     and water; forms a homopolymer; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase 1"
                     /protein_id="WP_006079864.1"
                     /db_xref="GI:492987453"
                     /translation="MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEI
                     LTLMSLDLSDDSLADTPRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDI
                     SLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVAL
                     QTLLETKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK"
     gene            complement(415510..417498)
                     /locus_tag="SBAL_RS01885"
                     /old_locus_tag="Sbal_0373"
     CDS             complement(415510..417498)
                     /locus_tag="SBAL_RS01885"
                     /old_locus_tag="Sbal_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="WP_011845602.1"
                     /db_xref="GI:500171177"
                     /translation="MKPFQLATLVTLCLPMLPLNTFAADTTASNTVLLAQQFSKGDEY
                     SNVKISPTGKYLSAITSVEGKNVLLVLDTQTKKLLNAIRFPSNAQVGDYEWANSERLV
                     LAKEYLKGWRDVPQYYGELLAINADGSRKAYLFGFESGEQQTGSNIKKNTAINATAFI
                     LDPLPDDERYMLVNAIPWNDRINLDFELSQDVYRVDLFTGVRKRITGSPIGQARFMTD
                     HQGEVRFVAGEDNKNITKVFYRKDGNWVNTDKLNLGLADFKPLSFTDDKNTIYAAGRS
                     QGETLGVYKINLETGDKTEIIQDENVDPSNFWINGTNKQLYAVEFENGYPSYAFVDNE
                     DSHAKLLKDLLGALPGHQVRIVSETRDAEKLVVVAFNDRNPGDYYIFDTKKLKLEYLA
                     AAKKWLDPEQMAEVKPISFTSRDGKQLHGYLTLPFGKEAKNLPLVVNPHGGPHGIRDW
                     WGFDPQNQYLASQGIAVLQVNFRGSGGYGDQFERAGYQKWGSEIQYDIIDGTQYVIDQ
                     GFADKERICIVGGSFGGYSALQSAVLAPDMFKCAIGVAGVYDLELMFDEGDVASRRSG
                     TSYLKDVLGQDKAVLKAMSPSENVDKLKANILLVHGGEDERAPIEQLESLEKGLKAHN
                     YPYQKLVMDNEGHGFYNDEHRAKYYEQMLSFLKTNLKL"
     gene            complement(417634..418227)
                     /locus_tag="SBAL_RS01890"
                     /old_locus_tag="Sbal_0374"
     CDS             complement(417634..418227)
                     /locus_tag="SBAL_RS01890"
                     /old_locus_tag="Sbal_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q12SF8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion factor SlmA"
                     /protein_id="WP_006079866.1"
                     /db_xref="GI:492987455"
                     /translation="MAVSPKINRREHILQCLAQMLETNPGQRITTAKLASEVGVSEAA
                     LYRHFPSKARMFEGLIEFIEESLLSRINLIMDDEKDTMKRCQLVLQLLLIFAERNPGI
                     SRVLNGDALLGENERLRSRISNLFAKIETQLKQILREKTLREGKGFNLDEAILANLLL
                     AFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS"
     gene            complement(418262..418720)
                     /locus_tag="SBAL_RS01895"
                     /old_locus_tag="Sbal_0375"
     CDS             complement(418262..418720)
                     /locus_tag="SBAL_RS01895"
                     /old_locus_tag="Sbal_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HZU5.1"
                     /note="catalyzes the formation of dUMP from dUTP; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_006079867.1"
                     /db_xref="GI:492987456"
                     /translation="MKTPIELKILDSRIGSEFPLPAYATPGSAGMDLRAMIDTTLTIA
                     PGETVLIPTGIAIHVADQGLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCW
                     NRSDSPFALEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK"
     gene            complement(418717..419937)
                     /locus_tag="SBAL_RS01900"
                     /old_locus_tag="Sbal_0376"
     CDS             complement(418717..419937)
                     /locus_tag="SBAL_RS01900"
                     /old_locus_tag="Sbal_0376"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="WP_011845603.1"
                     /db_xref="GI:500171178"
                     /translation="MMSVSLTNKNVLLGIGGGIAAYKSADLVRRLKERGFDVRVVMSQ
                     SAMEFITPLTLQALSGHPVASSLLDPAAEAAMGHIELARWADLVIIAPATANLLARIN
                     AGMADELITTTCLATEAPIALCPAMNQQMYRNLATQANLTSLASRGFTLWGPASGSQA
                     CGEVGPGRMLEPLEIAELASNFFATKEVSALPLAGQSLLITAGPTREAIDPVRYISNH
                     SSGKMGFALAKAAADMGATVTLVSGPVNLSTPEGVIRIDVESAQNMLDAVMDNVDKKD
                     IFIGCAAVADYRISDIATCKIKKSAEEMQLALVRNPDILATVASLPNRPFVVGFAAET
                     HDVEAYARDKLKRKNLNMIAANDVSVAGLGFNADANALRVFWPHGSQDLPATDKLTLA
                     RQLLSLIVKEKTNT"
     gene            420060..420737
                     /locus_tag="SBAL_RS01905"
                     /old_locus_tag="Sbal_0377"
     CDS             420060..420737
                     /locus_tag="SBAL_RS01905"
                     /old_locus_tag="Sbal_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZJ6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079869.1"
                     /db_xref="GI:492987458"
                     /translation="MGIKDWPEGEGPRDKLLQKGAGQLSDAELLAVLLRNGLAGLNAV
                     DLARSLISEFGGLRNLLCAPRNQVCRLPGVGPVKYAQLQAAAELARRVAQENLQRGQV
                     LTNPDLTRDYLMRQLADRSYEVFAVLLLDSQHRVIQFVELFRGTIDSASVYPREVVSL
                     VLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMVVGDREIVSF
                     AERGWIN"
     gene            420859..421095
                     /gene="rpmB"
                     /locus_tag="SBAL_RS01910"
                     /old_locus_tag="Sbal_0378"
     CDS             420859..421095
                     /gene="rpmB"
                     /locus_tag="SBAL_RS01910"
                     /old_locus_tag="Sbal_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013053320.1"
                     /note="required for 70S ribosome assembly; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_006079870.1"
                     /db_xref="GI:492987459"
                     /translation="MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEK
                     RFVQLRVSTKGIRLIDKKGIEVVVAELRARGEKV"
     gene            421102..421275
                     /gene="rpmG"
                     /locus_tag="SBAL_RS01915"
                     /old_locus_tag="Sbal_0379"
     CDS             421102..421275
                     /gene="rpmG"
                     /locus_tag="SBAL_RS01915"
                     /old_locus_tag="Sbal_0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013053319.1"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group lack the CXXC motif; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_006079871.1"
                     /db_xref="GI:492987460"
                     /translation="MAKAKGNREKIKLVSTAKTGHFYTTEKNKRNMPEKMEIKKFDPV
                     IRQHVIYKEAKIK"
     gene            421599..422918
                     /locus_tag="SBAL_RS01920"
                     /old_locus_tag="Sbal_0380"
     CDS             421599..422918
                     /locus_tag="SBAL_RS01920"
                     /old_locus_tag="Sbal_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651285.1"
                     /note="catalyzes the formation of N-acetyl-L-glutamate
                     from L-glutamate and acetyl-CoA in arginine biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="WP_006079872.1"
                     /db_xref="GI:492987461"
                     /translation="MRTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNHFRAILN
                     DVALLHSLGIKVVLVYGARPQIDAALAVNGIEPAYHEGVRITDEDSLKVIKQVAGALQ
                     FDITARLSMSLSNTPMQGAQINLVSGNFVIAQPLGVDNGIDFCLSGRVRRIDVQGLKR
                     QLDNHCIVLMGPIAASVTGESFNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNGDV
                     IAELMPNDAQNIMSKLAEQGSACVGTMAFLKASIDACRNGVPRCHLVSYLEDGALLQE
                     LFSREGIGTQIVTESAERLRCASIADIGGVLNLIRPLEEQGILVRRSREQLEIEIEQF
                     MLIERDGLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSLLLKNIINQARNRGYS
                     RLFALTTRSIHWFLEHGFVIEDVEALPQKKKQLYNYQRRSKILALDL"
     gene            423038..423577
                     /locus_tag="SBAL_RS01925"
                     /old_locus_tag="Sbal_0381"
     CDS             423038..423577
                     /locus_tag="SBAL_RS01925"
                     /old_locus_tag="Sbal_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845604.1"
                     /db_xref="GI:500171179"
                     /translation="MSPQYFELAPFTQTSIFSFIVLLLGLAGILLMLWLKNMPKIAKS
                     ASLGILLVMMGGFSWVFYQSNSAELVLTDTELTVDVPFYKVQLSRADLLPAEARIVDL
                     QQEADLTPSFKTNGIGMPGFQLGWFNLQGKGRAFLAITDKSQLVLVLVPTVKGYSLLL
                     TVPQGSEFLAQLQKSSSLL"
     gene            complement(423602..424486)
                     /locus_tag="SBAL_RS01930"
                     /old_locus_tag="Sbal_0382"
     CDS             complement(423602..424486)
                     /locus_tag="SBAL_RS01930"
                     /old_locus_tag="Sbal_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_006079874.1"
                     /db_xref="GI:492987463"
                     /translation="MQDLEYRKGILLAVSAYCMWGFAPLYFKLLNHVSATEILLHRVI
                     WSFVFMLIIMQFIGGFSRLRLLFKQPKQLMVLTITSILIAGNWLLFIWAVNNDHMLDA
                     SLGYFINPLLNVLLGMLFLGERLRKLQWFAVALASAGVLIQLISFGSIPIVSLALAGT
                     FGFYALLRKKVNVDAKAGLLVETAVLLPVALIYLVATLDTATASMLTNDWQLNLMLMA
                     AGIVTTIPLLCFAGAAVRIPLSMLGFFQYIGPSIMFILAVSLFNEPFDAEKGVTFGFI
                     WSALLVFTLDMAYKRKAA"
     gene            complement(424688..425152)
                     /locus_tag="SBAL_RS01935"
                     /old_locus_tag="Sbal_0383"
     CDS             complement(424688..425152)
                     /locus_tag="SBAL_RS01935"
                     /old_locus_tag="Sbal_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079875.1"
                     /db_xref="GI:492987464"
                     /translation="MTSPIQAEALRRVAAVFDQHVPFHNLLGLDIKRYDIDGVEVVIN
                     MKPELIGNIHQQILHGGVTATVLDVVGGLTAFAGLVASRDDWTVEELQQRLQTLGTID
                     MRVDYLRPGRGLTFTGTGSVIRAGNRVSVCRMELHNEQGTHIAFGTGTYMVG"
     gene            425592..427415
                     /locus_tag="SBAL_RS01940"
                     /old_locus_tag="Sbal_0384"
     CDS             425592..427415
                     /locus_tag="SBAL_RS01940"
                     /old_locus_tag="Sbal_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086682.1"
                     /note="functions in blocking illegitimate recombination,
                     enhancing topoisomerase activity, initiating SOS signaling
                     and clearing blocked replication forks; component of the
                     RecF recombinational pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="WP_011845605.1"
                     /db_xref="GI:500171180"
                     /translation="MEKFVLDTHDDPLSQRLAQVFGYRDFRDGQREVIERVCGGQDCL
                     VIMPTGGGKSLCYQLPALLMDGITIVVSPLISLMKDQVDSLLQTGVAAAYLNSSLPRE
                     QSAEVLRQLRHGELKLLYVSPERLLSADFIERMQSLQLAMFAIDEAHCISQWGHDFRP
                     EYAALGQLKQLFPYVPMMALTATADQATRQSICERLGIDPFRLLSSFDRPNIRYTVAE
                     KLNAANQLRHFLTQQNGTNGIIYCSSRRRVDEVADRLCLQGFNAKAYHAGMTQEDRGA
                     VQDSFLKDQIDIVVATVAFGMGINKSNVRFVVHYDIPKSIEAYYQETGRAGRDGLDAE
                     AFMLFDPADIGRVRHLIEQSEPGPQQQVEFHKLNTMAAFAEAQTCRRQVLLHYFDESA
                     LEPCGNCDICLDPPKRYNGTEDAQKVLSCIFRLGQRFGINHLIEVLRGSKGAPIVDRG
                     HDKLTTWGIGKDKSHEYWLSVIRQLIHLGLASQDVTRGSSITLNPSARPVLKGEVALM
                     LAEPRIQLTTTKRKVSQSKAPLNYDRKLFARLKLLRRTIAEQQDVPPYLVFNDATLAE
                     MAAMMPTSAGEMLAVNGVGERKLSRFGDAFLDEIAAYLAGE"
     gene            complement(427397..429178)
                     /locus_tag="SBAL_RS01945"
                     /old_locus_tag="Sbal_0385"
     CDS             complement(427397..429178)
                     /locus_tag="SBAL_RS01945"
                     /old_locus_tag="Sbal_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012586600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_011845606.1"
                     /db_xref="GI:500171181"
                     /translation="MDFRVLVLSLLLWLIPFGASAIDQLDELTELVYQYPSKALTQIT
                     ALEKQFTTRATSDINRLRLSVLKCQNLLQLGENEAAINVAQLGEANAKQLKLDQVRPY
                     FLICQADANLNYNNIQNALPLLDSAITLARRYQQPQALVDALRLRGQLDTDTDNFSSA
                     IEDLRLAIDIYPDIHTQTQNWVWPPQAYIYAAMGYLLYATHDFPQAMYYTNLGIQSSD
                     AKGKVLHIILRNAARIALDNQEFDYSDKLEKQAKALLPELGSPLELAYSYAILASIAL
                     DKGRIDTAEEYLSIAINTFKKHNQQLAMMRSTRLLAQIRFAQHQDDAALILMNHAIEQ
                     AENLKQYSDLKGFYGIMSDHYLEQGDFKQAYSFLLKRYRAAELANQGMNTARILQFKA
                     RLNQQDLQQDQNSTAPEKASILQELNLDWAYSTLFLIAMTLLGGAIWYLIDKQNNRAP
                     RIEGEEPAETLLQQVTSALNIAKQGNYPLSLLLFNASQIRQVDLPPLQDELQHRLREQ
                     DKLIRYSMDEIVIILPHTSAAGAKKVVNQLVACIQPWQGSSKVNIGIAAMQQFDTLES
                     LIKRASINQLGKVKISENNPNHYSPAK"
     gene            429686..431254
                     /locus_tag="SBAL_RS01950"
                     /old_locus_tag="Sbal_0386"
     CDS             429686..431254
                     /locus_tag="SBAL_RS01950"
                     /old_locus_tag="Sbal_0386"
                     /EC_number="2.3.3.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8E9N2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_011845607.1"
                     /db_xref="GI:500171182"
                     /translation="MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVME
                     VGFPVSSPGDFESVQTIARTIKNSRVCALSRALEKDIDAAAQALSVADQFRIHTFIST
                     STIHVESKLKRSFDQVLEMAVSAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEAAIL
                     AGARTINIPDTVGYTVPSEFGTIIQTLFNRVPNIDQAVISVHCHDDLGLSVANSITAV
                     QHGARQIECTINGIGERAGNCSLEEIAMILATRKGMLGLETGINAKEIHRTSNLVSQL
                     CNMPVQANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESIGLNRNNLNMTSRSGR
                     HVIKHRMEEMGYSEHDYNMDALYEEFLKLADKKGQVFDYDLEALAFMEAQAEEDNHYQ
                     LQQLVVQSDSTEGVATATVRIEVGGEIKTEAATGNGPVDAAYNAIARATDRRIDIISY
                     KLGAKGVGQNALGQVDITAVYHEQNFHGVGLATDVVEASARALVHVMNLTCRADKVAD
                     YKQSMQKNRELGGV"
     gene            431325..432419
                     /locus_tag="SBAL_RS01955"
                     /old_locus_tag="Sbal_0387"
     CDS             431325..432419
                     /locus_tag="SBAL_RS01955"
                     /old_locus_tag="Sbal_0387"
                     /EC_number="1.1.1.85"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_011845608.1"
                     /db_xref="GI:500171183"
                     /translation="MSYQVAVLAGDGIGPEVMAEARKVLREVEARFDLNIEYTQYDVG
                     GIAIDNHGCPLPDATLKGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFEL
                     FCNLRPAKLHDGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGENEEAF
                     DTMRYSRREISRIARIAFEAARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVE
                     LEHIYIDNATMQLLRRPDEFDVMLCSNLFGDILSDEIAMLTGSMGLLSSASMNSSGFG
                     LFEPAGGSAPDIAGKGVANPVAQILSAALMLRHSLKQEEAASAIERAVSKALNSGYLT
                     GELLSSDKRSEAKSTAEMGDFIANAIKEGV"
     gene            432419..433825
                     /locus_tag="SBAL_RS01960"
                     /old_locus_tag="Sbal_0388"
     CDS             432419..433825
                     /locus_tag="SBAL_RS01960"
                     /old_locus_tag="Sbal_0388"
                     /EC_number="4.2.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079880.1"
                     /note="dehydratase component, catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_011845609.1"
                     /db_xref="GI:500171184"
                     /translation="MTNAKTLYQKVWDAHIVASPEGEAPVIYVDRHLVHEVTSPQAFS
                     GLKVAGRKLRAPEKTFATMDHNTSTRSASLDALSPMARTQVETLAQNCKDFGVRLYDI
                     HHPNQGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTL
                     RQLKAKTMKIEVRGHVTDGVTAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSMEGR
                     MTVCNMAIEMGAKAGMVAPDQTTFDYLAGREFAPKDEDWAEAVAYWKAIKTDDGAVFD
                     AVVELDAADIAPQLTWGTNPGQVVAIDGKVPDPLNEANPSTRASMEKALEYIGLSAGT
                     QMTDISINKVFIGSCTNSRIEDLRSAAVHAKGRKVASGVTAIVVPGSGQVKAQAEAEG
                     LDKIFIEAGFEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPA
                     MAAAAAVAGHFVDIRKPY"
     gene            433853..434458
                     /gene="leuD"
                     /locus_tag="SBAL_RS01965"
                     /old_locus_tag="Sbal_0389"
     CDS             433853..434458
                     /gene="leuD"
                     /locus_tag="SBAL_RS01965"
                     /old_locus_tag="Sbal_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WIB8.1"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis; forms a heterodimer of LeuC/D; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_011845610.1"
                     /db_xref="GI:500171185"
                     /translation="MQPFTTHTGLAVMIDSTNIDTDQIIPKQFLSKVTRDGFGVHLFH
                     DWRYLDDAGDQPNPEFSLNQSRYRGASILLAQENFGCGSSREHAPWALADFGLRAIIA
                     QSFADIFYGNSINNGLLPVALTHAQVRQLMDEVAAEAGAQITVDLTSCKVVSPSGAEF
                     SFTLAESARHKLLNGLDAIGLTLSHAAQIGQYETQIQGWRR"
     gene            434992..436341
                     /locus_tag="SBAL_RS01970"
                     /old_locus_tag="Sbal_0390"
     CDS             434992..436341
                     /locus_tag="SBAL_RS01970"
                     /old_locus_tag="Sbal_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011787772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic hydrocarbon degradation protein"
                     /protein_id="WP_011845611.1"
                     /db_xref="GI:500171186"
                     /translation="MQKRLLTLAVTAALLSSTTQLHAAGFQLAEYSATGLGRAFAGEA
                     AMADNASAQARNPAMLTYLEGRQLSTGGIYVMPNVDVTGDVSISSPLLGPDPVVMKGG
                     DALDVADDALVPNFYYSNQLNDQWTWGLAVNSNYGLATELPATHAAAIFGNKTSVTTV
                     EFNPNIAYRINDAVSVGAGVRIVYGEGEIGASLPGWVDGIKPALPAPVQAVLPPGGTE
                     LKSMKGDDVGYGWQLGASWQINPAHRLGFAYHSGVQLDLDGHASGVLYTGGQDVSIEG
                     YLPLELPAFAEIASHHQLTDNWAMHASVNWTDWSVFDQLVAYFPGDVKPKGDLESDLV
                     KEEHFEDNWRFALGTTYQVNNDWLVRAGVALDKTAANDEWRTTTIPDSDRLWFSVGAG
                     YQATKNLNVDFAVTYIKATGDAPINEQQNLLGLAAVNFNGEASGDVWLAGIQMSYKM"
     gene            436535..438019
                     /gene="glpK"
                     /locus_tag="SBAL_RS01975"
                     /old_locus_tag="Sbal_0391"
     CDS             436535..438019
                     /gene="glpK"
                     /locus_tag="SBAL_RS01975"
                     /old_locus_tag="Sbal_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8E4K9.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_011845612.1"
                     /db_xref="GI:500171187"
                     /translation="MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGW
                     VEHDPMEIWASQSSVLVEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIV
                     WQCRRSSEICEQLKAQGLEEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGEL
                     LFGTIDTWLVWKLTEGKVHVTDPTNAARTLLFNIHSLTWDNKLLEALDIPLSLLPEVK
                     PSCSVYGTTRIAGEGSEIQVAGMAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGT
                     KAVRSNHGLLTTVAVGPKGEVNYALEGSVFMGGATIQWLRDELGLIRDASDTEYFASK
                     VADTNGVYLVPAFVGLGAPYWDPNARGALFGLTRGANRNHIIRAALESIAYQSKDLLD
                     AMTKDSGVSLKRLKVDGGAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAV
                     GFWESVIELEHKACIDKHFIPNIDAETRVRLYAGWQDAVARTRA"
     gene            complement(438191..438520)
                     /locus_tag="SBAL_RS01980"
                     /old_locus_tag="Sbal_0392"
     CDS             complement(438191..438520)
                     /locus_tag="SBAL_RS01980"
                     /old_locus_tag="Sbal_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845613.1"
                     /db_xref="GI:500171188"
                     /translation="MSGLDSIYAMLAQPVKAVLHPKRVVDKVSSATANAPDSHETPQS
                     QLPPTLEGRDAKVRERRKDADNNKNKKRRASDEPEELKEGVVLEVTDDTAEIKKPPSQ
                     HIIDVEV"
     gene            439258..439716
                     /locus_tag="SBAL_RS01985"
                     /old_locus_tag="Sbal_0393"
     CDS             439258..439716
                     /locus_tag="SBAL_RS01985"
                     /old_locus_tag="Sbal_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4Y2M7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator MraZ"
                     /protein_id="WP_011845614.1"
                     /db_xref="GI:500171189"
                     /translation="MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSAC
                     LLLYPIHEWELIEAKLLKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYA
                     NLDKRIMLVGQLNKFELWDEQSWLQQIDECLETIRSEELASNERLADFSL"
     gene            439748..440689
                     /locus_tag="SBAL_RS01990"
                     /old_locus_tag="Sbal_0394"
     CDS             439748..440689
                     /locus_tag="SBAL_RS01990"
                     /old_locus_tag="Sbal_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HZS4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase H"
                     /protein_id="WP_006079886.1"
                     /db_xref="GI:492987475"
                     /translation="MSQEFAHLSVLLAETVGGLNIKDDGIYIDGTFGRGGHSRQVLQQ
                     LGENGRLIAIDRDPQAIEAAKQFADDPRFQIVHGGFGQLADYVEELGLVGKIDGVLLD
                     LGVSSPQLDDAERGFSFMRDGPLDMRMDNSQGQTAAQWLARAEIEDMAWVFKTYGEEK
                     NARHIARCIAADRDKTPFLRTKDLADLIARITKSKERNKHPATRVFQAIRIYINSELD
                     QIDQALEGAVNVLAPQGRLSVISFHSLEDRIVKRFIRRHSQGESVPHGFPVTEDQINK
                     SRKLRAVGKAIMPSDEEIERNARARSSVLRIAERLDY"
     gene            440700..441014
                     /locus_tag="SBAL_RS01995"
                     /old_locus_tag="Sbal_0395"
     CDS             440700..441014
                     /locus_tag="SBAL_RS01995"
                     /old_locus_tag="Sbal_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011624922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="WP_006079887.1"
                     /db_xref="GI:492987476"
                     /translation="MSKPSINLPRIVLHDLWLHKWILLLALLVLCNAVAVVYGSHISR
                     QLTTQWDQLLQERDRLDIEWRNLLLEEQSQTEHSRITRIASKELNMSRPLPSEEVVVK
                     VP"
     gene            441028..442782
                     /locus_tag="SBAL_RS02000"
                     /old_locus_tag="Sbal_0396"
     CDS             441028..442782
                     /locus_tag="SBAL_RS02000"
                     /old_locus_tag="Sbal_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011982223.1"
                     /note="penicillin-binding protein 3; transpeptidase
                     involved in septal peptidoglycan synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsI"
                     /protein_id="WP_006079888.1"
                     /db_xref="GI:492987477"
                     /translation="MTRQAKIKRVSKPQKPQLIHWRLYVVVGFVCTLFCSLVGRAAYI
                     QIIEPDKLRHESDMRTLRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNG
                     FADMRRWQALADVLHEPVEDILDRVRSNPTKRFTYLKRQITPAVADYITQLKLPGVFL
                     KSESRRYYPGGEITAQLIGITNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVE
                     RLDIIQEGESPNDLVLSIDQRIQQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMV
                     NTPSYNPNARDNLQTFRMRNRAMTDTFEPGSTIKPFVVAAALEAGTVKSTDIIATSPG
                     WMRLGGRQVRDPANYGDMSLARILAKSSNVGISKLALSIPVQQLLGTYQSMGLGSFSG
                     INLTGESAGVIQDRHRWSDFERATLSFGYGLTATTLQLARMYATLGNGGTLFPVSIMK
                     LKKPPVGERVISEDVAHDVMQMLVGVTEKGGTGTLAHIDGYPVAGKSGTSRKAVAGGY
                     GDDYVALFAGVAPANNPKLAIVVVVNEPKGDLYYGGSVAGPAFAKVMSGALQMLNVEP
                     ITDKEQVQLAGIAAGRAE"
     gene            442779..444278
                     /gene="murE"
                     /locus_tag="SBAL_RS02005"
                     /old_locus_tag="Sbal_0397"
     CDS             442779..444278
                     /gene="murE"
                     /locus_tag="SBAL_RS02005"
                     /old_locus_tag="Sbal_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079889.1"
                     /note="involved in cell wall formation; peptidoglycan
                     synthesis; cytoplasmic enzyme; catalyzes the addition of
                     meso-diaminopimelic acid to the nucleotide precursor
                     UDP-N-aceylmuramoyl-l-alanyl-d-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramyl peptide synthase"
                     /protein_id="WP_011845615.1"
                     /db_xref="GI:500171190"
                     /translation="MMLLRDLLAPWLHYAGAQSFNDLTLDSRAIRRGDVFLALPGHKV
                     DGRQFIEKVLDLGAAAVLVHTDDADQHGKVLHSDNAEHGVQIYFFQLSRQVSAIAAQR
                     YPLAHQSATTSLGVIGITGTNGKTSTSQLIAQLITSLGRKAAVMGTLGNGLWGELVDS
                     GNTTADAITLMRQLHDFEAQGASVCAMEVSSHGLVQGRVDAVSFDVAVFTNLTRDHLD
                     YHGDMESYAAAKQSLFRFSTLGHGLLNLDDAVGASWLTELKSVPAQMWGFSIEGHQAA
                     AFYTKNAKFDDQGVSATLVWPEGETEIHSPLLGAFNLSNLLAALSALYLQGFDMKALA
                     EQVQYLTPVAGRMERFTTANNITLVVDYAHTPDAIEQALNALRRHCAGDLWCVFGCGG
                     DRDKGKRPLMGKAAEQYADRIMVTSDNARSEDPAQIITDIIQGLTHPQQALTQVDRIA
                     AIKEVVALAKPGDVILLAGKGHETYQEAAGVRHDYDERALARQLSEQSR"
     gene            444275..445657
                     /locus_tag="SBAL_RS02010"
                     /old_locus_tag="Sbal_0398"
     CDS             444275..445657
                     /locus_tag="SBAL_RS02010"
                     /old_locus_tag="Sbal_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
                     6-diaminopimelate--D-alanyl-D-alanine ligase"
                     /protein_id="WP_011845616.1"
                     /db_xref="GI:500171191"
                     /translation="MIPLSLETLSQHLGMFRVGDDVTIEDLSSDSRKIGAATLFVALK
                     GERFDGHDFAATAIENGAAALMVERELAFDIPQLIVPDCQKAMGAIGAYVRDQINPIC
                     VALTGSNGKTSVKEMIATILSAKHQILYTAGNFNNEIGVPLTLLRLTPADEFGIFELG
                     ANHKGEIDYTSGLVRPNVALVNNVGSAHLEGFGSQAGVAQAKSEIFNHLQADGTAIIN
                     ADDAFADFMSVKARPYKQLSFSQQDGAAKRHIDVIATGHKTNADGCYRFMLNYSGESC
                     QVVLPLAGRHQVSNALAAASVCIALGLNLTEIAEGLSQLTPVKGRMQPSQLGRVRLID
                     DSYNANPVSVGAAIAWLKEISENRCLVLGDLGELGDNAPLLHAELGQLAKQQGIDALF
                     CTGTLSQHTSQAFGAEHYDSVATLVEKLIKHINQLPGQVTVLVKGSRSAAMERVVDGL
                     TVAFGRGELV"
     gene            445658..446740
                     /locus_tag="SBAL_RS02015"
                     /old_locus_tag="Sbal_0399"
     CDS             445658..446740
                     /locus_tag="SBAL_RS02015"
                     /old_locus_tag="Sbal_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007651257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide
                     transferase"
                     /protein_id="WP_006079891.1"
                     /db_xref="GI:492987480"
                     /translation="MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALVFSLWFGPKL
                     IERLQLLQIGQVVRNDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVML
                     FVLGSFGLIGFIDDYRKVVRKDTKGLIARWKYILQSLAALLIAFFLYATAANPGETQL
                     VVPFFKDVMPQLGAVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYL
                     SGHAQFANYLHIPHLPGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAA
                     LGTIAVLVRQEILLVIMGGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWP
                     EPRVIVRFWIISIFLVLLGLATLKLR"
     gene            446747..448066
                     /locus_tag="SBAL_RS02020"
                     /old_locus_tag="Sbal_0400"
     CDS             446747..448066
                     /locus_tag="SBAL_RS02020"
                     /old_locus_tag="Sbal_0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
                     synthetase"
                     /protein_id="WP_011845617.1"
                     /db_xref="GI:500171192"
                     /translation="MQNQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGAET
                     LATSFPDVKLISGGFDCRYLVQATQIIISPGIATYTPEVRAAVDMGIEVIGDVELFAR
                     EIADRKPCVIGITGSNGKSTVTTLVGEMAREAGIAVAVGGNIGVPALDLLHENADLFV
                     LELSSFQLETTHSLKCVVATCLNISEDHMDRYSDIAAYREAKLRLYKQSRAVLFNRDD
                     KLTVPPEPMNQNSFGLAAPETDEWGISDSKIYHGSSEIMPITEVSLIGSHNHANLLAA
                     MALVDVVGVDKQVMAKVARSFTGLSHRCEVVGIKNGVTYVNDSKATNVGATVAALDGL
                     SDHLGDIILIAGGDGKGADFKPLGVALAKVTHLITLGRDGKKIAALKDGAVRVETMAA
                     AVTKAAELATSGDIVLLSPACASLDMYSNFMARGDDFRNLVEQLNGE"
     gene            448056..449267
                     /locus_tag="SBAL_RS02025"
                     /old_locus_tag="Sbal_0401"
     CDS             448056..449267
                     /locus_tag="SBAL_RS02025"
                     /old_locus_tag="Sbal_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086699.1"
                     /note="integral membrane protein involved in stabilizing
                     FstZ ring during cell division; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="WP_006086699.1"
                     /db_xref="GI:493005631"
                     /translation="MASDVRQLSLFGRLRSAMPNWQRDTEVPGVQLYDRALLAAVLSL
                     IGFGFVMVMSASMPEAQTLTGNPFYFMTRHVGYLVGCLAIAAFVLRVEMQTWQRWSPM
                     LLLVVGLMLLAVLVVGTTVNGATRWLSIGPIRIQVAEVAKFAFAIYMAGYLVRRHQEV
                     RENAKGFYKPIAVFAIYAVLILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALIFAG
                     VLAFVALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQK
                     LEYLPEAHTDFIFAVIGEELGFIGIIAVLSVLLFVALRSIRLGNLCLAMDKPFEGYLG
                     YAIGIWVCFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMMLLRIDYERRM
                     TLVQAVQGRLK"
     gene            449267..450355
                     /gene="murG"
                     /locus_tag="SBAL_RS02030"
                     /old_locus_tag="Sbal_0402"
     CDS             449267..450355
                     /gene="murG"
                     /locus_tag="SBAL_RS02030"
                     /old_locus_tag="Sbal_0402"
                     /EC_number="2.4.1.227"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8E698.1"
                     /note="N-acetylglucosaminyl transferase;
                     UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
                     pyrophosphoryl-undecaprenol N-acetylglucosamine
                     transferase; involved in cell wall formation; inner
                     membrane-associated; last step of peptidoglycan synthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase"
                     /protein_id="WP_011845618.1"
                     /db_xref="GI:500171193"
                     /translation="MTPAGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADR
                     MEARLVPQYGFDIDFIDIKGVRGNGLIRKLAAPFKVVRSILQAKAVIAEFKPDVVLGM
                     GGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQVLCAFKNTFTTVKAKVV
                     GNPIRQELIALGAEPKPEADEALKVLVVGGSLGAKVFNDLMPEAVAILSQQQFVTVWH
                     QVGKDNLTGVKAAYQQHGQDGGVNIAEFIDDMEAAYRWADVVLCRAGALTVSELAAVG
                     LPSILVPYPHAVDDHQTRNGQVLVEAGAAFLLPQAILDVNKLAGKLQLLANDRTELAR
                     MGQRARDVAVLDATEQVAAVCISLAEKG"
     gene            450358..451824
                     /gene="murC"
                     /locus_tag="SBAL_RS02035"
                     /old_locus_tag="Sbal_0403"
     CDS             450358..451824
                     /gene="murC"
                     /locus_tag="SBAL_RS02035"
                     /old_locus_tag="Sbal_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZM2.1"
                     /note="Catalyzes the formation of
                     UDP-N-acetylmuramoyl-L-alanine from UDP-N-acetylmuramate
                     and L-alanine in peptidoglycan synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="WP_006079895.1"
                     /db_xref="GI:492987484"
                     /translation="MTKTERYAQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEG
                     YQVSGSDIAQNAVTDRLCLLGAKIQIGHAAENVQQVDVVVVSTAINLENPEILAAKEL
                     RIPIVRRAEMLAELMRYRHGVAIAGTHGKTTTTSLIASVYGQAGRDPTFVIGGLLNSA
                     GTNARLGTSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDF
                     LHNLPFYGVAVVCIDDAVVREIMPRIGRQLVTYGFSDDADVQALNFSQQGHQCRFTVR
                     RKGKADLDLVLNLPGQHNVLNALAAIAVATEDEIDDSAITQALVEFQGIGRRFQHLGK
                     FATPKGEVMLVDDYGHHPSEVAATIKAARAGWPDKRLVMAYQPHRYTRTRDLYEDFVE
                     VLSQVDCLLLLDVYSAGEAPITGADGRALCRSIRLRGQLDPIFIASPDQLAEVLPDVL
                     QEGDLLLTQGAGNIGALSRLLATTELGFAVAELPAQAS"
     gene            451976..452725
                     /locus_tag="SBAL_RS02040"
                     /old_locus_tag="Sbal_0404"
     CDS             451976..452725
                     /locus_tag="SBAL_RS02040"
                     /old_locus_tag="Sbal_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012196580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="WP_012586608.1"
                     /db_xref="GI:501582292"
                     /translation="MSRVNWYLWSGAGFLFFIVASFVFGGYQLHKFLNDASTLPIEAV
                     AIKGERAYTTDKDIQVALQDLMQRSFFSADITLVQQALEDLPWVYRASVRREWPAKLR
                     VYLQEQQPAAHWNGDSWLNVHGEVFEAPSHPELEHLPQLSGPDDMGLEVLTVYAQINS
                     LLKINGFTLASLYLTPRHAWHATLGNGIVLDLGREDKIARIQRFITVYPVLAKQEKSV
                     ARVDLRYDTGLAVGWGDAQTREPIINDQKPR"
     gene            452706..453941
                     /locus_tag="SBAL_RS02045"
                     /old_locus_tag="Sbal_0405"
     CDS             452706..453941
                     /locus_tag="SBAL_RS02045"
                     /old_locus_tag="Sbal_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011073897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_006079897.1"
                     /db_xref="GI:492987486"
                     /translation="MIKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSR
                     GMDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDE
                     EVTQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHI
                     VTCANDMAKNITKSVERCGLKVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDI
                     AVYTNGALRHCAVVPVAGNQVTNDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIE
                     VPSVGGRPSRSMSRHTLAEVVEPRYQELFELVLKELKDSGLEDQIAAGIVLTGGTASI
                     QGVVDIAEATFGMPVRVASPLPIKGLYEYVDQSIYSTGVGLLHYGARRVIERQFERPE
                     RQGVTSAWNRVQSWFKGEF"
     gene            453975..455162
                     /locus_tag="SBAL_RS02050"
                     /old_locus_tag="Sbal_0406"
     CDS             453975..455162
                     /locus_tag="SBAL_RS02050"
                     /old_locus_tag="Sbal_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079898.1"
                     /note="GTPase; similar structure to tubulin; forms
                     ring-shaped polymers at the site of cell division; other
                     proteins such as FtsA, ZipA, and ZapA, interact with and
                     regulate FtsZ function; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_011845620.1"
                     /db_xref="GI:500171195"
                     /translation="MFEIMDTHSDDAVIKVIGVGGGGGNAVEHMVKHNIEGVEFIVTN
                     TDAQALRKSGAGSTIQLGRDVTKGLGAGANPDVGRAAAEEDRENIRAAIKGSDMIFIA
                     AGMGGGTGTGAAPVVAQIAREEGILTVAVVTKPFPFEGKKRMAYAEQGIAELAKHVDS
                     LITIPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVM
                     SEMGNAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEF
                     ETVGNHVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKRPDIQLVSKPAPRP
                     EPVVVEPKVEAYVEEAVHVNYAAPKGNVLPAAPLPAPQPAPSTKHELDYLDIPAFLRK
                     QAD"
     gene            455343..456263
                     /gene="lpxC"
                     /locus_tag="SBAL_RS02055"
                     /old_locus_tag="Sbal_0407"
     CDS             455343..456263
                     /gene="lpxC"
                     /locus_tag="SBAL_RS02055"
                     /old_locus_tag="Sbal_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HE88.1"
                     /note="zinc-dependent; catalyzes the deacetylation of
                     UDP-(3-O-acyl)-N-acetylglucosamine to
                     UDP-3-O-(3-hydroxytetradecanoyl)-glucosamine in the second
                     step of lipid A biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase"
                     /protein_id="WP_011845621.1"
                     /db_xref="GI:500171196"
                     /translation="MIFQRTVQKMVKTTGVGLHSGNKVTLSIMPAPVNSGIVLVRTDL
                     SPAVAIPAKAEQVRETTMCTALVNDEGIRISTIEHLFAALAGLGIDNAVIEVDAPEIP
                     IMDGSASPFVFLLQSAGIKEQAAPKKYLKIKRPVRVEDGDKWAELKPFKGFRVNFKID
                     FAHPEIARSQQHVVMDFSTSAFVKDISRARTFGFMRDIEYLRANNLALGGSMENAVVL
                     DEYRVLNPDGLRYEDEFVKHKILDAFGDLYVAGHAILGEFTAYKTGHALNNQLVRALL
                     AQQDAWELVSFEKEADVPVSFTVPGGAVFA"
     gene            complement(456276..456722)
                     /locus_tag="SBAL_RS02060"
                     /old_locus_tag="Sbal_0408"
     CDS             complement(456276..456722)
                     /locus_tag="SBAL_RS02060"
                     /old_locus_tag="Sbal_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006086703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006086703.1"
                     /db_xref="GI:493005640"
                     /translation="MKKPPQDLSQLLHQSGKLPDLAEKAELLMYLNHHVKQIIAGPVA
                     EQLKVANFRQGVLVVETTSAAWAARINFQKPKLLAQLQAETLPILTAIEVKVNPRLAM
                     YDAKPKQGHKELSPAAAEHIAALAENIGGSLGEKLKRLASLASRNK"
     gene            456750..457649
                     /locus_tag="SBAL_RS02065"
                     /old_locus_tag="Sbal_0409"
     CDS             456750..457649
                     /locus_tag="SBAL_RS02065"
                     /old_locus_tag="Sbal_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_006079901.1"
                     /db_xref="GI:492987490"
                     /translation="MSVTVFIQGRNGVTRWQPSKRWLLLPILLLATGSGIYQHNSARF
                     QDQQASVDNDRLVREQQKKQVLELKSATESQLAMLVTHVARMQAKITRLEALGQQVAQ
                     QNKLDEDFDFSSEVGVGGLSELGTNIELGQLIDDMDKLASRIDNNNVQLSLLETVSSN
                     HHIDDERYISGIPLDKGWLSSPYGLRNDPFNGRRTVHKGIDFTGREGAKVVATAAGVV
                     TWAGNMFGYGELVEIDHGNGLHTRYGHNKALSVTVGDVVAKGDAIASMGSTGRSTGAH
                     VHYEVLRGGQQIDPQKFVYRKAS"
     gene            457710..460436
                     /gene="secA"
                     /locus_tag="SBAL_RS02070"
                     /old_locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
     CDS             457710..460436
                     /gene="secA"
                     /locus_tag="SBAL_RS02070"
                     /old_locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620567.1"
                     /note="functions in protein export; can interact with
                     acidic membrane phospholipids and the SecYEG protein
                     complex; binds to preproteins; binds to ATP and undergoes
                     a conformational change to promote membrane insertion of
                     SecA/bound preprotein; ATP hydrolysis appears to drive
                     release of the preprotein from SecA and deinsertion of
                     SecA from the membrane; additional proteins SecD/F/YajC
                     aid SecA recycling; exists in an equilibrium between
                     monomers and dimers; may possibly form higher order
                     oligomers; proteins in this cluster correspond SecA1;
                     SecA2 is not essential and seems to play a role in
                     secretion of a subset of proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecA"
                     /protein_id="WP_011845622.1"
                     /db_xref="GI:500171197"
                     /translation="MFGKLLTKVFGSRNDRTLKGLQKIVISINALEADYEKLTDEALK
                     AKTAEFRERLAAGASLDSIMAEAFATVREASKRVFDMRHFDVQLLGGMVLDSNRIAEM
                     RTGEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAG
                     LGQHEKKAAYNADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDE
                     ARTPLIISGAAEDSSELYIKINTLIPNLIRQDKEDTEEYVGEGDYSIDEKAKQVHFTE
                     RGQEKVENLLIERGMLAEGDSLYSAANISLLHHVNAALRAHTLFERDVDYIVQDNEVI
                     IVDEHTGRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNYFRQYEKLAGMTG
                     TADTEAFEFQHIYGLDTVVVPTNRPMVRKDMADLVYLTADEKYQAIIKDIKDCRERGQ
                     PVLVGTVSIEQSELLARLMVQEKIPHEVLNAKFHEREAEIVAQAGRTGSVTIATNMAG
                     RGTDIVLGGNWNMEIDELDNPTAEQKAKIKADWQIRHDEVVAAGGLHILGTERHESRR
                     IDNQLRGRAGRQGDAGSSRFYLSMEDSLMRIFASDRVSGMMKKLGMEEGEAIEHPWVS
                     RAIENAQRKVEARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIEDTIQNIQDD
                     VIGAVIDQYIPPQSVEELWDIPGLEQRLHQEFMLKLPIQEWLDKEDDLHEESLRERII
                     TAWGDAYKAKEEMVGAQVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKN
                     PKQEYKRESFELFQQLLNTLKHDVISVLSKVQVQAQSDVEEMEARRREEDAKIQRDYQ
                     HAAAESLVGSSDEHEAVTAQAPMIRDGEKVGRNDPCPCGSGRKYKQCHGKLS"
     gene            461201..462746
                     /locus_tag="SBAL_RS02075"
                     /old_locus_tag="Sbal_R0008"
     rRNA            461201..462746
                     /locus_tag="SBAL_RS02075"
                     /old_locus_tag="Sbal_R0008"
                     /product="16S ribosomal RNA"
     gene            462846..462922
                     /locus_tag="SBAL_RS02080"
                     /old_locus_tag="Sbal_R0009"
     tRNA            462846..462922
                     /locus_tag="SBAL_RS02080"
                     /old_locus_tag="Sbal_R0009"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:462880..462882,aa:Ile,seq:gat)
     gene            463060..463135
                     /locus_tag="SBAL_RS02085"
                     /old_locus_tag="Sbal_R0010"
     tRNA            463060..463135
                     /locus_tag="SBAL_RS02085"
                     /old_locus_tag="Sbal_R0010"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:463093..463095,aa:Ala,seq:tgc)
     gene            463497..466425
                     /locus_tag="SBAL_RS02090"
                     /old_locus_tag="Sbal_R0011"
     rRNA            463497..466425
                     /locus_tag="SBAL_RS02090"
                     /old_locus_tag="Sbal_R0011"
                     /product="23S ribosomal RNA"
     gene            466546..466661
                     /locus_tag="SBAL_RS02095"
                     /old_locus_tag="Sbal_R0012"
     rRNA            466546..466661
                     /locus_tag="SBAL_RS02095"
                     /old_locus_tag="Sbal_R0012"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            466697..466772
                     /locus_tag="SBAL_RS02100"
                     /old_locus_tag="Sbal_R0013"
     tRNA            466697..466772
                     /locus_tag="SBAL_RS02100"
                     /old_locus_tag="Sbal_R0013"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:466730..466732,aa:Thr,seq:ggt)
     gene            466810..466925
                     /locus_tag="SBAL_RS02105"
                     /old_locus_tag="Sbal_R0014"
     rRNA            466810..466925
                     /locus_tag="SBAL_RS02105"
                     /old_locus_tag="Sbal_R0014"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(467476..467967)
                     /locus_tag="SBAL_RS02110"
                     /old_locus_tag="Sbal_0411"
     CDS             complement(467476..467967)
                     /locus_tag="SBAL_RS02110"
                     /old_locus_tag="Sbal_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="WP_011845623.1"
                     /db_xref="GI:500171198"
                     /translation="MECIMLRELEKAEQKWGGSNKLIDQWLKNRRKLLVHYCQIAGLP
                     PYGKSEKSLPSFEHVKSFCDLLVDYVSEGHFEVYDRVVNACSEYGESSKTLAQQVLPK
                     ITPTTNAALDFNDKYAETQDDLVLYQLDKDLSELAHNMETRFELEDELLEVLHRKHSE
                     HTQ"
     gene            468027..468320
                     /locus_tag="SBAL_RS02115"
                     /old_locus_tag="Sbal_0412"
     CDS             468027..468320
                     /locus_tag="SBAL_RS02115"
                     /old_locus_tag="Sbal_0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845624.1"
                     /db_xref="GI:500171199"
                     /translation="MRICVNDEMDKPAVLHQKIQIKSPTIETYRWASKVYSRLDATSF
                     LIVLASADFLYQRLGTGATFFCLSVTSLRINEQYVIWITFSGLCGQIDASDGE"
     gene            468413..469477
                     /gene="hemE"
                     /locus_tag="SBAL_RS02120"
                     /old_locus_tag="Sbal_0413"
     CDS             468413..469477
                     /gene="hemE"
                     /locus_tag="SBAL_RS02120"
                     /old_locus_tag="Sbal_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8E642.1"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_006079904.1"
                     /db_xref="GI:492987493"
                     /translation="MAELKNDRYLRALLKEPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNHELACEVTLQPLRRYDLDAAILFSDILTVPDAMGLGLYFEAGEGPRFERP
                     TDTIDAIKKLSIPDPEDELGYVMKAVSTIRRELNGAVPLIGFSGSPWTLATYMVEGGS
                     SKTFEKIKKMAYAEPMALHMLLDKLADSVILYLNAQVANGAQSLMIFDSWGGALSHSA
                     YREFSLRYMQKIIDGLTRFADGRKVPVTLFTKGGGLWLEAMAETGCDALGLDWTVDIA
                     DARRRVGHKVALQGNMDPSMLYAPIPRIEEEVGHILAGYGEGTGHVFNLGHGIHQHVD
                     PEHAGAFIKAVHAQSKQYHK"
     gene            complement(469643..469846)
                     /locus_tag="SBAL_RS02125"
     CDS             complement(469643..469846)
                     /locus_tag="SBAL_RS02125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079905.1"
                     /db_xref="GI:492987494"
                     /translation="MQHISFANSIKHRLALVVAKVDTFMQLNQFYTFDLKVKITKRTI
                     INFTFYQDNSHNQHVNIEHLNCY"
     gene            469909..472488
                     /locus_tag="SBAL_RS02130"
                     /note="diguanylate cyclase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            472564..473367
                     /locus_tag="SBAL_RS02135"
                     /old_locus_tag="Sbal_0416"
     CDS             472564..473367
                     /locus_tag="SBAL_RS02135"
                     /old_locus_tag="Sbal_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007650722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_006079907.1"
                     /db_xref="GI:492987496"
                     /translation="MDGLTGKVVIITGASEGIGRALAVAMARMGCQLVISARNETRLA
                     SLALEIANYGLPPFVFAADVSRAEQCEALIEATVAHYGHLDILINNAGMTMWSRFDEL
                     TQLSVLEDIMRVNYLGPAYLTHAALPHLKASKGQVVVVASVAGLTGVPTRSGYAASKH
                     AVIGFFDSLRIELADDNVAVTVICPDFVVSQIHKRALDGAGNPLGKSPMQEAKILTAE
                     QCANMMLPVIATRGRQLITSLRGRLGRWLKLIAPGLIDKIARRAIASGH"
     gene            complement(473386..473613)
                     /locus_tag="SBAL_RS02140"
                     /old_locus_tag="Sbal_0417"
     CDS             complement(473386..473613)
                     /locus_tag="SBAL_RS02140"
                     /old_locus_tag="Sbal_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079908.1"
                     /db_xref="GI:492987497"
                     /translation="MGYSIKDLIYQGEKSGVHNWGTLEGKSFYWHPDWFHIAEDMTGH
                     MATATIDKQGEKATQSEAEQSIIKHLNKSGK"
     gene            complement(473785..477000)
                     /locus_tag="SBAL_RS02145"
                     /old_locus_tag="Sbal_0418"
     CDS             complement(473785..477000)
                     /locus_tag="SBAL_RS02145"
                     /old_locus_tag="Sbal_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845627.1"
                     /db_xref="GI:500171202"
                     /translation="MRIRLLCASIAILLSGCGGGSEDAGTTTPPTQPPVQPPAPVQYI
                     ASSVSANGGALDPSSQKVESGKSAIFSITADTGFTLEAITGCGGTLNALTYTTAVITA
                     DCTITPTFIANAENAIKHQDHRLASASELIDFSIAKLASIDIKRKAHINQLYQGVGSS
                     ISWHPTHDSITFSSFMPENTFTVLPSNVDGSGESAVRGLVMAGEQQGQRYAAMAGNLF
                     SVNTSAQTDTLLKNILGWLTKGADKTDGLSIVTTQMPSKADSWDFPHNEGIRTWLTNN
                     YPAAHSINAANTCDYSELSNCIDTLKPDVILISDIDRQSLGFAGIKAAIAKAKAAGIP
                     LLLSNYWRNQSPMLSPLYLEMGLSTSGNYWSKLNANDLSVTDVLAEDTALTKVNNLLG
                     KLNEASFDTSVLNDCTGNYLSCNAAAFVDSFKAGADWYRSNAETLDNNAIDVFTKADF
                     PLMKAGLLLADKYRSEIDYPIAYSEHAQWQQALFADWTVSYARVHNLAQPDLGEYVTD
                     RANLCKGSNAHYAYPATVSERKTISVPYAGQWTTTGWYALPGQTIKLTRLDSSAANVE
                     IKLNYHRRNTNRAYEQKVYRGPLELAQQRLRLAQGKSIEFSSPYGGPIYLYINGDASS
                     VDVNAEHVAKHPTIMDFSNPAEIAAFNERIQNTELPHVDLRTDGAEQHLRRDRFLNAI
                     GTYVPDVNALLNSIVDDHINSVYTLAGLKIQGKSLSESLPADVLAACKGLFGDDCIDN
                     SLHTRTIIQHANYDQNAQCGAGCSGNPWDAAWNIDPTGWGDNHELGHNLQTNRLNVQY
                     AAANNSDNRAGYSSRAGENSNNIFPYVVKWKTYYLRDGNTGTVTDGHMNHKDLFYVFM
                     SDAAGTTDTSGKRVVFGANCKVLDAGEDRYTAPWSSNAYAVHNGYRMAFYIQMALKAH
                     GITLSDGTMLNNGFNLFTLLYQHSRIFGKYANNASDWEANRSKLGFSQFPFDGNSVYG
                     GKTVKDIPGNDFMLVSLSQLTGKDWRSHFDMLGLRYSSLAAAQTVANATSGTMPMGMY
                     ELETDLPPANMSQGLTFVPLSLTDGTTQWKGVGSPTQCTKP"
     gene            complement(477178..478476)
                     /locus_tag="SBAL_RS02150"
                     /old_locus_tag="Sbal_0419"
     CDS             complement(477178..478476)
                     /locus_tag="SBAL_RS02150"
                     /old_locus_tag="Sbal_0419"
                     /EC_number="6.3.4.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084345.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_011845628.1"
                     /db_xref="GI:500171203"
                     /translation="MKVLVIGGGGREHALAWKAAQSAQVETVYVAPGNAGTALEPNVE
                     NLAISATDIPALLDFAKTNKIELTIVGPEAPLVMGVVDAFNAAGLPIFGPTKAAAQLE
                     GSKAFTKDFLARHNIPTAGYKNCTEISDAKAFVRELTATTGYPVVIKADGLAAGKGVI
                     IAQDQAEADAAIDDMLAGNKFGDAGSHVVIEEFLKGEEASFIVMVDGKNILPMATSQD
                     HKARDNGDYGPNTGGMGAYSPAPVVTQAVHDWTVANVIRPTVDGMAAEGNVYTGFLYA
                     GLMISPDGSAKVLEYNCRFGDPETQPIMMRLKSDLVELCLAATRGELDKVTAEYDERA
                     AVGVVLAAGGYPDEYRKFDVIDGLSLGDNDGKVFHAGTEMKDGHVVTNGGRVLCATAL
                     GNTVTEAQKAAYKLVDEIHWDDVYFRTDIGYRAIAREQQD"
     gene            complement(478607..480205)
                     /gene="purH"
                     /locus_tag="SBAL_RS02155"
                     /old_locus_tag="Sbal_0420"
     CDS             complement(478607..480205)
                     /gene="purH"
                     /locus_tag="SBAL_RS02155"
                     /old_locus_tag="Sbal_0420"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007650718.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine biosynthesis protein purH"
                     /protein_id="WP_011845629.1"
                     /db_xref="GI:500171204"
                     /translation="MTAVNNARPIRRALLSVSDKTGILEFAKALHAQGVELLSTGGTA
                     RLLADNGVPVIEVSDYTGHPEIMDGRVKTLHPKVHGGILARRGLDESVMADNNINAID
                     LVAVNLYPFAETVAKAGCTLEDAIENIDIGGPTMVRAAAKNHKDVTIVVNAADYSRVL
                     AEMTANNGSTTHATRFDLAIAAFEHTAGYDGMIANYFGTMVPAHSTDECFADSKFPRT
                     FNTQLVKKQDLRYGENSHQAAAFYVDTKIDEASVATAIQLQGKALSYNNIADTDAALE
                     CVKEFLEPACVIVKHANPCGVALGKDLLDAYNRAYQTDPTSAFGGIIAFNGELDAATA
                     SAIVERQFVEVIIAPSVSQAARDVVAKKTNVRLLECGQWNTKTQTLDYKRVNGGLLVQ
                     DRDQGMVGLEDIKVVSKRQPTASELKDLMFCWKVAKFVKSNAIVYAKDGMTIGVGAGQ
                     MSRVYSAKIAGIKAADEGLEVVNSVMASDAFFPFRDGIDAAAAAGISCIIQPGGSMRD
                     AEIIAAADEHGMAMVMTGMRHFRH"
     gene            480559..481089
                     /gene="zntR"
                     /locus_tag="SBAL_RS02160"
                     /old_locus_tag="Sbal_0421"
     CDS             480559..481089
                     /gene="zntR"
                     /locus_tag="SBAL_RS02160"
                     /old_locus_tag="Sbal_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084343.1"
                     /note="mediates expression of the zinc export protein ZntA
                     in response to high levels of zinc; member of MerR family
                     of transcriptional regulators; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-responsive transcriptional regulator"
                     /protein_id="WP_011845630.1"
                     /db_xref="GI:500171205"
                     /translation="MYRIGELADLCEVKADTLRFYEKHGLLAPSSRTESGYRVYTEAD
                     AARLRFILRAKAVGFTLNEISELLSIELDKSNRVCADVKGMVDIKLAQVQAKIAELNH
                     FQTSLQSLSDACCGGPRSAEHCSILEALESSTERVRVEHHSHDGNQHETHQHKAHQNE
                     SRQHTHGKTIHDESGN"
     gene            481092..482603
                     /locus_tag="SBAL_RS02165"
                     /old_locus_tag="Sbal_0422"
     CDS             481092..482603
                     /locus_tag="SBAL_RS02165"
                     /old_locus_tag="Sbal_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011845631.1"
                     /db_xref="GI:500171206"
                     /translation="MLLKNFIDLFLDSAPWLLLGLILAGLLKVFVPMVWMQKQLGGHG
                     FKTVVKAALLGAPLPLCSCGVIPAAVGLRRSGASKAATTSFLVSTPETGVDSIAVSYV
                     LLGPFMAIVRPIAAITSAIVAGLLVGRDDDDGKPAAKSESKSASDAPVAACCASKSAT
                     QSQAVKAEPVKSCCSPTKDQPLAPVKAAASCCSTESHSEQKTEPKSAIKMTPVAATSS
                     LMTTAPSLMTAHGGSVANVGVIKAEKTASCCASKTAESVTPEKILVVKKGACCGTSNK
                     AESETHDHSAHAPQAQGEADSCCASTQDMATELKSQSVLSRVGIGLKYAATDLVRDTT
                     LWLLVGLFFAALVQTYVPADFLAQWGDGILAMLVMVLVSVPMYICATASTPIAAGLLL
                     AGVSPGAVLVFMMAGPATNIATLGVVAKELGKRALWGYLGGVIGVALVAGILVNYLVD
                     SFGFVVMPQIGEQHQMLPQWLVATSGIVLALLMAKVVFEKIPRSWIRRNDCCS"
     gene            complement(482711..483598)
                     /locus_tag="SBAL_RS02170"
                     /old_locus_tag="Sbal_0423"
     CDS             complement(482711..483598)
                     /locus_tag="SBAL_RS02170"
                     /old_locus_tag="Sbal_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="band 7 protein"
                     /protein_id="WP_006079914.1"
                     /db_xref="GI:492987503"
                     /translation="MIKNELNLPSSIGLSKIIPIVILLILFISLFGSWYTVDQGERGV
                     LLRNGKVIGTAEPGLGFKIPLIDTVVKISTQTHTTSYTSLQAYSRDQQPATLNASVTF
                     SVPPDRVEEVYANFKSIDAMVTRLLDRQVPTQVENIFGKYTAISVVQERIKFGIDVTS
                     AITNSIKGPVEINSVQIENIDFSNAYEKSVEDRMRAEVEVQTQLQNLEKERVSAQIAV
                     TQAQAQADSQLARAKAEAESIRIKGDAEASAIKSRAEALAQNQNLVELTKAEKWDGKL
                     PTTMLPTGTLPFIDVKKGN"
     gene            complement(483890..484591)
                     /locus_tag="SBAL_RS02175"
                     /old_locus_tag="Sbal_0424"
     CDS             complement(483890..484591)
                     /locus_tag="SBAL_RS02175"
                     /old_locus_tag="Sbal_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_011845632.1"
                     /db_xref="GI:500171207"
                     /translation="MRLDKFLCKSTDLDRDAASVAIINGSVTVNGAIATDCAMQVHEN
                     NAVCLNEKPLMPRPSRYFMLHKPADTLCSNVDGAYPSLFHLLDIEHAFDLHIVGRLDA
                     DTTGLVLLTDDGRWSFNIISPQYQCEKVYRVTLRDPLDSEATAAIAATFAAGLQLQGE
                     TALTLPATLQQVDEKTVLLTLTEGKFHQVKRMFAAVGNKVVALHRAQIGAVTLDVDVG
                     EWRELTLAEIASFTA"
     gene            complement(484909..486075)
                     /locus_tag="SBAL_RS02180"
                     /old_locus_tag="Sbal_0425"
     CDS             complement(484909..486075)
                     /locus_tag="SBAL_RS02180"
                     /old_locus_tag="Sbal_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011845633.1"
                     /db_xref="GI:500171208"
                     /translation="MEKIALTQSAQKPSLFVPVAGLSLFALASGYLMSLIPLSLTFFE
                     LSNSLAPLLASIFYLGLLLGAPCIAPIVSRIGHSKAFILFLNILLCSVVAMILIPKSG
                     VWLASRLVAGFAVAGIFVVVESWLLMADTQKQRAKRLGLYMTALYGGTAVGQLAIDYL
                     GTKGNLPYLVVMGLLAAASLPALLVKRGQPQVSEQQSMSLSALKNLSQPAIMGCLVSG
                     LLLGPIYGLLPIYVALDMGLDQQTGQFMALIIVGGMLVQPLVSYLSPIFNKSGLIVSF
                     SLLGVAALLLLSQHSSMTLIIGFLLLGASAFALYPIAISLACDNLPASQMVSVAQVML
                     LSYSVGSVIGPLVASSFGQTEFGLLIYLGICCILSSIYIFAQLLINTKPSFSSP"
     gene            486395..486601
                     /locus_tag="SBAL_RS02185"
                     /old_locus_tag="Sbal_0426"
     CDS             486395..486601
                     /locus_tag="SBAL_RS02185"
                     /old_locus_tag="Sbal_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011627365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845634.1"
                     /db_xref="GI:500171209"
                     /translation="MAVYHLGRKRGVICIAVLNINKITAWVRFCSIFARLKIKNKGVD
                     QNLVIIVADRLFLRAVSAINVVAG"
     gene            486686..488086
                     /locus_tag="SBAL_RS02190"
                     /old_locus_tag="Sbal_0427"
     CDS             486686..488086
                     /locus_tag="SBAL_RS02190"
                     /old_locus_tag="Sbal_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anion transporter"
                     /protein_id="WP_011845635.1"
                     /db_xref="GI:500171210"
                     /translation="MSSTEPSTVPPHKAPVSEGLDKKKMLILAADIVLLFALYYGLPF
                     EQGVNTGLAILVFAGILWLTEAIHISITAILVPILAVFFGVFETKEAMSSFANPIIYL
                     FFGGFVLAAALHHQKIDTLIAQKLLLASKGRLSIACFMLFGVTALLSMWISNTATTAM
                     MLPLALGILQQLDREKYHSTYVFLLLGIAYSANIGGIGTLVGSPPNAIAAAQVGLSFS
                     DWLKFGIPTVILMLPLMLIALYWYFKPDLSAKFDVQVEAQKLTFQGKFTLLIFLATVC
                     CWIFSVPLAKALGGITQFDTIVALGAVVLLAGLGLVGWKKIESTTDWGVLILFGGGLT
                     LSAVLKTTGTSVFLAHWMTDIFGSTHMSLFVFAVIAFVVMLTEFASNTASAALLVPVF
                     AAIAEALGVSPVMLSVLIGIAASCAFMLPVATPPNAIVYGSGHIKQSEMVRVGMIINF
                     ISMIVLGIIAHVFWDI"
     gene            complement(488168..488680)
                     /locus_tag="SBAL_RS02195"
                     /old_locus_tag="Sbal_0428"
     CDS             complement(488168..488680)
                     /locus_tag="SBAL_RS02195"
                     /old_locus_tag="Sbal_0428"
                     /EC_number="1.8.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_006084335.1"
                     /db_xref="GI:493000844"
                     /translation="MGEIIITQPLNNRPLTQYISRIDILFWSFAMIIACPHCDTLNRV
                     PDERVNQQPTCGKCKLSVFTAAPIELTSANFANHANKSELPLVVDFWASWCGPCKSFA
                     PVFSAAAKTWEPQFRFGKINTEEQQALAAQFNIRSIPTLMIFKQGKILAQQAGALPQS
                     ALNQWLKSHS"
     gene            488829..489164
                     /locus_tag="SBAL_RS02200"
                     /old_locus_tag="Sbal_0429"
     CDS             488829..489164
                     /locus_tag="SBAL_RS02200"
                     /old_locus_tag="Sbal_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_011845636.1"
                     /db_xref="GI:500171211"
                     /translation="MTELEVIDLQVGEGKEAVKGALITTQYRGFLQDGTQFDSSYDRG
                     QAFQCVIGTGRVIKGWDQGIMGMKVGGKRKLLVPAHLAYGERQVGAHIKPNSDLTFEI
                     ELLEVLTRD"
     gene            489306..490289
                     /locus_tag="SBAL_RS02205"
                     /old_locus_tag="Sbal_0430"
     CDS             489306..490289
                     /locus_tag="SBAL_RS02205"
                     /old_locus_tag="Sbal_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011845637.1"
                     /db_xref="GI:500171212"
                     /translation="MASDTAAEHIKQLQAEIAQLKRENAQLTALNRRAEEKLFAALDG
                     NGLCLWEQHIPSGNLTIFNMRWGEMLGFSPEELAAHVDIWKSKLHPEDKAWVIKAFDD
                     HVSGKSDYYQAVHRMLHKDGSVTWVSDRGRIVERFADGTPLRMMGSHIDITQEKRYEL
                     DLALLAHSDPLTNLMNRQAIAKAFDECLQPEMRGALFFIDLDGFKALNDRHGHKFGDN
                     LLVHVAHTLVSHSGELAKIARLGGDEFVIILPSSDIESLAMLAQSLLDVYRQGFLLEG
                     CDVEIGLSIGIDIFSYDDSFAKSCDRADAAMYRVKHQGKNGYRFYQQADDC"
     gene            complement(490317..490742)
                     /locus_tag="SBAL_RS02210"
                     /old_locus_tag="Sbal_0431"
     CDS             complement(490317..490742)
                     /locus_tag="SBAL_RS02210"
                     /old_locus_tag="Sbal_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845638.1"
                     /db_xref="GI:500171213"
                     /translation="MLGLCLGLAGTLWAQVPTDHFTLAWTHTIEKIRWEEDYHVTPQG
                     LVLVEARVKGTGAGMDIPDDAYLKNGSWHYRPKLPTLPKLRLGRTPEAGDFELCFAQA
                     SGKVQCQAMSHWIGQPNKQDAAVEVWGCEQANVAPIDVR"
     gene            complement(490785..492818)
                     /locus_tag="SBAL_RS02215"
                     /old_locus_tag="Sbal_0432"
     CDS             complement(490785..492818)
                     /locus_tag="SBAL_RS02215"
                     /old_locus_tag="Sbal_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_011845639.1"
                     /db_xref="GI:500171214"
                     /translation="MSDPQQGLSANTGDWPKALFYTALIFSIFQIITAAFHPVSTQVL
                     RATHIGFLLLVVFLSYPARGKSQPWQPLAWLLGLAGMATAAYQWYFEADLIQRSGELI
                     DADMVIGITLIVLVFEAARRVMGWALPIICGIFLAYGLLGQYLPGDLMHRGYGFDQII
                     NQLAFGTEGLYGTPTYVSATYIFLFILFGSFLEQAGMIRLFTDFAMGLFGHKLGGPAK
                     VAVVSSALMGTITGSGVANVVTTGQFTIPLMKRFGYRSAFAGGVEATSSMGSQIMPPI
                     MGAVAFIMAETINVPFIEIAKAALIPALLYFCSVFWMVHLEAKRANLCGLPKDQCPDP
                     WAAIKERWYLLIPLFILVYLLFSGRTPLFSGMVGLALTSIVILGSAIVLRLSSIAMRI
                     AFWIALGVLCAGFFQLGIGVVFGVIALLVAICWFIKGGKETLTVCLHALVEGARHAVP
                     VGIACALVGVIIGIVSLTGIASTFASYILAVGQDNLFLSLVLTMITCLVLGMGIPTIP
                     NYIITSSIAAPALLDLGVPLIVSHMFVFYFGIMADLTPPVALACFAAAPIAKESGLKI
                     SLWAIRIAIAGFVIPFMAVYDPALMLQGDSLLATAFVVLKATVGIGIWGVIFTGYLLQ
                     KLYWWERVIGFLAGASLILATPLSDEIGFGLALLFIVQHSWRARKLKRLAEQG"
     gene            complement(493021..493977)
                     /locus_tag="SBAL_RS02220"
                     /old_locus_tag="Sbal_0433"
     CDS             complement(493021..493977)
                     /locus_tag="SBAL_RS02220"
                     /old_locus_tag="Sbal_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_011845640.1"
                     /db_xref="GI:500171215"
                     /translation="MKIKKRFVAVGAAVTLTLSAAAMAATPAFINILTGGTSGVYYPI
                     GVALSQLYGTGIEGSKTSVQATKASVENLNLLQAGRGELALALGDSVAAAYQGDIDAG
                     FKTPLDKIRVLASAYPNYIQIVANKESGIKTLADLKGKRISVGAPKSGTELNARSIFK
                     AAGLSYEDMGKVEFLPYAESVELIKNRQLDATLQSSGLGMAAIRDLAATMAINFVEIP
                     EDVIAKINNPAYQHGVIPASTYEGQTTDVSTVAIQNLLVTQSGVSDDLAYQMTKIMFE
                     HLDRLGNAHSAAKSISLEKATKNLPIPLHPGAERYYKEVGAL"
     gene            complement(494759..496267)
                     /locus_tag="SBAL_RS02225"
                     /old_locus_tag="Sbal_0435"
     CDS             complement(494759..496267)
                     /locus_tag="SBAL_RS02225"
                     /old_locus_tag="Sbal_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620570.1"
                     /db_xref="GI:504433468"
                     /translation="MNTLLIGKGEQQVHLNLKYANRHGLIAGATGTGKTVSLMSLAEG
                     FSRQGVPVFITDVKGDISGLAMAGTPSEKLLQRAAQIGIEDYHNEANPVVLWDLAGVQ
                     GHPLRTTISEMGPTLLSRILELNDTQSGILDIVFQLADDQGLLLLDLDDLRAMLALVA
                     EERKDVSAKYGLISAQSLAAIQRSVLGLERDGGKDFFGEPALQLEDLMRTNLQGRGII
                     NLLAANKLILTPRLYSSFLLWLLSELFENLPEVGDPEKPKLVFFIDEAHLLFEGCPPS
                     LLKRVEQIMRLIRSKGVGVYFCSQFPDDVPGEILGQLGNRIQHALRAYTPRDQKAVKT
                     AAETFVPNPKLVVSEVISQLGVGEALVSMLADKGVPTMVERALIAPPRCRMGPATSEE
                     LHQVRAQSPIGGKYDHSINRESAYELLNQRRTGVATSNPTSTASNTANDGQTGQKAEE
                     QGWFSELIFGNKRRQGLAETLSKQAARTVGSQLGKQILRGILGGMLGKSSRR"
     gene            496506..496745
                     /locus_tag="SBAL_RS02230"
                     /old_locus_tag="Sbal_0436"
     CDS             496506..496745
                     /locus_tag="SBAL_RS02230"
                     /old_locus_tag="Sbal_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845642.1"
                     /db_xref="GI:500171217"
                     /translation="MMKTPLIMLVLCSTLLTSGCAELACSARTDVDPYEPMRDKQRCV
                     AEADKNLYEYQKAKAAEEKQRLKTAIEQATQKSLI"
     gene            496757..497182
                     /locus_tag="SBAL_RS02235"
                     /old_locus_tag="Sbal_0437"
     CDS             496757..497182
                     /locus_tag="SBAL_RS02235"
                     /old_locus_tag="Sbal_0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845643.1"
                     /db_xref="GI:500171218"
                     /translation="MKGAGGTQGGTGQFFMGLAMMCGGFYLLFNAIQVSSSFGLGYGL
                     YRVNAFGQGMSITTGMVMLPFIIGIVMVFFDAKSKLAWLLSLGSLTALIVGVISSIQF
                     HFKSMSAFELIVILVLAFGGLGLFLRSLKDAPTSDIQAK"
     gene            497298..498176
                     /locus_tag="SBAL_RS02240"
                     /old_locus_tag="Sbal_0438"
     CDS             497298..498176
                     /locus_tag="SBAL_RS02240"
                     /old_locus_tag="Sbal_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845644.1"
                     /db_xref="GI:500171219"
                     /translation="MRWRDTDRSSNIEDRRGQQMASAGVPSALLLRFLPFLLRTKIGR
                     VVLLIGGIYFAFQYFTGGLSLDPSTQANLSQSQSSATTAVQDENAQFVAAILGTTETV
                     WGQLLKGQYREPKLVLYRNMISTGCGMGQAQSGPFYCPADSKVYIDLSFLDELKTLGA
                     PGDFAFAYVIAHEVGHHVQNLLGTSTKVRQAQQSGSKVQANQLSVALELQADCYAGIW
                     GHYVNQQLNLLEAGDLAEGIAAASAVGDDRLQQMAGRAVQPDAFTHGSSAQRVKWFKT
                     GFDSGNLASCNTFAAK"
     gene            498228..498665
                     /locus_tag="SBAL_RS02245"
                     /old_locus_tag="Sbal_0439"
     CDS             498228..498665
                     /locus_tag="SBAL_RS02245"
                     /old_locus_tag="Sbal_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_011845645.1"
                     /db_xref="GI:500171220"
                     /translation="MAFNDTFRLSSHAVITNAQGQVLLLKANYGNFAWGLPGGALEPG
                     ETIHEALVRECQEELGLSVQVNYLSGVYYHSAYQSQAFIFRCELLLPEVAKDGAENEP
                     LPIHLSHEHSEFAFHDIDTLSAVQQQRIKDCLNFNGVVMSAKF"
     gene            complement(498691..499890)
                     /locus_tag="SBAL_RS02250"
                     /old_locus_tag="Sbal_0440"
     CDS             complement(498691..499890)
                     /locus_tag="SBAL_RS02250"
                     /old_locus_tag="Sbal_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011845646.1"
                     /db_xref="GI:500171221"
                     /translation="MSHSALNSFDDFYQLLADSLAKNSLIKLLLSKYRGADKSLQRIT
                     IRPISLQNEPVLSFVYQHQTNHITKNLSYDEGLASIKLLLGSDFKSAHLATAQAEVQL
                     EISKKGKVQISTHNVKQAVAAPLEHDREKKRFVDIERPFLTKLGVTDSQHNLIPAMSR
                     KWKQINKFIEVFSQALEASPHKNDQPINVVDFGSGKGYLTFAIHDYLRHSLHNDAQVT
                     GVELRQALADLCNETAATLDHQGLSFVCGDVRTHAPKQTDVMIALHACDIATDYAIHY
                     GIRANADIIMCSPCCHKQIRPQMHSPELFKPMLQYGVHMGQQAEMVTDSLRALFLEAN
                     GYATKVFEFISLEHTNKNKMILAVKKPQQNQKDSAAILAQIADIKAYYGIKEHCLETL
                     LAQTQAD"
     gene            500566..500853
                     /locus_tag="SBAL_RS02255"
     CDS             500566..500853
                     /locus_tag="SBAL_RS02255"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620571.1"
                     /db_xref="GI:504433469"
                     /translation="MKSRFSYQEHDQASKKLQKIRDYLVFLTTELSNSYPQASEVAKH
                     AKKASDTVDLLRFALAEELHRESPEGLKIGALDFYQRQNNYGGKSSSDVDI"
     gene            501585..503753
                     /gene="uvrD"
                     /locus_tag="SBAL_RS02260"
                     /old_locus_tag="Sbal_0441"
     CDS             501585..503753
                     /gene="uvrD"
                     /locus_tag="SBAL_RS02260"
                     /old_locus_tag="Sbal_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084318.1"
                     /note="unwinds DNA duplexes with 3' to 5' polarity with
                     respect to the bound strand and initiates unwinding most
                     effectively when a single-stranded region is present;
                     involved in the post-incision events of nucleotide
                     excision repair and methyl-directed mismatch repair;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent helicase"
                     /protein_id="WP_006084318.1"
                     /db_xref="GI:493000802"
                     /translation="MDVSSLLDGLNDKQREAVAAPQSSMLVLAGAGSGKTRVLTHRIA
                     WLMQVEQQSPYSILAVTFTNKAAAEMRERVEKVAGTNMGRMWIGTFHGLAHRLLRTHF
                     QDAGLPQSFQILDSDDQVRLIKRILKSLNLDEKQYPPRQAQGYINGKKDQGLRPKHID
                     AGGFPLEQNLLKIYQVYQESCDRAGLVDFAEILLRAHELWLNKPHLLAHYQDRFKHIL
                     VDEFQDTNAIQYAWIRVLAGQTANVMIVGDDDQSIYGWRGAQVENLHRFLKDFPTATT
                     IRLEQNYRSKGNILKASNALIANNPERMGKELWTDEADGDPISLYCAFNEMDEARFIV
                     GRINDWHEKGGNLSDCAILYRSNAQSRVLEEALLHKGLAYRIYGGLRFFERQEIKDAM
                     GYLRLINNKDDDAAFERVVNTPPRGIGDRTLDILRSTARQHELTLWQASVRLLDEKVL
                     AGRAANSVRGFMDLIMTMREDTQDMVLYRMADTVIQASGLKAMYEAEKGEKAHARIEN
                     LEELVTAARTFEMPEELEDMGELNGFLSHAALEAGEGQADAFTDAVQLMTLHSAKGLE
                     FTMVFMAGVEEGIFPSKMALEEGDRLDEERRLCYVGMTRAMEKLYITYAESRRIYGRE
                     DYARPSRFIKEIPPQYVDEIRLKAQVSTPMANNRFSTQKSAATNDTGFNVGQRVNHPK
                     FGEGKVTNFEGSGAQGRVQVSFTDFGSKWLVVAYARLEAL"
     gene            503892..504752
                     /gene="ubiA"
                     /locus_tag="SBAL_RS02265"
                     /old_locus_tag="Sbal_0442"
     CDS             503892..504752
                     /gene="ubiA"
                     /locus_tag="SBAL_RS02265"
                     /old_locus_tag="Sbal_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZR1.1"
                     /note="catalyzes the conversion of 4-Hydroxybenzoate into
                     3-octaprenyl-4-hydroxybenzoate, as part of the ubiquinone
                     biosynthesis pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="WP_011845647.1"
                     /db_xref="GI:500171222"
                     /translation="MNLKRKWDVYSRLTRIDRPIGTLLLLWPCLMALMLAAGGMPDLK
                     VLVIFIIGVVIMRACGCIINDYADRDLDSFVERTRSRPLASGEISTKEALILFVILGL
                     SAFGLVLLLNGLVVKLSVVGIILTIIYPFTKRITNMPQMFLGIVWSWSIPMAYAAQTG
                     EVPMEAWWLFAANWCWTVAYDTMYAMVDRDDDLKVGIKSTAILFGKYDRQIIGLFQLA
                     ALACFIAAGWSADRGLLYGLGILTFVGFSTYQQMLIFDRERAPCFKAFLNNNWAGLAL
                     FVGLGADYLI"
     gene            complement(504749..505831)
                     /locus_tag="SBAL_RS02270"
                     /old_locus_tag="Sbal_0443"
     CDS             complement(504749..505831)
                     /locus_tag="SBAL_RS02270"
                     /old_locus_tag="Sbal_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TMAO reductase"
                     /protein_id="WP_011845648.1"
                     /db_xref="GI:500171223"
                     /translation="MHLTAFFARSLRICLLLILSSFVFAVQAAWYPADVIADGQKTLY
                     RPLAKANQAWRICALLPHGKDQYWWGVAFGLSQEAERQGVTLGIYDAGGYDKIEQQKQ
                     QLHDCYALKAQAYIIAANTADGLIADIEQLSAAGIPVIDLVNGIATDKLTSRSLVSFE
                     DMSVAATEYIAAQQREALNQESPKLKVAWFPGPKGASWVMAAEQGFRRAAAKQEFDTI
                     EGGYGTTELFVQADLVRKVLAKQSVDYVIANAVAATFAARFLDGRRNQTGKVIAFYSN
                     AQTIELVQKKQLLATVSDSPVLQARIAIDLAVRALEGAPYPHRVSPVIKVISQDNIHQ
                     IDLEQILAPENQWMIHQDLPSINGTR"
     gene            506166..506561
                     /locus_tag="SBAL_RS02275"
                     /old_locus_tag="Sbal_0444"
     CDS             506166..506561
                     /locus_tag="SBAL_RS02275"
                     /old_locus_tag="Sbal_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_011845649.1"
                     /db_xref="GI:500171224"
                     /translation="MFIPPGFSRVSPYMIINNADSLVAFMQKAFDAKALHISHRLDGK
                     IANAQMQIGDCLFMLSEASEAFPPMPASYYLYVEDADKSVAQALAAAGELIMAVADKP
                     YGDRQGGVRDPVGNLWWISQRLAAGPYQD"
     gene            506596..507645
                     /locus_tag="SBAL_RS02280"
                     /old_locus_tag="Sbal_0445"
     CDS             506596..507645
                     /locus_tag="SBAL_RS02280"
                     /old_locus_tag="Sbal_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_011845650.1"
                     /db_xref="GI:500171225"
                     /translation="MPCQLTRLFGIELPIIQAPMAGVQGSALTIAVSQAGALGSLPCA
                     MLSLEALDAALTQIRAQTTKPINVNFFCHHEPEPQAAKQAAWLKQLAPYFAELGIHPD
                     TQAAGAQRAPYTSAQAEVLAKFKPEVVSFHFGLPNEDLLLEIKSWGSKIISTATTVEE
                     ALWLEARGVDAIIAQGLEAGGHRGHFLSDDLTEQHGTFSLLPQIIAAVDVPVIAAGGI
                     VDAKTVRAAMAMGASAVQVGTAYLLCPECTTSEIHRAALQSEAAQHTALTNLFSGRPA
                     RGIVNRFMAELGPINNAVPDFPLASSAVAGLRSAAEQQGFGDFSPLWCGQNATGCQAI
                     PAAELTKQLALGLIV"
     gene            507867..508784
                     /locus_tag="SBAL_RS02285"
                     /old_locus_tag="Sbal_0446"
     CDS             507867..508784
                     /locus_tag="SBAL_RS02285"
                     /old_locus_tag="Sbal_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014358105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin"
                     /protein_id="WP_014620573.1"
                     /db_xref="GI:504433471"
                     /translation="MLLRQIIVMCLAVVSFATFAGDKAYQDIALKTYPEQQQVTLGSV
                     AGNKPIYLKFWATWCQPCMEQMPHFEALQKKYQDKINIVAVNININEEQPKIADVIAR
                     FGLTMPVWLDNEGELGVALGLVGTPYSVLINRGGDVVYTSHESDANLDKFIDMLANGQ
                     ELTAQTTEAPSAEQTAKLLKPWEQGEHLLFFTATWCDWYLAESRPEMSKECIAVQKGL
                     NNLAQKVTNKAWHGVVNHLWTDDKALEDFKQLYQTKIDFSIDELGVLFNHFKIRNIPT
                     LLWVKDGKVIQRITDFSQPEQLVKQLSAQ"
     gene            509008..510090
                     /locus_tag="SBAL_RS02290"
                     /old_locus_tag="Sbal_0447"
     CDS             509008..510090
                     /locus_tag="SBAL_RS02290"
                     /old_locus_tag="Sbal_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011845652.1"
                     /db_xref="GI:500171227"
                     /translation="MTPIFSNAAIGRSLLILLLCAGVFFFIDFLVPALAALIVCFSSW
                     PLYQKLLAKCGGRSALAATIALCCIVLGLIIPLVFVFSYALQEIRTWVDWLVFTNQHG
                     SPVPLWIKDLPWMGEWLTLQWQQFIGEPHELGKIISAISGQNLSGISRWVLQLGWNTL
                     GLLLTLLFMLITLFFLYKDGEQVAKQLDIVGERVLPARWHSFSRVVPATVSSTVIGMT
                     LIAIGEGIVLGIAYWIAGVPSAVAFGVLTAFMALVPGGAPTMFTLISLYLVGTGDMTA
                     GVGLFLWGSIELFIVDKTLRPNLVGGPIKLPFLPTFFGLIGGVKTMGFVGLFVGPVLM
                     ALLVAIWREWLREEPEIIQSDKQAGS"
     gene            complement(510094..510390)
                     /locus_tag="SBAL_RS02295"
                     /old_locus_tag="Sbal_0448"
     CDS             complement(510094..510390)
                     /locus_tag="SBAL_RS02295"
                     /old_locus_tag="Sbal_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mitomycin resistance protein"
                     /protein_id="WP_011845653.1"
                     /db_xref="GI:500171228"
                     /translation="MNPAKVVRAEVKQLTDLPNIGKACAADLRLLGIDKPEQLLGQNP
                     YDLYQTLCNKTGQRHDPCMIDVFISITRFMAGEDAKPWWFYTDERKNTLGQTKP"
     gene            complement(510505..511092)
                     /locus_tag="SBAL_RS02300"
                     /old_locus_tag="Sbal_0449"
     CDS             complement(510505..511092)
                     /locus_tag="SBAL_RS02300"
                     /old_locus_tag="Sbal_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_041409049.1"
                     /db_xref="GI:752761931"
                     /translation="MKLTSLTQPIYDHLYRDISEFRSTFDLPVSDVDSLDDKADTLHT
                     SLIIEELTELAEADSRIEQADAIVDSVYVLMGRLVHVGAQAMTDRLEISYLIDLLLCV
                     AKNREIDFIRCWDEVHSSNMSKVCRNEQELTETIAFYAKQGVEIVGSQQGEFIIAKCA
                     KDVEMAGKVVRQGKVLKSVYYRPADLTTLVKAQVL"
     gene            511320..513434
                     /locus_tag="SBAL_RS02305"
                     /old_locus_tag="Sbal_0450"
     CDS             511320..513434
                     /locus_tag="SBAL_RS02305"
                     /old_locus_tag="Sbal_0450"
                     /EC_number="3.4.24.71"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M13"
                     /protein_id="WP_011845655.1"
                     /db_xref="GI:500171230"
                     /translation="MSDRLIPALLLSTSVLTGLTACSDNTTENTVKTSESAPKSQDVA
                     AQMPVGINVAAMSPTVKPGDDFYTYANGEWMKTTMIPADRSSTGAFLVAFEATEKHKT
                     SLIADLVKAQHAAGSDEARIADFYKAYTDTAAIDAAGMKPAEADIARYEAIASKQDLS
                     AALGENLRADVDPLNATDFHTENLFGIFVTQGLATPGEVLPYFLQGGLGLPEREYYLS
                     ADPKMDEIRTAYRAYIETLLKDAGVSDAAARADRIFALESKIAAAHASREDSEDFAKS
                     SGVWSRADFDAKAPGIDWTAFLAAAQLGNQPKFAAYHATAITGLSALVASEPLEAWKD
                     WLVFHQINSHADVLPSTIDNASFAFNGTKLSGTPEQRGRDKRALAALDQYLGDAVGHA
                     YAEQYFPASAKAEVSTMVDNIVAAFGQRVEKIDWMDPSTKKEALAKVATMAVGVGYPD
                     KWRNYDSYAVTATNAYANAINGEKVEYSHQLAKIGKPMDKGEWWMTPQVVNAVNLPVQ
                     NALNFPAGILQPPFFDAKADAAYNYGAIGAVIGHEISHSFDNNGAAFDSTGAMRNWWT
                     PADFAQFAKQGDALAGQFDTYAPFPDLHVNGKLTLGENIADVAGLAAALDAYHASLKG
                     KEAPVIEGFTGDQRFFIGFAQTWATKMRDEALRARVATDGHAPGMYRALTVRNLDAWY
                     SAFDVKPGDKLYLAPEDRVKIW"
     gene            complement(513487..515880)
                     /locus_tag="SBAL_RS02310"
                     /old_locus_tag="Sbal_0451"
     CDS             complement(513487..515880)
                     /locus_tag="SBAL_RS02310"
                     /old_locus_tag="Sbal_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="9-hexadecenoic acid cis-trans isomerase"
                     /protein_id="WP_011845656.1"
                     /db_xref="GI:500171231"
                     /translation="MDAIKRIWKRLLLATVLLATGCASVAQIDFNALFGTSSPQKRVE
                     NAQLNNQFVQQAEFVHKEVEPILNSRCVVCHACYDAPCQLKMTSSEGIERGASKEKVY
                     QGTRLVAATPNRLFVDAFTPEAWRQRGFYPMLNERNQTPEANTQASVLARMLTLKQMH
                     PLPEDKILDKRFDFSLDRVQQCASLEEMDKYEQSQPFAGMPYGLPALNANEHQVLMHW
                     LEQGAPLPFAPSLAPEFITEITHWEQFLNGDSLKSQLSARYIYEHLFAFHLYFESLNQ
                     PNAQPLFFELVRSRTPPGQALDIIASRRPFDDPKVERVYYRFRPYRATIVDKTHIPYA
                     LNTSLLHDWLQWFIDADYSVTQLPSYQPSIAANPFEAFIQIPAGARYRFMLNRAQDTI
                     MGFIKGPVCRGQVALNVINDRFWVYFVTPDYMDDTDFRTFYHSQIENLRMPAEEESTA
                     LAVTWVKYAAKQGKYMRARNQFLNEKFKNGQHLTIDGLWDGDDSNDNASLTVFRHFDN
                     ATVVKGLVGEPPKTAWIIDYALLERIHYLLVAGFDVYGNYGHQLLTRLYMDFLRMEGE
                     SNFLTLLPQEERRKQFSDWYQGAGTQLTAFIAGDINTFNQPTGVLYYSDYLKGELYQK
                     LGQKVAKVQPNRYQIENSHLQANSKALLQALGRLKGTQATLLPELTMIMVEPEKAGKA
                     EVFTLVRNSAHRNISSLFNEASNREPAKDDVTLVHGLLGSYPEAFWLVKEQDLPKIVA
                     AVEQMQTEKDYEALLDIAAVRRSDPTFWAFSDKLNQIFFDNHPIESGWLDYNRLQNR"
     gene            516143..516772
                     /locus_tag="SBAL_RS02315"
                     /old_locus_tag="Sbal_0452"
     CDS             516143..516772
                     /locus_tag="SBAL_RS02315"
                     /old_locus_tag="Sbal_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="WP_011845657.1"
                     /db_xref="GI:500171232"
                     /translation="MTADNRYFYEPSKGHGLAHDPLNAIVGPRPIGWISSRNAEGQRN
                     LAPYSFFNCFNYKPPIIGFASTGWKDSVANIVETGEFVWNLTTRGLAEQMNQTSAMLP
                     RGQDEFSFAGLTAKAGTIVKADLVAESPVNFECKLSQCIQLTAANGDKIDTWLVLGEV
                     VAVHIAKHLLNAEGIYQTALAEPVLRAGGPSAYYGISEDLRFDLHRPQV"
     gene            complement(517294..519201)
                     /locus_tag="SBAL_RS02320"
                     /old_locus_tag="Sbal_0453"
     CDS             complement(517294..519201)
                     /locus_tag="SBAL_RS02320"
                     /old_locus_tag="Sbal_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845658.1"
                     /db_xref="GI:500171233"
                     /translation="MKKYLVALLGCIAALFCFTQKNSNSSSYFNDTIETTQPSTSSSA
                     TLEKEITQTKLKAPNNYHSCQQLIASEKETHWNWAREQEWDQWLDKGYSIDDITLAID
                     HFLNSNFAANWRAKMLKKNSQLNQQNQSLTEQVKALVPDLPSFVLIGRSIPQSQIENI
                     ATLSQADALALIKETKLTIDDVDWLLKQDSLSQQLLLQAIENIDDTDALIGFGIQENE
                     TLHLIDTAAYYGRDQIVTTLLEKNSVLSDDAYLGTTMEYALDRLDDYFHMNIPLEDDL
                     IVRQVKIIKALHGLNSTANFSIQSDQKAVGFFPRHGYSFDAQQMTNLQQMYGLTLTEI
                     RPKTALTFDPNSALLTELNTNFAQLHANSATPEAIADCQSLVHKIDSQWQPHNLSYFS
                     DKLIKEGKEVTASNLNHIDPALTDCFNYQQRQPLPRRQSGNHSLDNTIYGLAAQNKIN
                     EAIKMVEYAQLEEAVNREFFYQLLGYNPEYFTELQLSQLRQETFNYDALYRMAHTRTI
                     SLISEGLDIDKLDYTGKSWLDIAIMEHDLPLLNYLVNQHISYPYRESGRDPLYLLLDT
                     NHYKFNPEHLLEYLSLLMVLEPKVYPQHQRLMSLIRLKFPESYTQITNQFPTLIAKED
                     IPLPPAVCLNF"
     gene            520194..520694
                     /locus_tag="SBAL_RS02325"
                     /old_locus_tag="Sbal_0454"
     CDS             520194..520694
                     /locus_tag="SBAL_RS02325"
                     /old_locus_tag="Sbal_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011840005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011840005.1"
                     /db_xref="GI:500165389"
                     /translation="MARYSPERKEAILKKLLPPHNLTVAEVAREEGIAVQTLYHWRDI
                     ARKEGRPVPGKTLTADDWSAEAKFAVLIETAPLSEAEISQYCREKGLYREQVQQWKLE
                     CLSGFQTSEVQTKTIKQQAKADKAEIKSLQRELRYKEKALAEAAALLVLRKKLNVLWG
                     DDSEES"
     gene            520700..521749
                     /locus_tag="SBAL_RS02330"
                     /old_locus_tag="Sbal_0455"
     CDS             520700..521749
                     /locus_tag="SBAL_RS02330"
                     /old_locus_tag="Sbal_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011789366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011840006.1"
                     /db_xref="GI:500165390"
                     /translation="MPERIALIALIQEAYTQGARLYKACAETGLSKRTYRRWYREGQV
                     QADLRPTAARPEPANKLEEHERQQILSVCNQAEYASLPPSQIVPTLLDNGIYIASESS
                     FYRVLNAHGQLNHRGRTQATVNRSKPLSYRADGPNQVWSWDITYLASTVKGQFYYLYL
                     FEDIYSRKIVGYEVHEQENGEYAAALIQRSLLREQCFNTPLVLHSDNGAPMKSLTMKA
                     KLEELGITASLSRPRVSNDNPFSESLFKTLKYRPQWPASGFSCLATAREWVEKFVSWY
                     NDEHKHSQLNFVSPGQRHALQDGAILAKRKKVLEAAKERKPMRWSTEIRNCEAVGAVT
                     LNPDKAPVEGVINAA"
     gene            complement(521771..522514)
                     /locus_tag="SBAL_RS02335"
                     /old_locus_tag="Sbal_0456"
     CDS             complement(521771..522514)
                     /locus_tag="SBAL_RS02335"
                     /old_locus_tag="Sbal_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845659.1"
                     /db_xref="GI:500171234"
                     /translation="MPKSILSPIIPITSTQSIFDTVGKSENNFSKNVKSVRNIQNVAA
                     KISPRVFNHNGIALSQTGHAKQLVILTHGGWKELENKSTTFRRQVGDGWTHVPTGLRI
                     DFYTEDKNFTKGPSVLSEVNKRPNDALKGLEPHLGLSESDLLLLANSRNKSVESIRDD
                     MLNLATYKKDGVTEGERVKDYALYHHENTHALIQQHQNEKYSPDVDIALVTDKKHKRH
                     LSDIFETIKKSGAEYQVIHFGACRRCFSR"
     gene            523114..523743
                     /locus_tag="SBAL_RS02340"
                     /old_locus_tag="Sbal_0458"
     CDS             523114..523743
                     /locus_tag="SBAL_RS02340"
                     /old_locus_tag="Sbal_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="WP_011845660.1"
                     /db_xref="GI:500171235"
                     /translation="MTADNRYFYEPSKGHGLAHDPLNAIVGPRPIGWISSRNAEGQRN
                     LAPYSFFNCFNYKPPIIGFASTGWKDSVANIVETGEFVWNLTTRGLAEKMNQTSAMLP
                     RGQDEFSFAGLTAKAGTIVKADLVAESPVNFECKLSQCIQLTAANGDKIDTWLVLGEV
                     VAVHIAKHLLNAEGIYQTALAEPVLRAGGPSAYYGISEDLRFDLHRPQV"
     gene            524284..524595
                     /locus_tag="SBAL_RS02345"
                     /old_locus_tag="Sbal_0459"
     CDS             524284..524595
                     /locus_tag="SBAL_RS02345"
                     /old_locus_tag="Sbal_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006085772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_006081424.1"
                     /db_xref="GI:492991518"
                     /translation="MRSTTRKTFSAEFKLEAAQLVLDKNHSIIEAAKAMNVGKSTMDK
                     WVRQLKLERQGGIPKASPITPEQIEIRELKKQIARLEEHNLILKKATALLMSDSMNNL
                     R"
     gene            524595..>525257
                     /locus_tag="SBAL_RS02350"
                     /old_locus_tag="Sbal_0460"
     CDS             524595..>525257
                     /locus_tag="SBAL_RS02350"
                     /old_locus_tag="Sbal_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000584438.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041410795.1"
                     /db_xref="GI:752763679"
                     /translation="MSALKQSHSILTICNAFKVHRSSYKYWLKRKENIDADFTILCSE
                     VKAAHRISHGSAGARTIAQLVTNKGIGLSRYRARNLMKKLGLLSCQQPKHSYRKATQE
                     HVAIPNTLNRQFAVTQPDQVWCGDVTYVWVGNRWAYLAVVLDLFSRKPVGWALSLSPD
                     SELTCKALKMAFELRGKPENVIYHSDQGSHYTSLKFRQLIWRLQIEQSMSRRGNCWDN
                     API"
     gene            525359..526561
                     /locus_tag="SBAL_RS02355"
                     /old_locus_tag="Sbal_0461"
     CDS             525359..526561
                     /locus_tag="SBAL_RS02355"
                     /old_locus_tag="Sbal_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011623001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011845662.1"
                     /db_xref="GI:500171237"
                     /translation="MRDIDILHDLLKKQCPQIHQKRLNSLMVATESLLDGNQLSLTQL
                     GRNITGNVAPKHNIKRIDRLLGNLHVVKDKFAIYQWHAQYLCGSNPMPIILVDWSDVR
                     EQLRMMTLRASISVKGRSITLYERTFLFEDYNAPRSHNTFLAELANVLPPRCCPLIVT
                     DAGYRNTWFREVERHGWFWLGRVRGDVSFMLNGQTSWQSNKSLYPKANSTAKYIGSVK
                     LARKSPLQCCLHLFKAKPKLRKDKRSSKAGRNHTAQKSYSLGSKEPWLLATNLPPDYF
                     GPSKVVDLYAKRMQIEETFRDLKSPQYGMGLRQSRSRCPKRYDVLLLIAMLAEIVLWC
                     IGLAAQHLGWQRYFQANTVRKRAVLSIVRLGKEVRKRDKYPVKETIFRWALIEYINLV
                     HDAGRPQL"
     gene            527112..528149
                     /locus_tag="SBAL_RS02360"
                     /old_locus_tag="Sbal_0463"
     CDS             527112..528149
                     /locus_tag="SBAL_RS02360"
                     /old_locus_tag="Sbal_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845663.1"
                     /db_xref="GI:500171238"
                     /translation="MEIVMADLFIPKTSITPENYKNFFSSGDFDQFSQVNNILGQYAP
                     PNRLYVAPSQCTVNDPTSFDLQALPPETRNKIKQMVDNYGEDITLAIAELFDGIDVSS
                     VTSNAIGLAGAVQGYASNRSSLIMNSMNEINTLMVEHNNKLKNAIGGLSDVHAARARE
                     EMIKMKVNKLNERFSSEISRLVNKQKLLRRSHFVNSERAVNMARNSRNTTRFSVASRA
                     EFRKLVNMSKYVKIIGRRLIALDLGFRAYSVVRDCSAGKNCIRAGIGEIAGAAAGIGT
                     AYVGFTALGYAGAAVGAVVSGPFLVLVLAVGAATVLVGSTIASDNAKGFAQSVYDYFT
                     DNEPEIDAYTY"
     gene            528133..528483
                     /locus_tag="SBAL_RS02365"
     CDS             528133..528483
                     /locus_tag="SBAL_RS02365"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620575.1"
                     /db_xref="GI:504433473"
                     /translation="MHILTDAQRIFFILLMWADFVFAVGLHIWYRLKVVKKYDAVLLK
                     SGIPHQSFDLMGGRIFLYMRAALSPAWFDKMHRKENLFDPKLLAPHVTRFDKILMLVQ
                     LVVIPLFFILLFIL"
     gene            complement(528605..529315)
                     /gene="fre"
                     /locus_tag="SBAL_RS02370"
                     /old_locus_tag="Sbal_0464"
                     /gene_synonym="fadI"
     CDS             complement(528605..529315)
                     /gene="fre"
                     /locus_tag="SBAL_RS02370"
                     /old_locus_tag="Sbal_0464"
                     /gene_synonym="fadI"
                     /EC_number="1.5.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845664.1"
                     /note="NAD(P)H-flavin reductase; catalyzes the reversible
                     oxidation/reduction of NAD(P) and flavine mononucleotide;
                     in Salmonella and E. coli this protein also reduces
                     aquacob(III)alamin to cob(II)alamin; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_011845664.1"
                     /db_xref="GI:500171239"
                     /translation="MKTIRCKIEKVSPFNDAVYQVLLRPETAFDFQAGQYLCVVMGEK
                     DKRPFSIASAPNAELIELHIGAAVSESYPMQVVERLKACALDGSTIDIEAPGGEAHLR
                     HESQRPRLLIAGGTGFSYIKSIVEHQIAIGQQVKTTLYWGCRTQDAMYFEAIARQWHD
                     AHPWLNFVPVIEEAPANWQGKTANLLAQIKQDFVSLNGYDIYIAGRFDMVGAAREIFR
                     EIGVEEAHLYGDAFAFIK"
     gene            complement(529430..530911)
                     /locus_tag="SBAL_RS02375"
                     /old_locus_tag="Sbal_0465"
     CDS             complement(529430..530911)
                     /locus_tag="SBAL_RS02375"
                     /old_locus_tag="Sbal_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007650916.1"
                     /note="catalyzes the decarboxylation of
                     3-octaprenyl-4-hydroxy benzoate to 2-octaprenylphenol;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="WP_011845665.1"
                     /db_xref="GI:500171240"
                     /translation="MSFKDLRSFIDHLEANGELKRISYPVDPHLEMTEIADRVLRAKG
                     PALLFENPKDHHMPVLVNLFGTPKRVAMALGKDDPLALREVGELLAFLKEPEPPRGFK
                     DAIAKIPMFKQALNMPPKTVRNPPCQQVIKTGDEVDLTQLPIQHCWPGDVAPLVTWGL
                     TITKGPRKSRQNLGIYRQQLLGKNKLIMRWLSHRGGALDFADFKQQFPGERYPVVVAL
                     GADPVTILGAVTPVPDSMSEYAFAGLLRGERTEVCKALSCDLEVPATSEIILEGYIGP
                     EELAEEGPYGDHTGYYNETDKFPVFTVTHITHRKDAIYHSTYTGRPPDEPAMLGVALN
                     EVFVPILRKQYPEIVDFYLPPEGCSYRMAVISIRKQYPGHAKRVMMGAWSFLRQFMYT
                     KFIVIVDEDVNCRDWQDVIWAITTRMDPKRDTVMIENTPIDYLDFASPVAGLGSKMGL
                     DATNKWEGETNREWGTPIVMDPKVKQKIDSIWDELGIDDSPTL"
     gene            531071..531880
                     /locus_tag="SBAL_RS02380"
                     /old_locus_tag="Sbal_0466"
     CDS             531071..531880
                     /locus_tag="SBAL_RS02380"
                     /old_locus_tag="Sbal_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845666.1"
                     /db_xref="GI:500171241"
                     /translation="MNIPVKFTQGKCVQSQSHGVFKRPLKCLVLSLAVGISLLGALSV
                     STAAVAGHRDHSEQGERQGHRDSHSRGESHYNNRHDNHYDNRHVRNDNRHYRPYYRPY
                     YPWGLGLGLGLATGWGSGWNVGYGVNSQWNNDWGWNTSRDAYARNYWNSPYSGIGLSI
                     PMRYDDEPVAISTPVRVTTSMQYSASEGRMVSSMPVNMAGQSTGQLVSQASNAASKTA
                     AIPSPRAAHSVSSLPSNARVVQQDGRTLYEWQGTLYAFDWNSQTYQEQLAR"
     gene            531990..533213
                     /locus_tag="SBAL_RS02385"
                     /old_locus_tag="Sbal_0467"
     CDS             531990..533213
                     /locus_tag="SBAL_RS02385"
                     /old_locus_tag="Sbal_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_006084278.1"
                     /db_xref="GI:493000704"
                     /translation="MDIAQNQAAQNKAKGASTLWVLLALALGTFALGTTEFASMTLVP
                     YIASDLGVDVAHVSYAISAYALGVVVGSPIIMVLAVRVRRRTLLIALAALMAVANGLS
                     ALAPSLNWLIFFRFLSGLPHGAYFGVAMLLAASLVPPEMKARAVSRVIIGLTLATIIG
                     VPFATWMGQTVGWRSGIGIVAILATITAVMVYFLAPDQAVAADASPRKELQTLKNREV
                     WLTLGIAAIGFGGIFCVYTYLAETLIQVTQVEPFKIPIMMAVFGIGATLGTLVCGWAA
                     DKSALAAAFWSLVLSTVVLAIYPSLTGHYWALMPVVFFVGCGLGLATIVQARLMDVAP
                     DGQAMTGALVQCAFNLANAIGPWVGSLVILSGQGIAATGYAASLLSLGGLVMWWLTHR
                     ESRRAVSLNTANCAD"
     gene            complement(533302..533979)
                     /locus_tag="SBAL_RS02390"
                     /old_locus_tag="Sbal_0468"
     CDS             complement(533302..533979)
                     /locus_tag="SBAL_RS02390"
                     /old_locus_tag="Sbal_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011845667.1"
                     /db_xref="GI:500171242"
                     /translation="MILITGASSGLGAAIASLYAKENEPLTLTGRNAERLQTVANALT
                     PFSNKPIAAITADLASESSLEALFDGLTQAPKTVIHCAGSGYFGAIETQGASDIHSLL
                     NNNVTSTILLVRELVKRYKDQTVTVVVVMSTAALAAKAGESTYCAAKWAVRGFIESVR
                     LELKQSPMKLIAVYPGGMDTGFWPSSGKALDTSSFMSADEAAGMLKQALVATEHGYIA
                     DITIQRA"
     gene            complement(534061..534510)
                     /locus_tag="SBAL_RS02395"
                     /old_locus_tag="Sbal_0469"
     CDS             complement(534061..534510)
                     /locus_tag="SBAL_RS02395"
                     /old_locus_tag="Sbal_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090313.1"
                     /note="composes the biotin carboxyl carrier protein
                     subunit of the acetyl-CoA carboxylase complex, the enzyme
                     that catalyzes the carboxylation of acetyl-CoA to
                     malonyl-CoA, which in turn controls the rate of fatty acid
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein"
                     /protein_id="WP_011845668.1"
                     /db_xref="GI:500171243"
                     /translation="MAMDLRKIKKLIELVQESDIAELAITEGEESIRITRYSPMPANV
                     QSSQTLPTVRVAPLNTQAKQTAVSPSAEGFVQVSPMVGTFYAAAELDDVPLVKVGQKV
                     SQGEVVCIIEAMRMMNPIQAERDGVVSAIWAKDGDEVAFDQPLFTLI"
     gene            complement(534546..534986)
                     /locus_tag="SBAL_RS02400"
                     /old_locus_tag="Sbal_0470"
     CDS             complement(534546..534986)
                     /locus_tag="SBAL_RS02400"
                     /old_locus_tag="Sbal_0470"
                     /EC_number="4.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_011845669.1"
                     /db_xref="GI:500171244"
                     /translation="MSHKILLVNGPNLNLLGRREPSVYGHQTLADIVAELKQQAKLAE
                     VELEHIQSNAEFELINAIHATDAQMIIINPAAFTHTSVALRDALLGVAIPFFEVHLSN
                     VHAREAFRHHSYFSDKAIGVICGFGSQGYEFALAAAIKRLNQPQ"
     gene            complement(535220..535636)
                     /locus_tag="SBAL_RS02405"
                     /old_locus_tag="Sbal_0471"
     CDS             complement(535220..535636)
                     /locus_tag="SBAL_RS02405"
                     /old_locus_tag="Sbal_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014358104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_041408643.1"
                     /db_xref="GI:752761525"
                     /translation="MIKISNRVELQENEIEWQFIRSSGAGGQHLNKVSTAAQLIFDIK
                     SSSLPEFYQERLLNKADHRITKSGKIIIKCQASRSQDANRQTALEQFIALVASVGEVQ
                     KKRIPTRATKGSQTRRLESKKQKGATKAMRQQKTDY"
     gene            535788..536153
                     /locus_tag="SBAL_RS02410"
                     /old_locus_tag="Sbal_0472"
     CDS             535788..536153
                     /locus_tag="SBAL_RS02410"
                     /old_locus_tag="Sbal_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845671.1"
                     /db_xref="GI:500171246"
                     /translation="MLCQIPDIAKGVISLFASGRLSSTDYRTRLQPAIKSYRKDWGQV
                     CLYIEADVLLEGWEFESLTGSGEVQLPNFEALVFVGGPDWVGNAVRLLGPFMQGEVAW
                     FPLEQKTKAIAWITKRSNI"
     gene            536190..536399
                     /locus_tag="SBAL_RS02415"
                     /old_locus_tag="Sbal_0473"
     CDS             536190..536399
                     /locus_tag="SBAL_RS02415"
                     /old_locus_tag="Sbal_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079957.1"
                     /db_xref="GI:492987546"
                     /translation="MSLFKSRAFSKQNVSKISAIALVLAFTAGLSACAPEVGSDAWCK
                     QMKDKPSGDWTANEAADYAKHCVFK"
     gene            536620..537072
                     /locus_tag="SBAL_RS02420"
                     /old_locus_tag="Sbal_0474"
     CDS             536620..537072
                     /locus_tag="SBAL_RS02420"
                     /old_locus_tag="Sbal_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845672.1"
                     /db_xref="GI:500171247"
                     /translation="MVILLIAIIVLQFAGANLGAHQLHAGNGAEEADNHPHLQFSAQV
                     TTLAQCVDCVCPSEQALGFTDIDASTEVLGNNVGENHASELHSHLVKTTELQDFDLCL
                     DCQCHGGHVALLSPGLSQPVQALESVFLAANLSYFQPDNLPKYRPPIA"
     gene            537444..538916
                     /locus_tag="SBAL_RS02425"
                     /note="transporter; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            538927..540249
                     /locus_tag="SBAL_RS02430"
                     /old_locus_tag="Sbal_0477"
     CDS             538927..540249
                     /locus_tag="SBAL_RS02430"
                     /old_locus_tag="Sbal_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter MFP subunit"
                     /protein_id="WP_011845675.1"
                     /db_xref="GI:500171250"
                     /translation="MNSHNHFNATKSYPVAISDTAAPDIITSQITAPEIIAPQITVPA
                     KRQFTLSTLALALCVLGSAALFTSQPSWAGDDHGSATQTEQADEHGAQALKLTQVQQA
                     LAGISLLPLSSDSLNIANLNLDIRATATLVVDRDRTATLAPQLDVRVLARHVVPGQEV
                     KKGEPLLTLGGSAVAQAQADYINAAAEWSRVKRMSEGAVSVSRRMQAQVDAELKRAIL
                     EAIKMTPAQIRTLESTPEAIGSYQLLAPIDGRVQQDIAMLGQVFSAGTPLMQLTDESY
                     LWVEAQLTPTQTAHITVGSAALVQVGDKTLAGKIIGRSHELDSVTRTEQVLVSMPNPD
                     HVLHAGQFAELYFANTVANSADKAGGIVLPDAALTRSGDGDWQIFIQDEDGFESIEVE
                     VVLRQRGLNLVRGPELEKAQQAQLKVVVAGAFFLASEQAKAGFDIHNH"
     gene            540280..543486
                     /locus_tag="SBAL_RS02435"
                     /old_locus_tag="Sbal_0478"
     CDS             540280..543486
                     /locus_tag="SBAL_RS02435"
                     /old_locus_tag="Sbal_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C peroxidase"
                     /protein_id="WP_011845676.1"
                     /db_xref="GI:500171251"
                     /translation="MLQKVIEAAIKNRLLVVLALLAMIVASVVMLPKLNLDAFPDVTN
                     VQVTINTAAEGLAAEEVEKLISYPVESAMYALPAVTEVRSLSRTGLSIVTVVFAEGTD
                     IYFARQQVFEQLQAAREMIPSGVGVPEIGPNTSGLGQIYQYILRAEPNSGIDAAELRS
                     LNDYLVKLIMMPVGGVTEVLSFGGDVRQYQVQVDPNKLRAYGLSMAQVTEALESNNRN
                     AGGWFMDQGQEQLVVRGYGMLPAGEQGLAAIAQIPLTEDKGTPVRVGDIAQVDFGSEI
                     RVGAVTMTRRDEAGKVQNLGEVVAGVVLKRMGANTKATIDDIGARVSLIEQALPDGVS
                     FEVFYDQAELVDKAVTTVRDALLMAFVFIVVILALFLVNIRATLLVLLSIPVSIGLAL
                     MVMSYYGLSANLMSLGGLAVAIGMLVDGSVVMVENIFKHLTQPDRRHLLEARTRADGE
                     ADPYHSDEDGGQQANMAVRIMLAAKEVCSPIFFATAIIIVVFAPLFALEGVEGKLFQP
                     MAVSIILAMISALLVALIAVPALAVYLFKRGVVLKQSVVLGPLDAAYRKLLTATLARP
                     KVVMLSALLMFALSLLLLPRLGTEFVPELEEGTINLRVTLAPTASLGTSLAVAPKLEA
                     ILLEFPEVEYALSRIGAPELGGDPEPVSNIEVYIGLKPISEWQSASSRLELQRLMEEK
                     LSVFPGLLLTFSQPIATRVDELLSGVKAQLAIKIFGPDLAVLSERGQALTDLVAKIPG
                     AVDVSLEQVSGEAQLVVRPKRELLARYGISVDQVMSLVSQGIGGGSAGQVIDGNARYD
                     INVRLAAEFRTSPDAIKDLLLSGTNGATVRLGEVASVEVEMAPPNIRRDDVQRRVVVQ
                     ANVAGRDMGSVVKDIYALVPQADLPAGYTVIIGGQYENQQRAQQKLMLVVPISIALIA
                     LLLYFSFGSFKQVLLIMANVPLALIGGIVALYVSGTYLSVPSSIGFITLFGVAVLNGV
                     VLVDSINQRRQSGEALYDCVYEGTVGRLRPVLMTALTSALGLIPILLSSGVGSEIQKP
                     LAVVIIGGLFSSTALTLLVLPTLYRWLYRGDKRIDELD"
     gene            543658..543981
                     /locus_tag="SBAL_RS02440"
                     /old_locus_tag="Sbal_0479"
     CDS             543658..543981
                     /locus_tag="SBAL_RS02440"
                     /old_locus_tag="Sbal_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_006079962.1"
                     /db_xref="GI:492987551"
                     /translation="MIAVIFEVIPTQEGKEEYLHVAAEMRQYLEGRKGLISIERFQSL
                     TDDGKVLSLSFWEDQASITQWRNQMAHSIAEQTGIVPCLFNSYRIRVAEVVQDYSETV
                     HIEAE"
     gene            complement(544075..544485)
                     /gene="mscL"
                     /locus_tag="SBAL_RS02445"
                     /old_locus_tag="Sbal_0480"
     CDS             complement(544075..544485)
                     /gene="mscL"
                     /locus_tag="SBAL_RS02445"
                     /old_locus_tag="Sbal_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZU7.1"
                     /note="forms homopentamer; channel that opens in response
                     to pressure or hypoosmotic shock; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="large-conductance mechanosensitive channel"
                     /protein_id="WP_006084265.1"
                     /db_xref="GI:493000666"
                     /translation="MSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPP
                     IGIILGGVNFSDLSIVLQAAQGDAPSVVIAYGKFIQTIIDFTIIAFAIFMGVKAINRL
                     KRKEEVAPKAPAAPTKDQELLSEIRDLLKAQQEK"
     gene            complement(544703..545647)
                     /locus_tag="SBAL_RS02450"
                     /old_locus_tag="Sbal_0481"
     CDS             complement(544703..545647)
                     /locus_tag="SBAL_RS02450"
                     /old_locus_tag="Sbal_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_006084264.1"
                     /db_xref="GI:493000663"
                     /translation="MMDLNRVQIFAQVVEQGSFTGAAKALGITKATVSRKIAELEADT
                     GTQLLFRTTRALKLTEAGSSYYNRINKILTDLQSAENQLSAQQQLIKGNLKIVCPIEL
                     GQLFLGPIFAQFLTLYPDITIEAELTNRKVDVIEEGIDLLFQIADSGDTRLQSYALVN
                     AHKSLMASPAYLAEHGTPKVPQDLAKHKAIRLQSAHIEGAWKLFDGKTWIVAEPMTQL
                     TVNNVTLAREAAIAGLGITAVPSIIAQVALEKGYLIPLLDDYPMVQTKVVLSYPQRAY
                     LPRKYRVFIEFIYSALFKRWGSQVLEVPDFIGQADQGE"
     gene            545742..546800
                     /locus_tag="SBAL_RS02455"
                     /old_locus_tag="Sbal_0482"
     CDS             545742..546800
                     /locus_tag="SBAL_RS02455"
                     /old_locus_tag="Sbal_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="WP_011845677.1"
                     /db_xref="GI:500171252"
                     /translation="MSKSKLIIAVPLLLAAVAGGGYYWWTQVRFIETTDNAYVEADIS
                     HISVKVPGYVVLSDVTDNQHVQKGELLAQLEDNQFSAKVSQAEASLASSKADLQTLAA
                     KVELQRALITQASAGVVAAESDKIRAQQQLSRSKKLKVSNYSSQDDVDQLQAGFDSAA
                     ARLDEAKAVLVAKQRELAVFNAQLDQAGSVVEQADATLELAKIQLNDTRVTAPFSGVI
                     GKRGAMVGQYVQPGQALYSLVPDGAVWITANFKETQIQHMQPGQSVLVSLDAFPDKTF
                     IGVIDSLSPASGAKFSLLPAENATGNFTKIVQRIPVRIRLDLSEEEAHMLPGLSAVVK
                     VDTASGTAISAIAANTGR"
     gene            546802..548430
                     /locus_tag="SBAL_RS02460"
                     /old_locus_tag="Sbal_0483"
     CDS             546802..548430
                     /locus_tag="SBAL_RS02460"
                     /old_locus_tag="Sbal_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_011845678.1"
                     /db_xref="GI:500171253"
                     /translation="MSATGSITASADIEAQGISVPNKPTDYERGSRRSWIAVFGGLIG
                     AFMAILDIQITNASMKEIQGSLGATLEEGSWISTAYLVAEMIAIPLSGWLSTGLSVRR
                     YLLWTTAAFIFASVLCSMAWNLEAMIAFRALQGFFGGALIPLAFRLILEFLPDNKRAV
                     GMALFGVTATFAPSIGPTLGGWLTEQFSWHYLFYINVPPGLLVMAMLAYGLEKQSVVW
                     DKLKNVDLAGIVTMALGMGCLEVVLEEGNRKDWFGSELIRNLAIIAVVNLVLFVWIQL
                     RRKEPLVNLRLLGKRDFVLSTVAYFLLGMALFGAIYLIPLYLSQVHDYTPLEIGGVIM
                     WMGFPQLLVLPLVPKLMERFDSRYLAAFGFLMFAISYYMNSQMTADYAGPQMIASQVV
                     RALGQPFILVPIGMLATMHLKPHENASASTVLNVMRNLGGAFGIALVATLSDTLARGH
                     LAHIKESLPAVSTQAQDYLAQSASMLQAGGSDPYTAAAQAKALLGKTMSQQAYIQAYN
                     DVFYIMGALLLIAVFAVLLIRKPTGPVAHDAMVE"
     gene            548594..549049
                     /locus_tag="SBAL_RS02465"
                     /old_locus_tag="Sbal_0484"
     CDS             548594..549049
                     /locus_tag="SBAL_RS02465"
                     /old_locus_tag="Sbal_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family N-acetyltransferase"
                     /protein_id="WP_006084261.1"
                     /db_xref="GI:493000655"
                     /translation="MQWQNLTFNQLNANTLYDILKLRVDVFVVEQACAYPELDDKDRH
                     PETQHLIGLSPDGELLAYARILPPGLSYPEASIGRVVVSPAGRGKGLAMPLMQHAIES
                     ALTTWPDAGIQIGAQDYLKAFYQKLGFVACSEMYLEDGIPHLDMRYHSA"
     gene            549149..549475
                     /locus_tag="SBAL_RS02470"
                     /old_locus_tag="Sbal_0485"
     CDS             549149..549475
                     /locus_tag="SBAL_RS02470"
                     /old_locus_tag="Sbal_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_006084260.1"
                     /db_xref="GI:493000653"
                     /translation="MSTSTDYKINQQQIACVASFLAKEGKTEALIAALASLIPDTRRE
                     AGCIRYELNVSRDEPRRVTFVEKFVDIAAFDEHCAKDAIQHYFHQVMPELVESFHVET
                     YHQIIV"
     gene            549504..550391
                     /locus_tag="SBAL_RS02475"
                     /old_locus_tag="Sbal_0486"
     CDS             549504..550391
                     /locus_tag="SBAL_RS02475"
                     /old_locus_tag="Sbal_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="WP_011845679.1"
                     /db_xref="GI:500171254"
                     /translation="MLINYIEPVFRPPSEWKSLILQVTNGCSWNQCRFCDMYTQPQKA
                     FRAQKLDKVEQDILAVARSGAPVSRVFLADGDAMSLPFARLEAICKLINRHLPQVTRI
                     SSYCLPRNLNNKTPEQLARLRELGLSLLYVGCESGDDEVLAKIQKGETFESSLAALLK
                     IRAAGMKSSVMILNGLGGVALSHQHAVNSAKLMNAAQPDYLSTLVVTLPLGTERMDAV
                     FGGQFQLPDQMGLFQEMHTLLEHLELEQTIFRSDHASNYLVLKGVLGKDKAKLLAQVA
                     LAINAPRSIPLRQEWQRGL"
     gene            550889..551584
                     /locus_tag="SBAL_RS02480"
                     /old_locus_tag="Sbal_0487"
     CDS             550889..551584
                     /locus_tag="SBAL_RS02480"
                     /old_locus_tag="Sbal_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="WP_011845680.1"
                     /db_xref="GI:500171255"
                     /translation="MKKVAICSALALSMASATASAETSNKVSAPTIRTMTQAQAPTEL
                     NANTTAVLVIDFQNEYFTGSMPIPNGKQALGKAKQVVKFAHQNAMPVYFVRHLGPAAG
                     PLFAEGSVNAEFHQDLQPLDIDFVINKATPSSFVGTNLDQQLKEKGIKTLVITGLMTH
                     MCVSSTARDAVPMGYDVIIAEDATATRDLATWDGSIVDHATLQRAAIAGVADVFAEIK
                     TTQAVLNMPVVRL"
     gene            551676..552683
                     /locus_tag="SBAL_RS02485"
                     /old_locus_tag="Sbal_0488"
     CDS             551676..552683
                     /locus_tag="SBAL_RS02485"
                     /old_locus_tag="Sbal_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_006079971.1"
                     /db_xref="GI:492987560"
                     /translation="MINTMNQSEIETASKVTIAIVVFDGIIPFHLSVPYEVFEKVLKA
                     DGTPACEITICAATPGILKTSAGFSMIVEKGLDELSSKDIIIVPSWDDPAHEPEPCII
                     NALQQAHANGSRIIGLCMGAFVVAAAGLLDGRSATTHWRWAQCFRNLHTNVFVDEKVL
                     YIDNGDVVTSAGTAASIDCCLYIVRQMWGSETANAVARHLVVPPHRQGGQAQYIDIPV
                     PAVNQREPLSAIMDWAIANIASPLTVDTMAEKACISRRHFTRRFQQATGTSFSLWLVN
                     QRLIMVKRYLETTDHSIDRIAEQAGFASTTSLRRHFRQQFDISPSNYRFVFRGKSKAS
                     E"
     gene            complement(552931..553797)
                     /locus_tag="SBAL_RS02490"
                     /old_locus_tag="Sbal_0489"
     CDS             complement(552931..553797)
                     /locus_tag="SBAL_RS02490"
                     /old_locus_tag="Sbal_0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011845681.1"
                     /db_xref="GI:500171256"
                     /translation="MRHLKAFYVFHVTAESSNYSKAAEKLHITHGAVSKQIKLLESHL
                     SQMLFYKQGRGMCLTQEGELLKQYTDIAFNALDNGIKKLTRESNKHLEVSCEPTLTMR
                     WLMPRLASFFRLTGIDVRLSTAGGPVDLNETGLSLAIRRDDFDISPEYTAHNLVNEWV
                     GPVFSPEYWRKSQNNLGDIVLLHSETRPSAWSDWSSRSKHTFYTNKSKSFEHFYFCLQ
                     AAVDGLGAAIGSYPLIVDDLKSGRLVAPFGFTQSGHKYVLLSHTERLGSNELEFLTWL
                     EKTMSLCQPETP"
     gene            553897..554508
                     /locus_tag="SBAL_RS02495"
                     /old_locus_tag="Sbal_0490"
     CDS             553897..554508
                     /locus_tag="SBAL_RS02495"
                     /old_locus_tag="Sbal_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_011845682.1"
                     /db_xref="GI:500171257"
                     /translation="MELLSFAVFGLLIVVSPGADFVLVFKNSAIYGRKAGVLTALGIG
                     IGVCVHITYSVIGISHLVSQNAVLFSIVKYVGAAYLIYLGVTGLVSSKLDLDYEKTNV
                     QPTQTRKYIFQGFLCNTLNPKTMIFFLSVFSQLISSDNESMSFAITYGFYIAFLHAAW
                     FCIVAYLVTSKHASNMLQKFGHRINQACGFGLIAFGAILSTNA"
     gene            555032..555376
                     /locus_tag="SBAL_RS02500"
                     /old_locus_tag="Sbal_0491"
     CDS             555032..555376
                     /locus_tag="SBAL_RS02500"
                     /old_locus_tag="Sbal_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_011845683.1"
                     /db_xref="GI:500171258"
                     /translation="MQPVAFFKALADETRLKCLLLIQREGELCVCELMAALSESQPKV
                     SRHLAQLKKAGLLVDRRQGQWVFYRINAEIAPWCQQVLGQTCDDNDSFLQENVRNLCQ
                     MGGRPDRVTACC"
     gene            555545..556540
                     /locus_tag="SBAL_RS02505"
                     /old_locus_tag="Sbal_0492"
     CDS             555545..556540
                     /locus_tag="SBAL_RS02505"
                     /old_locus_tag="Sbal_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011845684.1"
                     /db_xref="GI:500171259"
                     /translation="MFQIFTDFATWLVYGVFGLEAGSALGGAVHFFVEDVSKIFVLLV
                     LMIYFIALLRASLDVERVRDYLAGKNKGVGYLLGSIFGAITPFCSCSSIPVFLGFTSA
                     GIPLGITMAFLITSPLINEVAVLLLMSLLGWKFTLLYVAVGMTVGMLGGLLLDAIKAE
                     RWLQSFAAEALVRGRQMAVSNEVSTTERVLSLSERHEFAKAEALEIFGRVWKWVIIGV
                     GLGAALHGFVPEGWVETHLGQGQWWSVPAAVLVGIPLYSNATGIIPVMESLLANGLPI
                     GTTLAFCMSTVAASFPEFILLKQVMQWRLLAVLLVVLLTAFTLVGWIFNFAAPYL"
     gene            556550..556786
                     /locus_tag="SBAL_RS02510"
                     /old_locus_tag="Sbal_0493"
     CDS             556550..556786
                     /locus_tag="SBAL_RS02510"
                     /old_locus_tag="Sbal_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_011845685.1"
                     /db_xref="GI:500171260"
                     /translation="MKQVKVLGSGCAKCSKTAEMIADISEEMGVDAIVKKDTDPQTLL
                     KFKVMKTPAVVIDGELIHCGSVPTRDEIEGWLRD"
     gene            556989..558002
                     /locus_tag="SBAL_RS02515"
                     /old_locus_tag="Sbal_0494"
     CDS             556989..558002
                     /locus_tag="SBAL_RS02515"
                     /old_locus_tag="Sbal_0494"
                     /EC_number="1.2.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_011845686.1"
                     /db_xref="GI:500171261"
                     /translation="MAIKIGINGFGRMGRLALRAAWDWDEVEFVQINDPAGDAHTLAH
                     LLEFDSVHGRWRYPVTANADEIQIQDKIIRTTRNKVIADTDWSGCDVVIEASGVMKTK
                     ALLQAYLDQGVKRVVVTAPVKEEGVLNVVIGVNHQLYDPAIHPIVTAASCTTNCLAPV
                     VKVIHEQIGIKHGSMTTIHDITNTQTILDAPHKDLRRARACGLSLIPTTTGSATAITH
                     IFPELKGKLNGHAVRVPLANASLTDCVFELERAVTEAEVNALLKTAAEGELKGILGYE
                     ERPLVSVDYKTDPRSSIIDALSTMVINGTQLKLYVWYDNEWGYANRTAELARLVGQLD
                     FPR"
     gene            558013..559281
                     /locus_tag="SBAL_RS02520"
                     /old_locus_tag="Sbal_0495"
     CDS             558013..559281
                     /locus_tag="SBAL_RS02520"
                     /old_locus_tag="Sbal_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter permease"
                     /protein_id="WP_011845687.1"
                     /db_xref="GI:500171262"
                     /translation="MFAAKPFEQLMQLPAAVRQYLLITFNYWSFTLTDGALRMLVVLH
                     FHDLGYSPLAIAMLFLFYEIFGVVTNLIGGWLGARLGLNRTMNLGLGMQVFALAMLLV
                     PAASLPLWLAGVPWVMAAQALSGIAKDLNKMSAKSAIKLLVPKGEQGKLYKWVALLTG
                     SKNALKGAGFFLGGALLALLGFELAIATMALMLGLVWLLSLVMLKKDLGKAKNKPKFT
                     EIFSKSRSVNILSAARLFLFAARDVWFVVALPVYLASQLGWDHWAVGGFLAVWVIGYG
                     IVQTLAPKITGNRQAKSQLIDSAPDGRSALIWASMLAFVPALIACSIQFSFYPEASLL
                     LGLMLFGALFAVNSSLHSYLIVSYASEDAVSLDVGFYYMANAMGRLVGTVLSGLVYQA
                     YGLAACLWISTAFIGITAMISIKLPRQVAE"
     gene            559288..560172
                     /locus_tag="SBAL_RS02525"
                     /old_locus_tag="Sbal_0496"
     CDS             559288..560172
                     /locus_tag="SBAL_RS02525"
                     /old_locus_tag="Sbal_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620578.1"
                     /db_xref="GI:504433476"
                     /translation="MQKRFKASTYYFNRLMLPVRLRCLGCSGCFILGLFFATTCPLYA
                     AQTQPALIPALTPASDWKNLTYITQAFSEIALKNEYDVAKHRVRKWRIPVRVFVEHQV
                     GDRALHTQLVQMHLAHLAEITGHDIQLVDTLLDANLHLVFTRQSQWESEVMRLMGPSS
                     AKNVHGSVCMAKFALNAKSEIERAWVIIPVDQAQMHGKLVACVVEEITQVLGLPNDSE
                     KVFPSIFNDKTPQDLLTGLDFILLKLLYNPNIRAGMTAAEVKAPLQILLEQWQRDDTL
                     IHADKTVRQGQLYPLLGY"
     gene            560290..561732
                     /locus_tag="SBAL_RS02530"
                     /note="beta-lactamase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            562023..563399
                     /locus_tag="SBAL_RS02535"
                     /old_locus_tag="Sbal_0498"
     CDS             562023..563399
                     /locus_tag="SBAL_RS02535"
                     /old_locus_tag="Sbal_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:alanine symporter"
                     /protein_id="WP_006079981.1"
                     /db_xref="GI:492987570"
                     /translation="MEAITEFVGLINGFVWGTPMLVMILGVGLFLSLGLRLMPILKLG
                     TGFKLLWSGRIPDKDKNVKGDVSPFNALMTSLSATIGTGNIAGVATAIFVGGPGALFW
                     MWCTALVGMATKYSEAVLAVKFREVDDQGNHVGGPMYYIKNGLGKKWAWLGTLFAIFG
                     SLAGFGIGNTVQANSVAAALSSNFGVPAWVSGVVMMLLVGAVLMGGIKRIAEVAGKLV
                     PFMTIFYITAGLGVLVVHIQDVPAAFALIIHSAFNPVAAQGGFAGAAVWAAIRFGVAR
                     GVFSNEAGLGSAPIAHAAAQTNNPVAQGLVAMLGTFIDTIVVCSITGLAIVVSGSWTS
                     GENGAALTSYAFSHALPLGNYIVAIALSIFAFTTIIGWSFYSEKCVQYLFGIKAVKPF
                     RLLWTIAVPLGAVSSLDFIWLLADTLNAMMAIPNLIALALLSPVVFGLTREYFIKKRA
                     DEAAKAQS"
     gene            complement(563486..564841)
                     /locus_tag="SBAL_RS02540"
                     /old_locus_tag="Sbal_0499"
     CDS             complement(563486..564841)
                     /locus_tag="SBAL_RS02540"
                     /old_locus_tag="Sbal_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845689.1"
                     /db_xref="GI:500171264"
                     /translation="MSESLAQYQQDLRRFSDELIRIQTPIKILDAIKWPREMEERFLS
                     NKGTVLPAIKQEFYQNIALPFDPVKTQAELASLKQDIHRRLGKRDKLGKILVANVDQY
                     RLVVDMLENRGTPTFGKLSQELYGSASHRLHGDRHTLRQLGDKLSYIFSLPAARHMNK
                     HHPKIISAPEAVHVLSQRLEKYFHSDDMRVRLSDGIVSDAAVGGDTVKLNSKAMFSES
                     DLNVYEVHEGWVHVGTTLNGRAQPHATWLSVGSPRVAATQEGLAVLLEMLTLSSNPGR
                     ARRISDRVAAVDMAENGADFIEVFNYFRGLNLSATDSYRVTQRVFRGGMVEGGSFFTK
                     DISYVRGYVENINFIRSAITSGLPELIPMLFLGKLAIEDIPVLYQACQEGILTTPKYL
                     PPMFDNFSGLYAWFGFASGLAGIDLKGVQRHFTRLFKDVPNVEPAFEFLDDTEFDNNS
                     D"
     gene            565120..566082
                     /locus_tag="SBAL_RS02545"
                     /old_locus_tag="Sbal_0500"
     CDS             565120..566082
                     /locus_tag="SBAL_RS02545"
                     /old_locus_tag="Sbal_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845690.1"
                     /db_xref="GI:500171265"
                     /translation="MAAMSYLSVIERYHEYEATVHELMESILTGIADAELFKQPKVDV
                     KAMKGIAKSYPFVELMYLLDGQGLQISQNIAVVDHQIELIPLGGNRDRSQRPYFINRD
                     ESDGVNITRPYLSNASGNLCLSASLAIYQQEQKLGYLVVDVDLTRLIEFMMGDSARRR
                     VTPAFKAVYGVIVAGLFVLVTVLLWTALRDIYGLFTVERIGQDPLQPFGIIIFMTLAL
                     AIFDLGKTILEEEVLMHKDIFRHSSTRRTITRFVSTILIAISIEALLTMFKASLGEKQ
                     YIEPAIWMMLAVVGLLVGLGAYVYLGAKAEWLLIKTQAYKSAKK"
     gene            566766..568919
                     /locus_tag="SBAL_RS02550"
                     /old_locus_tag="Sbal_0502"
     CDS             566766..568919
                     /locus_tag="SBAL_RS02550"
                     /old_locus_tag="Sbal_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845691.1"
                     /db_xref="GI:500171266"
                     /translation="MDKDEFSKSHSPSNNIYFSVLSSSWLMIVAALLFMGISWYVLEQ
                     YLRDRGEERFENSVQELTEAVNRRMLAYEQVLRGGVGLLLSSNSVTRKEWQTYVVNAH
                     LSEYYPGFQGFGYAQLLKPDTLDTHVQQVQAEGFKDYKVYPEGVRDQYCVILYLEPFD
                     WRNQRAFGYDMCSESNRRKAIEHAITTGQPTVSGKVALVQDTPEDAKAGFLMYLPIYQ
                     GIVATEAERKQQAIGLVYAAFRMDYLMQGIMGDRFSGLKLAIYESPQASADSLMFTSS
                     KVLPNQKDVFYQSQTDLIGGKQWRLDISSQSRFISRSEETQGIWLQFIGCAFILALFY
                     SVLIMARNRYKESLLTSELIANEKRFRLVIEASPSALFMVDKAGVITLVNTHAERLFG
                     YARDELLGRSINMLLPDALRDAHQQHMNNYLVQPIAKNMSMRDDLFGCCKDGSRLAIE
                     VGLTPIHFSNGIFILATINNVSERKRIEVQRAEHMQELERINQELDRFAYIASHDLKS
                     PLRGIEQLTSWLAEDLSDNTNENVQKYLGLIQSRIHRMVLLLDGLLMFSRIGRVDTET
                     TEVNSRQLAEDMFALVAPPQGFELVLKGEFPNFHTVRALLELVIRNLISNAIKHHDLG
                     TGVITVLFEAADKHYLFSVIDDGPGISSAYQNKVFEMFQTLKPRDEVEGSGLGLSLVK
                     KTVESLGGNIQLKSQGRGCCFYFTWPKKIVKKELL"
     gene            568916..569350
                     /locus_tag="SBAL_RS02555"
                     /old_locus_tag="Sbal_0503"
     CDS             568916..569350
                     /locus_tag="SBAL_RS02555"
                     /old_locus_tag="Sbal_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011845692.1"
                     /db_xref="GI:500171267"
                     /translation="MRAADQYQQVTILLVDDDDVDYMAVQRAMRQLRLLNPLVRARDG
                     IEALSILTSLDTIKGPYLILLDLNMPRMNGFEFLERIRSDPSLSSSVVFMLTTSSTDE
                     DRMKAYSHHVAGYMVKTDIKDGFNNIFNMLEGYWRIVELPSA"
     gene            569360..571093
                     /locus_tag="SBAL_RS02560"
                     /old_locus_tag="Sbal_0504"
     CDS             569360..571093
                     /locus_tag="SBAL_RS02560"
                     /old_locus_tag="Sbal_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011845693.1"
                     /db_xref="GI:500171268"
                     /translation="MDLLLIDDDEVDRTAIIRALRQSKLTFNVIEANCAFDGLNLALE
                     RHFDGILLDYLLPDANGLEVLIKLNAMTQDQTVVVMLSRYEDEKLAQRCIELGAQDFL
                     LKDEVNSRILTRAIRYAKQRSSMALALRNSHQKLKELAEHDSLTKLVNRYGFELCLNR
                     AIARAKRCHDYLAVILLDLDDFKAINDTLGHQTGDVLLLKVAARLSEVLRDGDIIARL
                     GGDEFVVLVTDNDYKYFPMIVANRLLKVFEDEFCLGDNDVLIGASIGVAFYNEAASNS
                     SELMKCADIAMYRAKKMGRNQIQFYSEALDKEVRYRNHIESSLRMALKRNEFKVHYQA
                     QVNAKTHQLVGMEALIRWQHPVDGIIAPDQFLPIAEEIGLMDDIDDWVLEQACTQAQV
                     WLTQLQPLGQEFTIAVNLSASQIGNENLFDKIVHTLTKTGLPAGALELEITENCLIED
                     PHEHAKVLDRIAGLGVRFALDDFGTGFSSLEHIKLFPISVLKIDKSFVASYDKDEKDT
                     RLLAALLNFAHGFNVISVAEGVETFEQAEFCTARHCTVLQGYLFSRPLDAAAFEAKYI
                     LPLITQTQLPV"
     gene            571254..572159
                     /locus_tag="SBAL_RS02565"
                     /old_locus_tag="Sbal_0505"
     CDS             571254..572159
                     /locus_tag="SBAL_RS02565"
                     /old_locus_tag="Sbal_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1RFM0.1"
                     /note="responsible for the addition of glutamate residues
                     to the C-terminus of ribosomal protein S6; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-L-glutamate ligase"
                     /protein_id="WP_006079988.1"
                     /db_xref="GI:492987577"
                     /translation="MKIGILSQFPQLYSTQRLVEACQSRGHEAVVINTLNCYMNINSI
                     KPSIHYEGTELVGFDAIIPRIHASVTFYGCAVVRQFEMMGVYAANDSISIARSRDKLR
                     ALQLLSRKGIGMPVTGFANKPNDIPDLINMVGGAPLVIKLLEGTQGIGVVLAETKTAA
                     ESVIEAFLGLKANILVQEYIKESNGSDIRCFVVGDKVIASMKRQGPEGDFRSNLHLGG
                     CGEVVKITAVERKMAIAAVKAMGLVVAGVDILRSNRGPLILEVNSAPGIEGIEQTTGI
                     SVTEPIVEYIEKMVAARKTNRPIIA"
     gene            complement(572268..572960)
                     /locus_tag="SBAL_RS02570"
                     /old_locus_tag="Sbal_0506"
     CDS             complement(572268..572960)
                     /locus_tag="SBAL_RS02570"
                     /old_locus_tag="Sbal_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845694.1"
                     /db_xref="GI:500171269"
                     /translation="MKKSLYSVLALSTGMLVAGNAFAAVSGNIGGTSNYLWRGATQTK
                     DAVAIQGGIDYSHDSGFYAGTWASNVDFGDDTSYELDLYAGYGGSITEDISYDFGYLY
                     YAYPDAPSSIDFGELHAAVTWKWLELGYSHVINAGDDVAADPLDNKDLSYLAATVSVP
                     LTEKLSLSVHYGYSSGDVVQSWFGEDNYADYNVTLSADTSMGTVSFMVSDTDLTDDDA
                     KLVLGYSYSFDL"
     gene            572959..573240
                     /locus_tag="SBAL_RS02575"
     CDS             572959..573240
                     /locus_tag="SBAL_RS02575"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041408840.1"
                     /db_xref="GI:752761722"
                     /translation="MLIPSIDLFIDSPVAHLSKQWSLVHLGFFSKKGFANHMPLLQFY
                     VKQYIRISSVNKMFLFASLWGRGALLLCKKYSAFHWDRAKKRLTMEALF"
     gene            complement(573251..573523)
                     /locus_tag="SBAL_RS02580"
                     /old_locus_tag="Sbal_0507"
     CDS             complement(573251..573523)
                     /locus_tag="SBAL_RS02580"
                     /old_locus_tag="Sbal_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070888.1"
                     /note="histone-like DNA-binding protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_006079990.1"
                     /db_xref="GI:492987579"
                     /translation="MNKTELIAKIAENADLTKVEAARALKSFEAAITESMKNGDKISI
                     VGFGSFETATRAARTGRNPQTGKEIQIAEATVPKFKAGKTLRDSVN"
     gene            complement(573672..574469)
                     /locus_tag="SBAL_RS02585"
                     /old_locus_tag="Sbal_0508"
     CDS             complement(573672..574469)
                     /locus_tag="SBAL_RS02585"
                     /old_locus_tag="Sbal_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_006079991.1"
                     /db_xref="GI:492987580"
                     /translation="MSHLSPSELSILLVEPSDIQRRIIIQRLQQEGILSIQTAENIEA
                     AKDIIARHKPDLIASAMHFDDGTAIDLLGYLRASADCKDIQFMLVSSECRREQLEIFR
                     QSGVVAILPKPFSAEHLATALNATIDLLSHDELDLSNFDVQDVRVLVVDDSRMARNVI
                     KRTIGNLGMKLITEAEDGAQAIELMKNNMFDLVITDYNMPSVDGLALTQYIRNESQQS
                     HIPILMVSSEANDTHLSNVSQAGVNALCDKPFEPKLVKKLLYQLLEE"
     gene            complement(574553..574933)
                     /locus_tag="SBAL_RS02590"
                     /old_locus_tag="Sbal_0509"
     CDS             complement(574553..574933)
                     /locus_tag="SBAL_RS02590"
                     /old_locus_tag="Sbal_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079992.1"
                     /db_xref="GI:492987581"
                     /translation="MPKRLMLLISLYCLFSIAALLRAVTTQSFDVFTLGVLPVLVGIM
                     MRTPWSSLVLKIYIGMQTLGFSALGITAIIAYRITPEDVKVIVSGHNIPMLPLTISII
                     VILLLQYWIAFSKVTSHYLTRQTQ"
     gene            575061..575570
                     /locus_tag="SBAL_RS02595"
                     /old_locus_tag="Sbal_0510"
     CDS             575061..575570
                     /locus_tag="SBAL_RS02595"
                     /old_locus_tag="Sbal_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011788000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845695.1"
                     /db_xref="GI:500171270"
                     /translation="MTEVEFWGLVTRTEAAQSQESLTQALKQKLAELSNEELKAFDKI
                     FGQQMRRSYLWSVWGAAYIITGCDSEYAFAEFRCFLISLGKEIYDGVVNQPDTLARLA
                     AWPERDAYAYPFVDEYDLIAGKLYEDRTGDELPFMPSGKATPIGKKFSTKPKDLKQQY
                     PELSARFPF"
     gene            complement(575583..575897)
                     /locus_tag="SBAL_RS02600"
                     /old_locus_tag="Sbal_0511"
     CDS             complement(575583..575897)
                     /locus_tag="SBAL_RS02600"
                     /old_locus_tag="Sbal_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845696.1"
                     /db_xref="GI:500171271"
                     /translation="MNLKTASLSNSYSRKFALLALLTLGTCISLSSHAAPLTISQHQA
                     VNAHFSKLAQTQHAAENQMTEQLKQDFTQQLTAQEHEFMNDICPKYGMTFDVTTNACL
                     RS"
     gene            complement(576033..576359)
                     /locus_tag="SBAL_RS02605"
                     /old_locus_tag="Sbal_0512"
     CDS             complement(576033..576359)
                     /locus_tag="SBAL_RS02605"
                     /old_locus_tag="Sbal_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079995.1"
                     /db_xref="GI:492987584"
                     /translation="MAHLIKMKFPVVPVFILILFTCVVSAIWFISPSDKNTGPKTWSA
                     FIYNHGYDSGKYKKTDNFDSYETCRDFAREQSAFYDDVPWECGSMCQFDTRKQGFQCK
                     EMKNER"
     gene            576619..577143
                     /locus_tag="SBAL_RS02610"
                     /old_locus_tag="Sbal_0513"
     CDS             576619..577143
                     /locus_tag="SBAL_RS02610"
                     /old_locus_tag="Sbal_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845697.1"
                     /db_xref="GI:500171272"
                     /translation="MKIQSLLLAGVLSCSAAWAADEAPVNPVTEDGVVKIVWQSPKDF
                     RDIKSSGEIQSRYEKRLFETLTENINKEAAKVLKPNQKLEMTITDVDLAGDMRPTFGA
                     TANDLRIIKDIYPPRITFSYQVLENDKVIIAGDEKLTDMGFMGGIQSLSDKPFMYETK
                     MLTDWLKKTIAPQL"
     gene            complement(577182..578939)
                     /locus_tag="SBAL_RS02615"
                     /old_locus_tag="Sbal_0514"
     CDS             complement(577182..578939)
                     /locus_tag="SBAL_RS02615"
                     /old_locus_tag="Sbal_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-D-manno-heptose 1-phosphate
                     guanosyltransferase"
                     /protein_id="WP_011845698.1"
                     /db_xref="GI:500171273"
                     /translation="MTSLDLAKELDKIISKSAINPLFQPIFNILEHKIHGFEALSRGP
                     EHSPLYSPVPLFQTAEHEGKLSELETLCRRISLEQFKLRQFQGKLFINISPKALLDPA
                     HPKGMTLQLLQQLGIAPSQVVIELSEQYPADDIDLLKSCLNHYRSQGFLTAIDDLGAG
                     YSGLRLWSELSPDYVKIDRHFIHEIDSTPVKQEFVRSIVELCQSLTCKVIAEGIETQE
                     ELAVLKQLGIVYCQGYLLGRPEVLPCRAMKATLVPNNTQIQPRYSESAESLCTNAITV
                     APTLKLKFLSDTFSSQPALQAVVVVDNQLPLGIISRATLLELFSTPYGRALHENHAVS
                     EVMDPQVIQIEANEPLSTVSQLLTSETANTVAQQFIILRRGKLLGIGHTKDLLQRITE
                     HRIKMARHANPLTDLPGNVPIQEELKRLKIQKKHFYLAYFDLCNFKPYNDIYGFCRGD
                     EVICEVTNLLLKYKSDNCFIGHVGGDDFVIISTCEHMISRCQRILADFETHKHLFYSA
                     EHWQAQEMLADDRQGEACYHQLISLCVGILPPALTFNANEHSLSTLSARAKKQAKSAN
                     NGFYLLENHLTIETQALSA"
     gene            complement(579102..579410)
                     /locus_tag="SBAL_RS02620"
                     /old_locus_tag="Sbal_0515"
     CDS             complement(579102..579410)
                     /locus_tag="SBAL_RS02620"
                     /old_locus_tag="Sbal_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006079998.1"
                     /db_xref="GI:492987587"
                     /translation="MPHTKVIEQLKENLQIAYRQAIDADAKLDELKKAGHGNFTSIFT
                     AEQGFIASSNRFLPYVQELVDDLTRMEEYEALDPKELETYVRQLGALLQTLQAFKTQS
                     "
     gene            579459..580361
                     /locus_tag="SBAL_RS02625"
                     /old_locus_tag="Sbal_0516"
     CDS             579459..580361
                     /locus_tag="SBAL_RS02625"
                     /old_locus_tag="Sbal_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GumN family protein"
                     /protein_id="WP_011845699.1"
                     /db_xref="GI:500171274"
                     /translation="MATSQWRLIASICFLALTGWSTKAVSAETDKPPFYQVQWQGKSA
                     YLLGSIHIGRADFYPLPTQIETALGKAKGLVVEVDMNKADSNALLRQYGRADKTKGLD
                     WQSRDKQTVESMTPYCAATANVCQSIQSFAPWLQATQVNLIRYNNLGYSTDYGVDMQL
                     MARHAALPVYQLETAESQFQLLASFDSQAQWSMVREAISTSDADLLSLIAAWRSGNEA
                     ELDSIMQEQMGGEGDTEMLEKILWRRNHVMADGIIKLMGSTEITSPLFVVVGAGHVVG
                     DKSVVQLLEQAGAKVSACWKQTCQ"
     gene            complement(580396..581169)
                     /locus_tag="SBAL_RS02630"
                     /old_locus_tag="Sbal_0517"
     CDS             complement(580396..581169)
                     /locus_tag="SBAL_RS02630"
                     /old_locus_tag="Sbal_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-methionine-dependent
                     methyltransferase"
                     /protein_id="WP_011845700.1"
                     /db_xref="GI:500171275"
                     /translation="MQDKNFDKLAQKFAKNIYGTPKGDIRAAVLWRDLAPALAKLGDR
                     KLRVLDAGGGFGYFSQKLARLGHEVVLCDISAEMLAQAQEQIDASPEPLAIQLIHAPI
                     QALSVEQHGYFDIILCHAVVEWLTDAKPTMAGLLTMLKPAGLFSLMFYNKEAMRFHAL
                     VSGNFDYVAADLKVKKKVQLTPTHPLYIQEVKEWFSDWQMSLISQSGVRVIHDYLKKS
                     QPVDFDYQKLLQMELEYSQREPYISLGRYVHFLGQSPAV"
     gene            581552..582415
                     /locus_tag="SBAL_RS02635"
                     /old_locus_tag="Sbal_0518"
     CDS             581552..582415
                     /locus_tag="SBAL_RS02635"
                     /old_locus_tag="Sbal_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="WP_006080001.1"
                     /db_xref="GI:492987590"
                     /translation="MNNAYCVELNAMPSLFSLYRKIFFGRKPGWDQQPLPHIKVTAPH
                     VTVSETKVSQYAQVCGFQFDGKVLPPTYLYVMAFRLHAVIFTHDGITFPLLGMIHLKN
                     RIQVYRPVTVDETFSLECALTTSRETDSGLEFEFVSKAFVGEELVWESLSTYLYRIDV
                     AGRRVRPPKAIDMAWETPQSWRLSEDLGRRYAKASGDYNLIHLHPVLSKRFGFDRVLA
                     HGMWSKARCLAELMPSIGDRPFTVDVTFKLPLLMPADVGFGYEQNTDNMVFELRDSKG
                     RRPHLSGDVQF"
     gene            complement(582496..583386)
                     /locus_tag="SBAL_RS02640"
                     /old_locus_tag="Sbal_0519"
     CDS             complement(582496..583386)
                     /locus_tag="SBAL_RS02640"
                     /old_locus_tag="Sbal_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_011845702.1"
                     /db_xref="GI:500171277"
                     /translation="MSESHFTFSEFVAGFWRMESWDMTPMQRLSLIEQYLELGVTTMD
                     HADIYGQYQCETLFGEALALKPALRQQMQMVSKCGIKPAFACRPERYVNHYDTSCEHI
                     IASVEHSLKQLNTDYLDLLLIHRPDPLMDADAVAEAFKILKQAGKVQHFGVSNFTNAQ
                     FSLLQSRLDAPLVTNQVELSPLAMSTLHDGTLDLCQQRRIRPMAWSCLAGGKIFETTN
                     PQAVRLHQTLKLIAEQVGAQDISQVIYAWVRMLPSRPVPLIGSGNIERIKSAVASNEI
                     QLDRQQWFSIWQASMGHSVP"
     gene            583591..585348
                     /locus_tag="SBAL_RS02645"
                     /old_locus_tag="Sbal_0520"
     CDS             583591..585348
                     /locus_tag="SBAL_RS02645"
                     /old_locus_tag="Sbal_0520"
                     /EC_number="6.3.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3CZY6.1"
                     /note="catalyzes the formation of
                     10-formyltetrahydrofolate from formate and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="WP_011845703.1"
                     /db_xref="GI:500171278"
                     /translation="MLTDMDISSRASLKNITEIGADLGLLPEEMMLFGHTKAKVELSV
                     LQRLAGQRKGKLIIVTAVTPTPHGEGKTVTSIGLTQSLNAIGQKACACIRQPSMGPVF
                     GVKGGAAGGGYAQVVPMQEMNLHLTGDIHAVSSAHNLGAAAIAARLFHETRLGKTEFE
                     AQSEQAFLDIDPNEIRWHRVVDHNDRCLRQIHVGLGDNNGPEYESSFDITAASELMAI
                     LALSHDLADMRARIGRLVLALNTQGQVITAEDLGVAGAMTAIMADAIKPTLMQTLNGS
                     PCLIHSGPFANIAHGNSSIIADDIALRLADFVVTEGGFGSDMGFEKFCNIKVRQSGQA
                     PAAAVLVTTLKALKANSGLATEVDSNVSNIHVPNISATNINAPDQARLEAGFANLNWH
                     INNVARYGIPVVVAINRFATDSDAELQWLIEAVNASAAFGCEISDAFIQGEAGAIALA
                     QTVVRAAETESQFKLLYPDEASLEAKLSTLAEVGYGATGVSLSIEAKQQAQQLTALGY
                     GHLPLCMAKTPLSISHDPSLKGVPKDFVVPVRELVLHAGAGFITALVGNVMTMPGLGL
                     KPGYLKIDIDAKGEIVGLG"
     gene            complement(585499..587148)
                     /locus_tag="SBAL_RS02650"
                     /note="mechanosensitive ion channel protein; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            587394..587723
                     /locus_tag="SBAL_RS02655"
                     /old_locus_tag="Sbal_0523"
     CDS             587394..587723
                     /locus_tag="SBAL_RS02655"
                     /old_locus_tag="Sbal_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084232.1"
                     /db_xref="GI:493000565"
                     /translation="MLCSHCNQYIKVSDITQQRGKGFDAQVRCPHCTAWLGRSPTLAK
                     LKLLGFYLSVFTAGYSYFDASVRHFAIPVMIFSLMLLFVSHFMDQVITIEAPEPVDDS
                     DQRQKYR"
     gene            complement(587844..588005)
                     /locus_tag="SBAL_RS02660"
                     /old_locus_tag="Sbal_0524"
     CDS             complement(587844..588005)
                     /locus_tag="SBAL_RS02660"
                     /old_locus_tag="Sbal_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080009.1"
                     /db_xref="GI:492987598"
                     /translation="MASVFNHQKATLMLAFFRENLGLILGIVIFSVVIFGGIYYVEHS
                     LAAQEQVVQ"
     gene            588633..589817
                     /locus_tag="SBAL_RS02665"
                     /old_locus_tag="Sbal_0526"
     CDS             588633..589817
                     /locus_tag="SBAL_RS02665"
                     /old_locus_tag="Sbal_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007650820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006084229.1"
                     /db_xref="GI:493000557"
                     /translation="MTVLNTRISLVALACAFVSPSLLAEDSSLTNPAISAVLNGYYQT
                     GERPLAESPDGFGLGETELALSANIDDMFYGKVTAVVEMHDGDTELNLEEAFIQTMAM
                     PAGFSIRGGRFLSDIGYLNNQHLHTDSFTDRPVVYRAFLGGHYFDDGIRFNYVAPTDL
                     YWTMGVEAFKGDSLRAADEHGEREFKKVGVYTLYSKIGGDIGDNSSWQAGLSYLRNEN
                     GQVTAHEEGEHEDEHDHGDEHAGHSHAASYTGKNTYGADFVYKWAPNGNYKYQNLTVS
                     GEYYRVSDFTPVDLHPEDAPSQDYHQGWYLSSVYQFTPSWSAGVRYGEADTQELHGDH
                     FHGQKLKESEVSLAWHSSHFSTVRFQYTNQKGTNFDGIEDDNIFTIQYIMSLGAHGAH
                     QF"
     gene            589801..590709
                     /locus_tag="SBAL_RS02670"
                     /old_locus_tag="Sbal_0527"
     CDS             589801..590709
                     /locus_tag="SBAL_RS02670"
                     /old_locus_tag="Sbal_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_006080012.1"
                     /db_xref="GI:492987601"
                     /translation="MRINSNLAKLAAVALSVTYTGLAHAELNVFACEPEYAALAKELA
                     PTASIYSATTALQDPHQVQARPSLIAKMRQADLVVCAGADLEVGWLPMLQMKSANANV
                     RSTDQGLFFAADQIETLDKLASVDRSMGDVHAQGNPHIHFDPTRLLKVATALSAKLTQ
                     LDPAGAADYQKSLADFTTRWQAAVPRWEEQAKGLQGKKVIAYHSSFRYLFNWIGIEQV
                     ADLEPKPGLAPTSGHLASLLTRAEQGDILAVVVASYQDERGAKWLGEKANLPVVMLPM
                     SVGGNDKSQDLFSLYDSVISLLNGVK"
     gene            590714..591514
                     /locus_tag="SBAL_RS02675"
                     /old_locus_tag="Sbal_0528"
     CDS             590714..591514
                     /locus_tag="SBAL_RS02675"
                     /old_locus_tag="Sbal_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011845706.1"
                     /db_xref="GI:500171281"
                     /translation="MFDLELMSILLPALAAGILVLSTHIVLGRQVLKRGIIFIDLAIA
                     QVAALGAIVAHMDHRLEDMPFANVWMPALFALAGAGFIAWLSKRMAGELEAMIGCFYV
                     LSAVAAMLLLANDPHGAELLKQLMSGQILWVSWSQLILPAVVYSLVLFAIFLRPQMLD
                     GAGFYLLFALVITLSVELVGVYLVFSTLILPALALNKYRGKGRLFYAYLVGLLGYVLG
                     LVLSATLDLPSGAAIVATLAVSALVIRFVLAKVAPQATGSEILPKHHA"
     gene            591676..592419
                     /locus_tag="SBAL_RS02680"
                     /old_locus_tag="Sbal_0529"
     CDS             591676..592419
                     /locus_tag="SBAL_RS02680"
                     /old_locus_tag="Sbal_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_006080014.1"
                     /db_xref="GI:492987603"
                     /translation="MLLIVRSMLLAVSLLLAFIFGGLVCLLRPRHRDNVHMFAKIFSS
                     VAPILGIKVIVRRHKDVQDGPYIFLANHQNNFDLFTHTTAVPKGTVSLGKKSLAWMPL
                     FGQIYWLSGNILIDRKNRHSAFDTMAKTVEKIKQKNLSVWIFPEGTRSRGRGLLPFKA
                     GAFHTAIAAGVPVVPVLASCQSHIKLNRWNNGVVIIDMMAPVATAGLDKADVKNFSAQ
                     IHASMSARFAEINQEAAALMGKTLASDDV"
     gene            592740..593153
                     /locus_tag="SBAL_RS02685"
                     /old_locus_tag="Sbal_0530"
     CDS             592740..593153
                     /locus_tag="SBAL_RS02685"
                     /old_locus_tag="Sbal_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_006080016.1"
                     /db_xref="GI:492987605"
                     /translation="MSIESQLKAQLAENRDIVQALLDDGSEPDAEYIIEHHFSSTNFD
                     RLEKAAVDAFKLGFEVNDAEEMELEDGSIIFCFDAVAHHKLEVELLDKAAEQLLQLAV
                     KQKVEYDGWGTYFVGDEMDDEEDEDDEEEDDGFPH"
     gene            complement(593233..594219)
                     /locus_tag="SBAL_RS02690"
                     /old_locus_tag="Sbal_0531"
     CDS             complement(593233..594219)
                     /locus_tag="SBAL_RS02690"
                     /old_locus_tag="Sbal_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_006080017.1"
                     /db_xref="GI:492987606"
                     /translation="MSNDQSAMNELHWLIDMVQTIEVGLVVLDRHYNIQLWNGFMENH
                     SGVSPNSIKGQNLFTRFPDLPATWLKQKMESVFMLKNRAFISWEQRPYVFQFKNYRPI
                     TGRADYMYQNVTLLPLASLTGQVTHISVIIYDVTDIAINKLQLKAANEQLERLSQTDG
                     LTQLHNRRHWQECLDHEYDIYARYSGMASLVMIDIDNFKHINDSYGHVAGDKVIQHIA
                     HLLSQSLRETDCAGRYGGEEFAVVLPKTSGADAMYFTERLREKIAASVILYESLKISV
                     TVSLGVCEIGSHITSSSSWISCSDKALYEAKQKGRNCSVLHTSTSVNKTTQD"
     gene            complement(594238..595233)
                     /locus_tag="SBAL_RS02695"
                     /old_locus_tag="Sbal_0532"
     CDS             complement(594238..595233)
                     /locus_tag="SBAL_RS02695"
                     /old_locus_tag="Sbal_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007650814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheC"
                     /protein_id="WP_006080020.1"
                     /db_xref="GI:492987609"
                     /translation="MSISVLICDDSAMARKQMARTLPKEWDVEITYATNGAEGLDAIR
                     AGKGEVVFLDLNMPVMDGYEVLQTVQQQDLPALIIVVSGDIQIKAHERVKALGALDFI
                     QKPVSADAISNILQDYGILTLTQKDIADEVPMIKVDMRDACQEIANVAMGRAADLLAK
                     LLDVFVLLPIPNVNVLEVSELTMALKATEESSTVSALCQGFIGAGIAGEALLLFHDSS
                     FKDMAKLMGLANPEDKNTEIEVLIDTGNVLIGAFLNGISEQLDMKFSQAHPVVLGRHC
                     TVNDLIHDNSEKWQRTLAMEINYRIEDHNIQCDLLLLFTEDSIPTLSYKLGYLLD"
     gene            595776..596582
                     /locus_tag="SBAL_RS02700"
                     /old_locus_tag="Sbal_0533"
     CDS             595776..596582
                     /locus_tag="SBAL_RS02700"
                     /old_locus_tag="Sbal_0533"
                     /EC_number="4.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_011845707.1"
                     /db_xref="GI:500171282"
                     /translation="MSGQSVQVKIDDGIAYVLLNRPEKMNAINYLMFSELDRAIKQIK
                     SNRGVRAVIVSGAGGNFSSGLDVKSVMSAPMQAVKLLFKGLPGNANLAQRVSLGWQNL
                     PVPVIAVLEGCCYGGGMQIALGADVRIASHDCKLSIMEAKWGLVPDMAGLVALRQIMP
                     KDQAMLLSLTAKVLEGNEALTLGLVTQVSETPMEVAQQLAQQLMQTSPDAAAAIKLSI
                     NRSWTASVRSLLCRESISQIRLLLGKNCKIAAARQLKEPQKPYQDRQSGW"
     gene            complement(596618..597514)
                     /locus_tag="SBAL_RS02705"
                     /old_locus_tag="Sbal_0534"
     CDS             complement(596618..597514)
                     /locus_tag="SBAL_RS02705"
                     /old_locus_tag="Sbal_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845708.1"
                     /db_xref="GI:500171283"
                     /translation="MARIISLLFCLLLGFIAISTRAADPATAAPTPAEVSTKKLNNRY
                     LPENEVKQITIDNQPYDLLVRPWEGKKKLGAAIILPATNGTADAPGLMAFVRRNINPA
                     GWASLSLTPPTELPAANFATAATEVTSPGAAQLSSPSNKPSPKIKPEDNSKHLQEQED
                     FLVQSMSQLDAVGADYAGKRILITADQSAGLLISLLSQKKIADPDVLIVINPYREDEK
                     LNQALAEQLAKLTLPILDIQSPDGHPASLETAANRKILAVTLKSPNYRQTSLALNLDN
                     ESAWQNCLNAIKGFSARMSGAQ"
     gene            complement(597769..600675)
                     /locus_tag="SBAL_RS02710"
                     /old_locus_tag="Sbal_0535"
     CDS             complement(597769..600675)
                     /locus_tag="SBAL_RS02710"
                     /old_locus_tag="Sbal_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8EJ93.1"
                     /note="transcription regulator that activates
                     transcription by stimulating RNA polymerase (RNAP)
                     recycling in case of stress conditions such as supercoiled
                     DNA or high salt concentrations. Probably acts by
                     releasing the RNAP, when it is trapped or immobilized on
                     tightly supercoiled DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-associated protein RapA"
                     /protein_id="WP_011845709.1"
                     /db_xref="GI:500171284"
                     /translation="MPFALGQRWISDTESELGLGTVVQVEGRMVTVLFPATGENRMFS
                     RAEAPLTRVIYNPGDSVESHEGWSLAVSELTEKDGIVIYHGIHSETGEQVTLRETLLN
                     HNIRFNKPQDRLFAGQIDRLDRFGVRYQCQMLRHKLASSDLLGLQGPRVGLIPHQMWI
                     AHEVGRRYAPRVLLADEVGLGKTIEAGLIIHQQLLTGRAERILIIVPDTLRHQWLVEM
                     LRRFNLRFSVFDEDRCVEAYADHDNPFYTEQLVICSLELLRKKKRLDQALDADWDLLV
                     VDEAHHLEWTEEAPSRAYQVVEALSEVIPGVLLLTATPDQLGHESHFARLRLLDPDRF
                     YDYDAFLAEEDSYKDVAIAAEALAGNTKLPDAAINSLTELLGEKDISPSIRLIQADGI
                     DAEVQQAARSELLQELLDRHGTGRVLYRNSRASVKGFPKRFFNAYPHAMPDQYQTAAR
                     VSGMMGGHKSLEAKAAQALSPEKLYQEFEDNSASWWKFDPRVDWLIEFLKSHRSKKVL
                     IIASQAETALSLEEALRTREGIQATVFHEGMSIIERDKAGAYFAQEEGGAQALICSEI
                     GSEGRNFQFASHLVLFDLPLNPDLLEQRIGRLDRIGQKNDIQIHLPYLEDTAQERLMQ
                     WYHQGLNAFELTCPSGHVLYSEFAEDLLNVLAVDDSDELTNLLNHTQSRYKELKHAME
                     QGRDKLLEINSHGGEKAMAIVQRLAQNDGDTHLIGSVIRLWDIIGVDQEDKGENSIIL
                     RPSEHMMFPTYPGLPEDGVTVTFDRDTALSRDDIALITQEHPLVQTGLDLITGSETGT
                     TSVAILKNKALPAGTLFLELIYMADASAPKSSQLYRYLPPTPIRVLLDKNGNDLSAKV
                     DYASFDKQLSAVNRHIGGKLVTASQPILHPLFAKGEEYAQVVVDEMVAQAREKMTQQL
                     SAERSRLESLKAVNPNIREEELEYLRNQMQELNTYLDASQLQLDAIRMVLVSHV"
     gene            601082..602476
                     /locus_tag="SBAL_RS02715"
                     /old_locus_tag="Sbal_0536"
     CDS             601082..602476
                     /locus_tag="SBAL_RS02715"
                     /old_locus_tag="Sbal_0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007644584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_006080025.1"
                     /db_xref="GI:492987614"
                     /translation="MEQDDRKLFVLDTNVLLHEPLAIYSFKEHDVVIPMTVLEELDQI
                     KDRKSDVSRDARVAIRALEDTLGGETTPEQIINGVPLPSREGHADAVGSLSIFPDHLV
                     DFTLGALPGDGNDNRIINTALHLQNLHQPRTVVLVTKDINMRLKAKGAGIQLVEDYRT
                     DQLIDDIRFLSKGFYQFEGNFWEHLNKVSTERHGRHTVHEVPLKDLENDKFYINQYLI
                     DTESDFCGRVTERTDTHLHILDLGRERVKNLEAWGVKPKNVYQGMALQALLDPDIDLV
                     ILTGPAGCGKTLLAMAAALELVVERNRYDKVIVTRNTPEIAESIGFLPGTEEEKMMPW
                     LAAITDTLEVLHKNDVNPTGSMNYIMEKANIQFKSINFMRGRSIQNSIVLLDECQNLT
                     ASQIKTMITRMGEGTKLICCGNLAQIDSNYLTAVTSGLTYIVERFKDFEGSANVYLNG
                     VVRSRLAEYAEEHL"
     gene            602692..606408
                     /locus_tag="SBAL_RS02720"
                     /old_locus_tag="Sbal_0537"
     CDS             602692..606408
                     /locus_tag="SBAL_RS02720"
                     /old_locus_tag="Sbal_0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845710.1"
                     /db_xref="GI:500171285"
                     /translation="MKSSEPDLQLKSPIQKNYNRAVFYTYIGVIVMSLLTAWMFFDRQ
                     KAQQMEQREEQVQRHVLQIDLLLESSIRAVKSLRNVAVDHLRLGELVRKERLPQYGKF
                     NESGQYFTLEPSYAQSGEPFTNMGRITGAGSLDGRSDKFYQELEMLFELSLSFPVAKE
                     AAPKASAIYYLSKRRIMSYFPWSNDDQRFRDELLNKKQFQYATPAMNPQRSVFWSEAY
                     VDSTGKGLLTTLGVPVYLDDEFIGSINLDMTLASLARQIRVYFKMPGTVILLDQQNNI
                     LSHSDFDSSDINRVYHISQRIPSELHSLPESELFDAHDGIIRNGYYIHSVALHNAPWR
                     LLYLQDEDDLFQDSWEKLQLTFILVVIALSVLVTIVHWQTRRSFVSPASRLLSHLEGC
                     SQEPRKPPEKITRGWEPWFLLVSRIFEENKQYTHHLAEQNKRLDKLVARRTERLKDTT
                     ERREREYALLRSLLDSIPEAIVFKDKEGNYLGCNKAAERMLGYTESEMIGLSSEDLTS
                     PEMGIRIRAEDEQVLKDRTPLRYQEKVELAGKPVLLDTLKLPFYNRRGELQGLIAVWR
                     DVTREYESAEQLRLSEERYHLAMDAVEDGLWDWYLDSEQIICNPAYYSMLGYKTNEFP
                     ALVSTIDELSHPDDRIRVEGYRAQYLADPVGAYEIEFRMLGKNGGYHWVLSRGRVVEF
                     TAEGQPKRMLGTHKDITRHKSNEVALLEAKQDAELANLYKSEFLANMSHEIRTPMNAI
                     IGMLQLAQRTSLTAQQKDYLEKAGFSAQSLLRIINDILDFSKIEAGKLELERVPFPLD
                     KVLDHALDLNALKAQEQGVELLLYAPVTAGLILKGDPLRLGQVLINLLSNAVKFTQSG
                     EIELGCEDVGERDHRITLKFWVRDTGIGIGKDQQDKLFDAFAQADGSTTRKYGGTGLG
                     LSISKHLVSMMGGKMQVQSELGVGSTFSFTISFEIAEAAKIEPLVVPEKLNSLRTLVV
                     DDNPTALQIYSTLMRDFHFEVDTAASGAEALYKLSRAPIDLLLLDWMIPEMDGSDVVS
                     AIDTMVAEGRLAKRPVIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAAF
                     ADEPRLNVVQPMVEVQVEDGEHTGLVLLVEDNFINQQVATELLKSAGYEVVLAGNGQV
                     ALDTIDSRPFDAVLMDIQMPVMDGLTAARALRERFSADDLPIIAMTAHAMSGDREKSL
                     AAGMNAHITKPIVLNELFETLNHWIKHKNQHQNR"
     gene            606538..608946
                     /locus_tag="SBAL_RS02725"
                     /old_locus_tag="Sbal_0538"
                     /note="metalloprotease; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(608967..610775)
                     /locus_tag="SBAL_RS02730"
                     /old_locus_tag="Sbal_0539"
     CDS             complement(608967..610775)
                     /locus_tag="SBAL_RS02730"
                     /old_locus_tag="Sbal_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007644587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_011845712.1"
                     /db_xref="GI:500171287"
                     /translation="MQTPQLQHFYISEEQSIYLLKANDARKHKAWIRLCKQQLSKLGY
                     TDIELVGKGAYGFVFAGINQAGDAHVFKFSRINLPQHIQDRLEEEAFMLSLLKHPNVP
                     GAIKFERVGKQGILVMERAKGEDLDQLCRRMGALPTAMVMSIARQLADILYYLRTGKP
                     LVHGDIKPSNLVYDIEQQHLSLIDWGSAVFAQRDEYNKPVEDNVMALMSSDQQHTNAR
                     MGDVYFIGEEQLNGALSSPRFDEQGVAATLYALASGQASRFGAQVISPTSIGLPMELA
                     RTLEGMLSTDPKQRNIAGDYFLKSMRHSHRLHLPELPKAELQGEIPVWVQSRDKDVET
                     VSYSSRKSFLKEHNAQDPIAKMDDIQLEKYYRNFLAGMGDTEKGFIAAVGRLAQYPIV
                     GGLAIHWQETGVFIDSNLAIYDAKQKSALIIAVNNMVDLARGIKRIGVFKACFFNAKD
                     TLHIERTDISEPFVASADLQLPFEVGDVPTLEDKSRLHSYFEDGKDPDENLELPVEIM
                     EELARINQIHHTGCIIFEALPNHLKIHSYLKLLNPRKQAAFRASLDRILHHVGKIQGH
                     GVSGFMKLPYKNTRRFTHLERKADHFYPKNPKEIGA"
     gene            611025..611366
                     /locus_tag="SBAL_RS02735"
                     /old_locus_tag="Sbal_0540"
     CDS             611025..611366
                     /locus_tag="SBAL_RS02735"
                     /old_locus_tag="Sbal_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080029.1"
                     /db_xref="GI:492987618"
                     /translation="MPTQYKALLIELLEYPRKRILQSMEVTHCPHAVFFNDSDEQCLT
                     CHQGMECIWMNQNDELVAVNEKSIAELKQQLLIAVDFVDSSLSPHHLSRRQCQCDNCV
                     WLRKVQATLDQ"
     gene            611469..612125
                     /locus_tag="SBAL_RS02740"
                     /old_locus_tag="Sbal_0541"
     CDS             611469..612125
                     /locus_tag="SBAL_RS02740"
                     /old_locus_tag="Sbal_0541"
                     /EC_number="2.1.1.67"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4YAM5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiopurine S-methyltransferase"
                     /protein_id="WP_011845713.1"
                     /db_xref="GI:500171288"
                     /translation="MEPGFWHEKWHQQQIGFHQQDINPFLVKYWQQLGLPADTQVFVP
                     LCGKSLDMCFLAEQGHQVIGCELNELAVQQFFSDNQLEMTQTTVGEHQHYQTEQISLY
                     QGDIFTLPNAITQEVTAFYDRAALIAWPESMRAQYAKQLASLLPSGSVGLLVTLDYPQ
                     EALIGPPFAVSPTWVEQHLSDDFDIEVLASQDVLADNPRFIKKAVPWLNEAAYLLKRK
                     "
     gene            complement(612415..612606)
                     /locus_tag="SBAL_RS02745"
                     /old_locus_tag="Sbal_0542"
     CDS             complement(612415..612606)
                     /locus_tag="SBAL_RS02745"
                     /old_locus_tag="Sbal_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011788027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_006080031.1"
                     /db_xref="GI:492987620"
                     /translation="MYVCLCHAITDTQIKNAVSQGDSSLADVKKRLGVADQCGKCARM
                     AVQIIQNQLEREPNYYEVA"
     gene            612868..614442
                     /locus_tag="SBAL_RS02750"
                     /old_locus_tag="Sbal_0543"
     CDS             612868..614442
                     /locus_tag="SBAL_RS02750"
                     /old_locus_tag="Sbal_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011845714.1"
                     /db_xref="GI:500171289"
                     /translation="MRTNLPVTQREYDYPADWILLSTTDTQSHITYANQSFCTVAGFE
                     LDAMLGKPHNMVRHPDMPPHAFEDMWRCIKKGEPWKGIVKNRCANGDHYWVDAYVSPI
                     SVNGKVVEFQSVRTKPTREQVKRAETAYAELNKKGSVSALKRTVSMPAKLLLLALLAM
                     LPMLYLALQIGLMGFIALAISILVLLVGGNLVLSRYYAIVAKAKHIYDNPLMAHIYSG
                     SSDDLGAIDLALQMQTSELKSILGRASDSCYNVSEQAKISAAKGKQIQSTSQAQLSEI
                     EQVATAMQEMTATLGDMSSNCADAASATQMASAETINGDKTVSSTISSIQAMAEQLQQ
                     TSKVITELEAYSKDIGTVLDVIQSIAGQTNLLALNAAIEAARAGEQGRGFAVVADEVR
                     ALAQRTHDATKEIQSMINLLQQGTNKAVVSMQQGVVAASQCISTADLAGTALRTIREA
                     ISTITDMTHHIASAVEEQSSVANEMNRSVVNVSQFTHSSHQLGSEMVGLNDEVTREMD
                     SHSVLVDQFLKRSFRV"
     gene            complement(614567..615502)
                     /locus_tag="SBAL_RS02755"
                     /old_locus_tag="Sbal_0544"
     CDS             complement(614567..615502)
                     /locus_tag="SBAL_RS02755"
                     /old_locus_tag="Sbal_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_011845715.1"
                     /db_xref="GI:500171290"
                     /translation="MGHKLLLLTKANQQYRDLIEAQQLPDLEILDDNPAGIIEADIWL
                     AEPKLAAPLLPHAKNLQWLQSSFAGIDALMSPRGRKDYQLTNIKGIFGPLMSEFVFGY
                     LLAHIRGHGFYRQQQQQKQWQVQPPIRHTSLQGMRLILLGTGSIAQHLAQTAKHFGMH
                     VTGINRSGNTVEGFDAIEAMANLAQTLMQADVVVNLLPSTPATQSLLNADTLGKLKDD
                     AVLFNVGRGDALDLDALNIQLIAKPTQQAVLDVFAQEPLPNSHPIWERENAIITPHIS
                     APSHPAQIVEIFSQNYRRYISGEPLQNRIDFSKGY"
     gene            615597..615929
                     /locus_tag="SBAL_RS02760"
                     /old_locus_tag="Sbal_0545"
     CDS             615597..615929
                     /locus_tag="SBAL_RS02760"
                     /old_locus_tag="Sbal_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006080036.1"
                     /db_xref="GI:492987625"
                     /translation="MDQLVALIAQLGNMLRPWAFDIATAMVVCLILVFSADVNRILRR
                     HLLGHSFVLRTFVFIIVNAFGYGLLIVKATPWVARHIVAMPSHWMFLLIVAMFIFIGY
                     WAQRNSQA"
     gene            complement(615950..616672)
                     /locus_tag="SBAL_RS02765"
                     /old_locus_tag="Sbal_0546"
     CDS             complement(615950..616672)
                     /locus_tag="SBAL_RS02765"
                     /old_locus_tag="Sbal_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="WP_011845716.1"
                     /db_xref="GI:500171291"
                     /translation="MLIFAHRGASGYQAENTLAAMAKALELGAQAVELDVHNVEGELV
                     VFHDRRLDNKSSGSGVIHLVSKDYLASINVKGESIPTLWQVLELIAGRCIVNIELKGI
                     NTVTPLIDLYPKAMSQLGFTKEQLLISSFNHPYLHELKQALPDALVAPLLASIPLEGA
                     AVVSDLNAYSLHLDVSFISQALVDDAHNRGAKVYVYTVDHSDDIHALKQMGVDGVFSN
                     YPDRAMQALTQVATADYSGYFE"
     gene            complement(616687..619890)
                     /locus_tag="SBAL_RS02770"
                     /old_locus_tag="Sbal_0547"
     CDS             complement(616687..619890)
                     /locus_tag="SBAL_RS02770"
                     /old_locus_tag="Sbal_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_011845717.1"
                     /db_xref="GI:500171292"
                     /translation="MPRILLFVIAFFSFSVLANSPLQLDKRLGINKQDQQQNLSIDEQ
                     INDLKINIEKLAASATSFQQAQIDFEQHKKRTNQALKEAYKPLSLEKGTDLSQQASMA
                     YIRLSELKESESTLGRQVNDLLQRHNDLPTVIASARQSVAQNKKAELAPLDTPTGELQ
                     QTQRLFFEQSLATNEAELASSQKRIELTQLQLQLVRQQLVQQEALIETINKAINKQRQ
                     QQTDATLAKNLVNTGKVVDPITRNIADTNQIYGQKLQTLTLQINNVVEQQEQSETQYQ
                     SQAKQLANIQEQITWVKMNSAFGERFLQMLQSLPKPPNHEKLQTLIADARLDRYHLEQ
                     QQALNDQELEQPGLYNEQQIKLLHSQQSLISQLMQSYDQYLSELGKLKVNYQQLSQQH
                     LTLKNTLNEHLFWVPNAASISKLWLTDLERSAVWLVQQAQWDELGKAWEEQNDYWSWW
                     IILLVLCLVVQDLITPKFNRLLNHYTTYVGNVTQDKFIYTLKALACSVSYALIKPFPV
                     IMAGLIFYQSDRNFVQAVGMGILAIGLVYLLYRFIFILTLDKGVLVGHFKRPSKLIQA
                     GQSRLRHFVLVASPLLGLMGFTEVLDTSLVRNSIGRGAFIVFCIVLFLLYKDILILSR
                     KNSDAKKDGKNKKLIQKILWTLLISVPLLSAGLAFRGYYFTAFQMLLQLQLSIVLGLG
                     FLLLYQLIKRWMLIERRRIAFDRAKAKRAERLAQREKGETHHLSADGLDTYEEPVVDL
                     ETISSQSLGLVRSLLLLAFLASLIGLWTQTHTALFSFLDGITLWTTNTSINGLEQQLP
                     ITMKSLMFGLIVVGFSLMIATNLPGLLELMILQRLDLSPGTGFAITTVSRYLVVFLGL
                     LIGFSNLGMEWSKLQWLIAALSLGLGFGLQEIFANFISGLIILFEKPVRIGDTVTIRD
                     LTGTVSKIQIRATTIIDWDRKEIIIPNKAFITEQLINWSLSDPITRVIVYVSVARDSD
                     PAKVEATLYQAVQECEDALASPEPEVWFAGFGKHTQDYEVRAYAKDMSARWPLRHDLH
                     KRVTKKLKENNLELAYPQMEIHIKNGQSREQQGIIRS"
     gene            complement(619959..620840)
                     /locus_tag="SBAL_RS02775"
                     /old_locus_tag="Sbal_0548"
     CDS             complement(619959..620840)
                     /locus_tag="SBAL_RS02775"
                     /old_locus_tag="Sbal_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011845718.1"
                     /db_xref="GI:500171293"
                     /translation="MSSAKPSGLIELHLAVLLFGGTALFSKLIPLSALDITFLRCIVA
                     ATVLGLLVKLSRKRLTLASKQDYLVAIGLGVIVSLHWVTYFAAMQLSSVAIGMIAFFT
                     YPVMTVIAEPLLTGRKIKLLDMISGVLVLIGVILLIPEANLGNDTTLGIAIGIVSAIL
                     FTARNLLHKRYFSQYSGPHAMFYQTLVAVVFLMPWHQTELNSISLEVWGLIILLGVVF
                     TAAPHALFTSALRQLSAKTVGLVSCLQPFYGAMLALIILGEELNLNTVIGGTIIVATA
                     IFETHQSHQSQRRKKNA"
     gene            complement(620847..621725)
                     /locus_tag="SBAL_RS02780"
                     /old_locus_tag="Sbal_0549"
     CDS             complement(620847..621725)
                     /locus_tag="SBAL_RS02780"
                     /old_locus_tag="Sbal_0549"
                     /EC_number="4.1.1.65"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase proenzyme"
                     /protein_id="WP_011845719.1"
                     /db_xref="GI:500171294"
                     /translation="MDKVKIALQYMLPKHLLSRLVGKLAAAEAGALTTAAIKWFIKQY
                     KIDMSEAAQSEPEAYKSFNAFFTRALKPGIRPLDMDADIMVHPVDGAVSQLGPIKNGR
                     IFQAKGHHYSSLTLLGDQAEDAKRFEGGDFATIYLAPKDYHRIHMPIKGTLSKMTYVP
                     GELFSVNPLTARNVPGLFARNERVVAIFETELGPLAMVLVGATIVASIETVWAGTVTP
                     PTGKQVFTWEYPTQGPDAITLDKGEEMGRFKLGSTVVMLFAKDAIATFAEGVEAEAVT
                     RMGQAFANLKDVKQAD"
     gene            complement(621788..622852)
                     /locus_tag="SBAL_RS02785"
                     /old_locus_tag="Sbal_0550"
     CDS             complement(621788..622852)
                     /locus_tag="SBAL_RS02785"
                     /old_locus_tag="Sbal_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620580.1"
                     /note="EngC; RsgA; CpgA; circularly permuted GTPase;
                     ribosome small subunit-dependent GTPase A; has the pattern
                     G4-G1-G3 as opposed to other GTPases; interacts strongly
                     with 30S ribosome which stimulates GTPase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase RsgA"
                     /protein_id="WP_014620580.1"
                     /db_xref="GI:504433478"
                     /translation="MSKKKPLSQGQLRRMRANHEKRLNRDSGDKNTPELQDSSLGQEQ
                     PGTVISRFGQHADIETESGQVVRCNIRRAVTSLVTGDKVIVRLAIESQANSGIAGIVE
                     AVHPRRSSLTRPDLYDGVKIIASNIDQILIVSSVLPSFTTQIIDRYLVAAEDTDIPPI
                     IILNKIDLLNPDEAQAIDEALQRYKDIGYPVYKVSSKLGDGIDTIKDILKDKVSVFAG
                     QSGVGKSSIINALLPDAELVIGDVSDNSGLGQHTTTTAKLLHLPSGGDLIDSPGVREF
                     ALWHLPAQRVGWCFIEFREYLGACKFRDCKHGDDPGCALQEALSQGKISADRFHNYHK
                     IIASLDEQRHARHFRAATDE"
     gene            622965..623510
                     /locus_tag="SBAL_RS02790"
                     /old_locus_tag="Sbal_0551"
     CDS             622965..623510
                     /locus_tag="SBAL_RS02790"
                     /old_locus_tag="Sbal_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4YAL6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="WP_006080044.1"
                     /db_xref="GI:492987633"
                     /translation="MTADVNNLIWIDLEMTGLEPDVDRIIEIATLVTDQELNIIGQGP
                     VIAIHQSDDVLAAMDDWNQKHHGESGLIDRVRASQETEAQAVAKTIAFLEQYVPKGAS
                     PMCGNSIGQDRRFLNRYMRELEDYFHYRNVDVSTIKELVKRWSPETMAGFKKQNTHQA
                     LQDIQESIAELQYYRSKVFKI"
     gene            623621..623696
                     /locus_tag="SBAL_RS02795"
                     /old_locus_tag="Sbal_R0015"
     tRNA            623621..623696
                     /locus_tag="SBAL_RS02795"
                     /old_locus_tag="Sbal_R0015"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:623654..623656,aa:Gly,seq:gcc)
     gene            623739..623814
                     /locus_tag="SBAL_RS02800"
                     /old_locus_tag="Sbal_R0016"
     tRNA            623739..623814
                     /locus_tag="SBAL_RS02800"
                     /old_locus_tag="Sbal_R0016"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:623772..623774,aa:Gly,seq:gcc)
     gene            623857..623932
                     /locus_tag="SBAL_RS02805"
                     /old_locus_tag="Sbal_R0017"
     tRNA            623857..623932
                     /locus_tag="SBAL_RS02805"
                     /old_locus_tag="Sbal_R0017"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:623890..623892,aa:Gly,seq:gcc)
     gene            623975..624050
                     /locus_tag="SBAL_RS02810"
                     /old_locus_tag="Sbal_R0018"
     tRNA            623975..624050
                     /locus_tag="SBAL_RS02810"
                     /old_locus_tag="Sbal_R0018"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:624008..624010,aa:Gly,seq:gcc)
     gene            624708..625163
                     /locus_tag="SBAL_RS02815"
                     /old_locus_tag="Sbal_0552"
     CDS             624708..625163
                     /locus_tag="SBAL_RS02815"
                     /old_locus_tag="Sbal_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080046.1"
                     /db_xref="GI:492987635"
                     /translation="MRIQQLRDLLEYVANCRLDMAQLYGRLNNQADSARVKMMLDYFE
                     SHQKTMAEKLRDYIEEAPHRILDTWYKDFTFEDFTKRCQDTMLPANMNEDDVLNLHLD
                     LENRLIGLLEKTVNSTTAEDARNALANLIRVEKTQQQRLVHSTIRMDDI"
     gene            625434..626918
                     /locus_tag="SBAL_RS02820"
                     /old_locus_tag="Sbal_0553"
     CDS             625434..626918
                     /locus_tag="SBAL_RS02820"
                     /old_locus_tag="Sbal_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_011845721.1"
                     /db_xref="GI:500171296"
                     /translation="MAQDLSQFPKALFTQAQVRQAELSAVSQGASSLYELVERAGAAA
                     FECLTKHNPNASSVFFLAGSGNNGADALVCARLARASGMAVSVMMTSVAGTPECQQAL
                     AHYLKDGGELLPKAVAPILAAKIIVDGLLGTGVRDAVRDDMAEYICAINDNAAWVLSL
                     DLPSGVIADTGAVAGVAVMADVTLCFGGWKQGLLTGKARHYSGELEFAALGLTPFFAE
                     ASAQRVGKETLKDYFAARARDSHKGQSGKATVIGGDMGMAGAVRLASEACLRAGAGLV
                     TVISRPDHQLTVNVSRPELMFWGCDLVDMEVYLRLGWAQVIVLGPGLGKHDWGYNLFK
                     AVGLSDKPCVLDADALNLLSNEPRRQTNWVLTPHPGEAARLLGCSVAEIEQDRFAAVR
                     AIQQKYGGVVLLKGAGTVIFDGKQMIVAPVGNPGLASGGCGDVLSGIIGALMAQGMDN
                     MQATVLGVVVHGCAADLAAIQGERGMLASDLMPFIRQLVNSDLL"
     gene            627021..627479
                     /locus_tag="SBAL_RS02825"
                     /old_locus_tag="Sbal_0554"
     CDS             627021..627479
                     /locus_tag="SBAL_RS02825"
                     /old_locus_tag="Sbal_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_006084210.1"
                     /db_xref="GI:493000501"
                     /translation="MTELTFFLDNEDDTIAVGQKLARHVQAPLTLYLTGDLGAGKTTL
                     SRGLIQGLGHKGAVKSPTYTLVEPYELEGVEVYHFDLYRLNDPEELEFMGIRDYFTDK
                     SLCIVEWPDKGEGLLPDADVHMHLSYQNSGREIRIEALSEPGEKLLKAIK"
     gene            627488..628909
                     /locus_tag="SBAL_RS02830"
                     /old_locus_tag="Sbal_0555"
     CDS             627488..628909
                     /locus_tag="SBAL_RS02830"
                     /old_locus_tag="Sbal_0555"
                     /EC_number="3.5.1.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011845722.1"
                     /db_xref="GI:500171297"
                     /translation="MIKNNPYFQIIILSLCSFLSVAAHAANQLESVRIWAAPESTRIV
                     FDLSEAPDYTYFSLDGPNRLVVDLKKSATKVALKNLENNSKLVKGVRVSKSPTKGDLR
                     LVIDLVKPLNASLFSLPVTAPYGNRLVVDLEDKTLTTATAVVSSTPVKTVTQAAQSSR
                     DIVIAIDAGHGGDDPGSIGPSGVYEKKVALEIARRVSSKINDTPGMRAVMIRTGDYFV
                     NLNKRSELARNSKADLLISIHADAFTSPNPRGASVWVLSMRRANSEIGRWLEQKEKHS
                     ELLGGAGEIIQNTDNEQYLAMTLLDMSMNSSMAIGHSVAGDILKDLGGVTDLHKSRPE
                     SASLAVLKSPDIPSILVETGFISNPKEERLLSSSRHQENIANAIYKGVSRYYHNNPPA
                     DTLLAQRGGASSSSAKSTKERTPTAYVGSSTSSNVKHKVSRGESLSAIAQRYRVHMSS
                     IKQANGMKSDVVQLGQTLVIPQS"
     gene            628923..630836
                     /locus_tag="SBAL_RS02835"
                     /old_locus_tag="Sbal_0556"
     CDS             628923..630836
                     /locus_tag="SBAL_RS02835"
                     /old_locus_tag="Sbal_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_014620581.1"
                     /db_xref="GI:504433479"
                     /translation="MGIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGASRVDI
                     EIDKGGSKLIKIRDNGSGIPKDELALALSRHATSKLHTLDDLEAILSFGFRGEALASI
                     SSVSRLTLTSRTADQTEAWQAHAEGADMAVKVMPAAHPVGSTIEVVDLFFNTPARRRF
                     LKSDKTEFTHIDEWLKRIALVRGDIHFTLTHNGKMVRNYRPAMNEAQYLQRLTQVCGR
                     PFAEQALKIECQHDDLRLSGYLQSPWSPVISDTHYFYVNGRLIRDRLVNHAVRQAFAQ
                     KAELEQPGYVLMLDIDPHQVDVNVHPAKHEVRFHQSRYVHDYILQALQSALEEAGELN
                     FVHSSSLDEVEDVFVDAPTSATEISAPFVLGADSAQVNVPADTLESAQPLVASAVQVK
                     SAGAGREGTSFGTQTNAFGSMATPRDNSRGSYSAGESRQRTELPSKAAIASYGALLQT
                     PSYSVKDQDYQPSLPMPAILDGQYWVMATADKLSLLPIKSVALATRCQEIEAKLATGL
                     IGQPLLMPVSVAADADWQAVLDEHDTLIRQLGLELTIRYQQLIIKKVPPYIRESQLAK
                     VIPEWLQSLRFETPAPSALAFWLAKHSLTGFVSAPEIWAAFSQLAEEKKQLIANKAIL
                     LPWQSWLEEQASE"
     gene            630829..631755
                     /locus_tag="SBAL_RS02840"
                     /old_locus_tag="Sbal_0557"
     CDS             630829..631755
                     /locus_tag="SBAL_RS02840"
                     /old_locus_tag="Sbal_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WSV3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="WP_014620582.1"
                     /db_xref="GI:504433480"
                     /translation="MNKELQPKVIFLMGPTASGKTALALELAEKHNCEIISVDSALIY
                     RGMDIGSAKPSVDELARGPHRLIDIRDPRESYSAADFRADAIAEIEQIVSMGKTPVLV
                     GGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLRDIDPVSAERIHPN
                     DPQRLSRALEVYRISGKSMTELTQTKSAPLPYDVVQFAIAPRERKVLHDLIAQRFAIM
                     LKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLA
                     KRQLTWLRSWPELNWLESGAEGNLVTLMRQCR"
     gene            631848..632120
                     /locus_tag="SBAL_RS02845"
                     /old_locus_tag="Sbal_0558"
     CDS             631848..632120
                     /locus_tag="SBAL_RS02845"
                     /old_locus_tag="Sbal_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8EJ69.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA chaperone Hfq"
                     /protein_id="WP_006084207.1"
                     /db_xref="GI:493000492"
                     /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVI
                     LLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGAQDDAPSGE"
     gene            632144..633451
                     /locus_tag="SBAL_RS02850"
                     /old_locus_tag="Sbal_0559"
     CDS             632144..633451
                     /locus_tag="SBAL_RS02850"
                     /old_locus_tag="Sbal_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080055.1"
                     /note="involved in modulation of proteins HflK and HflC;
                     part of the hflA locus (high frequency of lysogenization)
                     which governs the lysis-lysogeny decision of bacteriophage
                     lambda by controlling stability of the phage cII protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase HflX"
                     /protein_id="WP_011845725.1"
                     /db_xref="GI:500171300"
                     /translation="MFDRYEAGETAVLVHIDFSDEERREDLVELQLLVESAGARSVGV
                     ITGSRRSPDRKFFVGSGKAEELAALVAATEANVVIFNHALSPAQERNLEQVCHCRVLD
                     RTTLILDIFAQRARTHEGKLQVELAQLRHMSTRLIRGWTHLERQKGGIGLRGPGETQL
                     ETDRRLLRGRIKNINKRLERVDKQREQSRRARKRSDLSTVSLVGYTNAGKSTLFNALT
                     SSDVYAADQLFATLDPTLRKLDLPDGAVILADTVGFIRHLPHDLVAAFKATLQETRQA
                     ELLLHIIDCADENMADNFDQVQSVLKDIEADEVMQLVVCNKIDLLEDVTPRIEYNDIG
                     KPVRVWVSAQKRLGFDLLLKAITELIGEVIKELTLRIPATAGHYLGQFYRLDAIQQKE
                     YDDLGNCILSVRLSDADWRRLAKQSQGELETFIYEDSIDEAVC"
     gene            633488..634627
                     /locus_tag="SBAL_RS02855"
                     /old_locus_tag="Sbal_0560"
     CDS             633488..634627
                     /locus_tag="SBAL_RS02855"
                     /old_locus_tag="Sbal_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protease HflK"
                     /protein_id="WP_011845726.1"
                     /db_xref="GI:500171301"
                     /translation="MAWNEPGNKGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGNG
                     LGQSFSSFSLIIILAVAVVVWGLSGFYTIKEAERGVALRFGKHAGEIGPGLHWKATFI
                     DQIYPVDIQSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREA
                     TDSALRYVIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAVVDVNFLPARPPE
                     EVKDAFDDAISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREVLEARG
                     KVARFELLLPEYQAAPDVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDKLIQ
                     QKPATTELEAKPQQNVNSSSVSTTRANEPLSGRPSRDDRTRQGRE"
     gene            634631..635524
                     /locus_tag="SBAL_RS02860"
                     /old_locus_tag="Sbal_0561"
     CDS             634631..635524
                     /locus_tag="SBAL_RS02860"
                     /old_locus_tag="Sbal_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protease HflC"
                     /protein_id="WP_006080058.1"
                     /db_xref="GI:492987647"
                     /translation="MGRLSVILIAVLLGIGLSSLMVVNEGERAIVARFGEILKDNVDG
                     NRVTRVYGPGLHIKVPVIDKVKLLDARIQTLDGAADRFVTSEKKDLMVDSYVKWRIAD
                     FEKYYLSTNGGIKSNAESLLQRKINNDLRTEFGRRTIREIVSGKRDELQNDALENASE
                     SAKDLGIEVVDVRVKQINLPANVSNSIYQRMRAERQAVAKEHRAQGKEQSEIIRATID
                     ANVTVKIAEAERKALTIRGEGDALAAKIYSDAYSKDAEFFGFVRSLEAYRASFSGKSD
                     IMVLEPDSEFFKYMKSTAPKK"
     gene            635895..636485
                     /locus_tag="SBAL_RS02865"
                     /old_locus_tag="Sbal_0562"
     CDS             635895..636485
                     /locus_tag="SBAL_RS02865"
                     /old_locus_tag="Sbal_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011788046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol-cytochrome C reductase"
                     /protein_id="WP_006080059.1"
                     /db_xref="GI:492987648"
                     /translation="MSNAPVDTGRRRFLTAATAVVGGAGAVAVAVPFIKSWNPSAKAK
                     AAGAPVEVNISKVEPGQLIRVEWRGKPVWVVRRTDAVINELPTHDDKLRDPASAEMQQ
                     PDYATNPLRSIKPEYFIAVGICTHLGCSPTYLPDSFGEQVEGVTSGFFCPCHGSKFDM
                     AGRVFQGVPAPLNLVIPPHQYVDDGTVIIGVDKGVA"
     gene            636485..637699
                     /locus_tag="SBAL_RS02870"
                     /old_locus_tag="Sbal_0563"
     CDS             636485..637699
                     /locus_tag="SBAL_RS02870"
                     /old_locus_tag="Sbal_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B"
                     /protein_id="WP_011845727.1"
                     /db_xref="GI:500171302"
                     /translation="MVKNLINWIDARIPMTATYNRHVGQYATPTNFNFWYFFGSLAML
                     VLVNQLLTGIWLTMNYVPTAEGAFASVEYIMRDVEYGWLLRYMHSTGASAFFVVIYLH
                     MFRGLIYGSYQKPRELLWLFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAI
                     PVIGDDLTLWIRGDFVISGATLNRFFALHVIALPLVLVVLVFLHLIALHEVGSNNPDG
                     IEIKKNKDENGWPVDGIPFHPYYTVKDIMGVAGFLIVFCWVMFFVPEGGGYFLEGPNF
                     EAANPMKTPVHIAPVWYFTPFYAILRAIPDKLTGVVMMGLSIAVLFVLPWLDRCKVKS
                     IRYRSTLHKLNIAQFAISFIVLGYLGAVPATPELTIAARIFTVTYFGYFLLLFIYSKN
                     EKTKPVPARLTH"
     gene            637699..638394
                     /locus_tag="SBAL_RS02875"
                     /old_locus_tag="Sbal_0564"
     CDS             637699..638394
                     /locus_tag="SBAL_RS02875"
                     /old_locus_tag="Sbal_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011845728.1"
                     /db_xref="GI:500171303"
                     /translation="MKKLLIALVTLLPTLAIAATEHVHLEKANVDLHDKASLERGVDL
                     FQHYCSGCHSTQYQRYERVATDIGISADDMRNKYMFTDAKIGELMQNAIPHKDSAKWF
                     GATPPDLTLVARVRGEDWVYSYLKGFYKDPSRPFGVNNTVFPSVGMPHVLEELQGTPV
                     KQEDGTVVVTGGKLNAEEYDQAVRDITGFLVYSAEPVQLERKAMGWWVLGFLFIFFIV
                     AYLLKKEYWKDVH"
     gene            638491..639120
                     /gene="sspA"
                     /locus_tag="SBAL_RS02880"
                     /old_locus_tag="Sbal_0565"
     CDS             638491..639120
                     /gene="sspA"
                     /locus_tag="SBAL_RS02880"
                     /old_locus_tag="Sbal_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080065.1"
                     /note="transcriptional activator; required for activation
                     of bacteriophage P1 late promoter; induced by starvation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stringent starvation protein A"
                     /protein_id="WP_006080065.1"
                     /db_xref="GI:492987654"
                     /translation="MAVAANKRSIMTLFSGADDLYSHQVRIVLAEKGVTVDVLQVDPN
                     EMPEDLLEVNPYNSVPTLVDRELVLYESRIIMEYLDERFPHPPLMPVYPVSRGQSRLM
                     MHRIDTDWYSLVDRIRKGDRVEAARKELTESLIAIAPIFGEVPYFMSEEFGLADCYLG
                     PLLWRLPVLGIELDSRVAKDIKAYMTRIFERESFKASLTEAEREMRMGM"
     gene            639120..639557
                     /locus_tag="SBAL_RS02885"
                     /old_locus_tag="Sbal_0566"
     CDS             639120..639557
                     /locus_tag="SBAL_RS02885"
                     /old_locus_tag="Sbal_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011845729.1"
                     /db_xref="GI:500171304"
                     /translation="MKPLTPNRPYLLRAYYDWLMDNQLTPHVVVDAFVEGTQVPQQYV
                     KDGQIVLNIAAGAVGNLQISNEFVEFNARFGGVPQQVMLPMASIVAIYARENGAGTVF
                     DIEDAYLVDDEVDSSLSVVETNDKAPEPTDEPPKRHSHLTVVK"
     gene            639750..640334
                     /locus_tag="SBAL_RS02890"
                     /old_locus_tag="Sbal_0567"
     CDS             639750..640334
                     /locus_tag="SBAL_RS02890"
                     /old_locus_tag="Sbal_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084204.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="WP_011845730.1"
                     /db_xref="GI:500171305"
                     /translation="MLLMIDNYDSFTFNLVQYFQQLGQEIVVKRNDEISIAEIEALAP
                     THLVISPGPCTPNEAGVSLAAIKHFATRMPILGVCLGHQAMAQVFGANVVRAERVMHG
                     KVSAIAHTGQRLFEGLNQPLTVTRYHSLLVDAVPEGFVLDAWFDDPIHGREIMAMSHQ
                     DLPLYGVQFHPESILTEQGLELLANFLAQSAVPV"
     gene            640525..642996
                     /locus_tag="SBAL_RS02895"
                     /old_locus_tag="Sbal_0568"
     CDS             640525..642996
                     /locus_tag="SBAL_RS02895"
                     /old_locus_tag="Sbal_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="WP_011845731.1"
                     /db_xref="GI:500171306"
                     /translation="MRSVMRNLGLSALAVAVLAGCAATSTETAAPASSPQAFQVPLAQ
                     PPQVSQALTLNQIMANPDWMGVFAKEAYWSDDSQSVLFARQASASPLRSYYQQGINDS
                     RAVELALDKLHAADQQFGVFDRAKSHKAYLYQGNIFVKQLSTGKISQLTRQRSAIDGV
                     RYLNNGDIAYWQGDNVFQIHQDSGLVEQLAEIKMAKAPEGVKEPTSYIAKQQHRLIKY
                     VALQQENAKAKAQYKDELQKSDPTLAASTWYLGDSEVVSELSLSPDGRYILLALTDKN
                     YSGSSEHDIMPNYLGSDGYIDPVPVRARVAEDTPPGQRFVVLDLNQHKQVDITIEGLT
                     GFDEDVLAKVKAENAKAKGETYQSTKAPRKIQLMQDWGWTQSAIQWHESEDKLALMLE
                     ATDNKDRWIASVDLTKGKFTTEHRLHDDAWVNYDYNQFGWLPGTDSLYYLSEESGYSQ
                     LYVKGLGEKPRALTQGKFVVSDIQLSPDANYIYYKANQTHPGIYNVHRVNLATGKNEQ
                     LTQWDGNLDYSLSPDGTQLLLNASRRTQPNELYVQSIGGELKQLTSYTSDAFKNYPWQ
                     APEVVAVPSSHGAGKVYARVYLPQGYDKSRAEKYPAVIFNHGAGYLQNADYGFSGYFR
                     EFMFHNLLTQQGYVVMDMDYRGSKGYGRDWRTAIYRNMGHPEVEDLKDGVSWMGTNTN
                     VDTQRVGTYGGSYGGFLTFMSLFTAPDLFQAGAALRPVADWAQPYTSNILNTPDVDPI
                     AYERSSPIEHAQGLTKPLLIMSGVMDDNVFFQDSVRMVQHLIELEKPTFETAIYPVEP
                     HGFRQPSSWLDEYRRIYKLFEQELK"
     gene            643201..644346
                     /locus_tag="SBAL_RS02900"
                     /old_locus_tag="Sbal_0569"
     CDS             643201..644346
                     /locus_tag="SBAL_RS02900"
                     /old_locus_tag="Sbal_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011627247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_006080071.1"
                     /db_xref="GI:492987660"
                     /translation="MAISVAGGVRPGKIIEIEHRLYQQLILGKHKASPTLLDDLDLEL
                     EADANKLDVEREAILARLMKQIKAKEVFEAVSSQLHETVNNAIEHQLASPELVLAKSE
                     INESQILLLELLLAKNLDATRLRPLISNLSWLCRDLTNMVNSPSFRARRPQSSDVRVT
                     DIKLVMNYIGIENLRTIIPYFCLRNWLPSANAKLLWTTRKLWRYSIVSGIAANALAQL
                     HNTDSALVYSSALLNQLGTSVVLSLSARLFDQTWGAWIREASSSRDKEVYDAVIATEF
                     PAKAVFEQVLSHGHKLNWQLLELLKFEASPLTGLLKELDLTLSYRELSPQAALVARAN
                     CYAKVVLLEEMRQIDPQEKRLMFDYYELTEQEVLRLKAQNYRKLDLL"
     gene            644402..645313
                     /locus_tag="SBAL_RS02905"
                     /old_locus_tag="Sbal_0570"
     CDS             644402..645313
                     /locus_tag="SBAL_RS02905"
                     /old_locus_tag="Sbal_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011845732.1"
                     /db_xref="GI:500171307"
                     /translation="MPSWQASVLNTILSYVARPSISRGKAKVPLAQVRKKLLDLDKRW
                     LPWPDKLVSATIPLQHSSLLHYVLLNQQTRLGNLFYIRGGGFCFKTPHAHARLIADIS
                     QRCKLDAYIPDYRLAPEHPFPAPFDDVLEAYKRLIALKGAENVILMGDSAGGNLALSL
                     LLELKRLALPLPTACILLSPALDLALTGDTELILAADDPFFTIEALLRLRGAYLAGAD
                     PMSAKVSPLQGDLADLPPILVIAGTRELLLQDSERLVAQVKASGGEITGCFYPNMPHV
                     FPLFNLLPEALEVRSKISHFVLSHLIR"
     gene            645622..646839
                     /locus_tag="SBAL_RS02910"
                     /old_locus_tag="Sbal_0571"
     CDS             645622..646839
                     /locus_tag="SBAL_RS02910"
                     /old_locus_tag="Sbal_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase"
                     /protein_id="WP_006080073.1"
                     /db_xref="GI:492987662"
                     /translation="MSVDMKLDRAQFDAVMVPNYAPAAVIPVRGEGSRVWDQEGNEFI
                     DFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPALELATKLVNSTFADKVY
                     FANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFTVSVGGQAAYSDGF
                     GPKPQSITHLPFNDVAALEAAVTDRTCAIMLEPLQGEGGIIDADPAFLKAVRELANKH
                     NALVIFDEVQTGVGRTGELYAYMGTEIVPDILTTAKALGGGFPIAAMLTTAEIAEHLK
                     VGTHGSTYGGNPLACAIGNAVLDVVNTPEVLDGVKHREQLLRDGLNKINEKYHVFSEV
                     RGKGLLLGAVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPSLVIPEADIAEGL
                     ARFERAVASIAAA"
     gene            646967..647986
                     /locus_tag="SBAL_RS02915"
                     /old_locus_tag="Sbal_0572"
     CDS             646967..647986
                     /locus_tag="SBAL_RS02915"
                     /old_locus_tag="Sbal_0572"
                     /EC_number="2.3.1.109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine N-succinyltransferase"
                     /protein_id="WP_011845733.1"
                     /db_xref="GI:500171308"
                     /translation="MLIIRPIQVGDFEALYQIAEESGHGFTSLPVNADLLRHKIARAE
                     ASFVKTVDAPFDEGYLMVLEDTDTREVVGTCAIEAAVGMEDAFYHYRLGTEVYHSEQI
                     DVRNEVETLTLCHDYTGAAEMCTLFLREAYRKGNNGRMLSRSRFLFLAQHAKRFGETV
                     IAEMRGVSDADGHSPFYGWLQKHFLGIDFIQADYLSGLGKKAFMAEMMPRNPVYVCLL
                     PEEAQKVIGEVHTNTRPALSLLQAEGFRCRGYVDIFDGGPTVECRLSDIRGVRESRLL
                     TVDIGDMVEADTQFIISNTQLANYRATSAALAVDDKSEHIIISPELAAGLLLAKGDQI
                     RILAM"
     gene            647996..649456
                     /gene="astD"
                     /locus_tag="SBAL_RS02920"
                     /old_locus_tag="Sbal_0573"
     CDS             647996..649456
                     /gene="astD"
                     /locus_tag="SBAL_RS02920"
                     /old_locus_tag="Sbal_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080076.1"
                     /note="a high throughput screen identified this enzyme as
                     an aldehyde dehydrogenase with broad substrate
                     specificity; converts succinylglutamate semialdehyde and
                     NAD to succinylglutamate and NADH; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-succinylglutamate 5-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_011845734.1"
                     /db_xref="GI:500171309"
                     /translation="MTHYIQGQWHAGKGHDVASINPANAQTIWTGKTATAEQVNAAVD
                     AAREAQFDWFMLGFDARLAIVEAYRSQLEANKAELAETIAQETGKPQWETATEVGAMI
                     GKIALSAAAYNKRTGTEANDTPAGRAVIRHKPHGVVAVFGPYNFPGHLPNGHIVPALL
                     AGNTVIFKPSELTPKVAELMVSLWDKAGLPAGVLNLVQGEVDTGKALASHPQLDGLFF
                     TGSSRTGHFLHQQYAGHPGKILALEMGGNNPLIIKGVQDIKAAVHDILQSAYISSGQR
                     CTCARRLYVEQGEQGDALIAMLAAAVKQIKVGPWNAQPQPFMGSMISETAAKGMVAAQ
                     TNLQNLGGVSLVELTHLEAGTGLVSPGLIDVTAIDVLPDEEYFGPLLQLVRYSDFDQA
                     IKLANQTRYGLSAGLLADSREDYDYFLARIRAGIVNWNKQITGASGAAPFGGVGASGN
                     HRASAFYAADYCAYPVASVEADAVSLPATLSPGLSL"
     gene            649665..650468
                     /locus_tag="SBAL_RS02925"
                     /old_locus_tag="Sbal_0574"
     CDS             649665..650468
                     /locus_tag="SBAL_RS02925"
                     /old_locus_tag="Sbal_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate aminotransferase"
                     /protein_id="WP_006080078.1"
                     /db_xref="GI:492987667"
                     /translation="MHTDINALFAALWQDYIQMTPSAAKVHALLGHGKPIINDHIALR
                     TFNIAKVNLDVLAKHFTSLGYVPCGDYKFEQKKLIAKHFEHPDSTQPKVFISELLVEE
                     FSPALQDTIRGLIAQVDVAATTADNFIYSGRHWSLDSKTYQDLLTESEYAAWVAAFGY
                     RANHFTVSINHLDGFETLESVNDALKQAGFVLNGSGGEIKGSPEVLLEQSSTMADKIG
                     LEFTDATVEIPSCFYEFALRYPMANGELYTGFVAASADKIFESTNVNKA"
     gene            complement(650594..651922)
                     /locus_tag="SBAL_RS02930"
                     /old_locus_tag="Sbal_0575"
     CDS             complement(650594..651922)
                     /locus_tag="SBAL_RS02930"
                     /old_locus_tag="Sbal_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845735.1"
                     /db_xref="GI:500171310"
                     /translation="MISIRTKLSLWLTGLLVIGTVIGLILFESMLRQAFHDSIINRLE
                     EDLEHIMLATHIHDGDISIDQSQLSSFYKPAYSGRYFQLNLPNEVIRSRSLWDMQLDI
                     EPLAPNKTRVWQAKGPKNNDMQLLSLGLNSSSANVSATLTVAQDLSIGRRVFSEVYGT
                     KLGINLAMLVAMIAGIFLILRQSFKPVKHIQHALSRLREGEINALELNNIPPEVQPLA
                     KTYNELLEYTAKQIERSRNNLGNLSHGLKTPLAVMQQQVEALGLKDPETAIALQQQLD
                     SIHKMVERKLAAARITGDMLPAAQLVIPRDLHSLANTLNKVHRNKTIECAFELDPNIL
                     RLPIHREDGMELLGNLLDNAFKWAQSRVSIQLSRQQERLCLCIDDDGPGVADDELDKL
                     TQRGTRLDESVMGHGLGLSIVKEIAEQYEIGLKFSHSTRLGGLRIELTFS"
     gene            complement(651919..652593)
                     /locus_tag="SBAL_RS02935"
                     /old_locus_tag="Sbal_0576"
     CDS             complement(651919..652593)
                     /locus_tag="SBAL_RS02935"
                     /old_locus_tag="Sbal_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011790767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_006080080.1"
                     /db_xref="GI:492987669"
                     /translation="MKLLLVEDNPMLVTELEKQLKLAGYVTDITDKALEADYLIKETQ
                     YDCVILDIGLPDGNGLELLEGWRNQGISTPVIMLTARSQWHEKVEGFNAGADDYLGKP
                     FHAQELLARIQALIHRAHGRLNTSSKQLSYGGVILDEAEQTVKVADQLFELTAMEFRL
                     LKIFLMSPKKLLSKTQLTDKLYQFDDEKESNVVEVYVTHLRKKLGKTAIETRRGQGYI
                     FHGIIE"
     gene            complement(652574..652921)
                     /locus_tag="SBAL_RS02940"
                     /old_locus_tag="Sbal_0577"
     CDS             complement(652574..652921)
                     /locus_tag="SBAL_RS02940"
                     /old_locus_tag="Sbal_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080081.1"
                     /db_xref="GI:492987670"
                     /translation="MKRLFLICFFSLFTLAHPMQLNAEPIELEHYQAKALVNSGQILS
                     LNGTLAVVNQFCQGELIDAHLYQEDHKWRYDLQIKVQRGQIVNLSIDATNGQADHSIA
                     LPSECRKHETVTR"
     gene            complement(653004..653639)
                     /locus_tag="SBAL_RS02945"
                     /old_locus_tag="Sbal_0578"
     CDS             complement(653004..653639)
                     /locus_tag="SBAL_RS02945"
                     /old_locus_tag="Sbal_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012156707.1"
                     /note="cAMP receptor protein; complexes with cyclic AMP
                     and binds to specific DNA sites near the promoter to
                     regulate the transcription of several catabolite-sensitive
                     operons; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_006080082.1"
                     /db_xref="GI:492987671"
                     /translation="MALIGKPKPDPTLEWFLSHCHIHKYPAKSTLIHAGEDSDTLYYI
                     VKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEQAERTAWVRAKQACEIAEISYK
                     KFRQLIQVNPEILMKLSAQMAYRLQSTSQKVGNLAFLDVAGRIAQTLLHLAKQPDAMT
                     HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEEQNLIQAHGKTIVVYGTR"
     gene            654070..654849
                     /locus_tag="SBAL_RS02950"
                     /old_locus_tag="Sbal_0579"
     CDS             654070..654849
                     /locus_tag="SBAL_RS02950"
                     /old_locus_tag="Sbal_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011070955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845736.1"
                     /db_xref="GI:500171311"
                     /translation="MKYRLWVLGAGLSLTIGLSSAAHAFSIPQPAAELAASKFVHIQV
                     TAEQGDADAQFLLGLMYLSGRFVAQEVPSGLHWISLAAEQQHEKAQQTLADLSFEGQL
                     IKRDLSVAEHWYRALSEQGSRWAQFRLGFIYASGGDGVQRNCGKAVEQFSQVGDDVAL
                     GNVAWILATCPEAEYRDGNKAVELSLKLLKVNENDPTNLDNLAAAYAEVGDFGAAIST
                     QQKAIEALKMSAEMTKTDEFMQRLQTYEQKRAYRETLRLLE"
     gene            complement(654976..655521)
                     /locus_tag="SBAL_RS02955"
                     /old_locus_tag="Sbal_0580"
     CDS             complement(654976..655521)
                     /locus_tag="SBAL_RS02955"
                     /old_locus_tag="Sbal_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase"
                     /protein_id="WP_011845737.1"
                     /db_xref="GI:500171312"
                     /translation="MQQRLFLGFAPTAAQRARLSDVQQQLFCHLNPEAKAVSVTNMHL
                     TLCFLGQVDDEQRIALLDAIDRLAKPRFSVQLNLLDLWPNAKVCCLKGDEVEPPLAQL
                     AKQTQAIAGRLQLHSSEHHFCPHISLFRKAKQWTLDEAALLQLKDMNTLTLTPECLHL
                     YHSKSTSTGVEYHILHSWTLG"
     gene            655721..657940
                     /locus_tag="SBAL_RS02960"
                     /old_locus_tag="Sbal_0581"
     CDS             655721..657940
                     /locus_tag="SBAL_RS02960"
                     /old_locus_tag="Sbal_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-D-manno-heptose 1-phosphate
                     guanosyltransferase"
                     /protein_id="WP_011845738.1"
                     /db_xref="GI:500171313"
                     /translation="MLVGLANPLQQALVSIFSESPLETLEQNVDRALETITLQLHCDG
                     VFVLTGSQSLDRLRTRNLYLKPQFAKGQQTRVWPLARMPFFRSLVRTPRLLNLPDVNT
                     LPADAQAERALLRDWDVKSLLVLPPVVFGETRIALGAVNCSECCEWSEEFISEFNHAA
                     VMIGSAMELTRIALSMLASEHKYCEVFNQLPLACALLDKYNQLTMLNKVALQTLPIQH
                     GYDLFDMVREEEHAMLTDTLHVVREGVLGQAWCELPLKSIHQLAWLKLSFSQISGDKD
                     TLVMIAEDVSEKYRLADELSFHANYDALTGLPNRLHFEALLENLLHAHDDMPICVAFL
                     DLDQFQVINNISGHQAGDKLLCQVALRLKQLVRKGDIVARLGGDEFGILMHYCNVDSA
                     KQIAKRICTQLANHEFIWEGRSHNVSVSMGIAKLDKKAADIYTVMSQADAACRLAKDQ
                     GRNGWHLYSASDPKMNRLYTEMMASVDIVGALALNQFELYFQSIVPLNREESGLHLEI
                     LLRMVQANGTIVSPAIFLPAAERYNLASKVDLWVIDNLLKWGGCHLDIWQQLDLVSVN
                     LSATSLGDFEFMNWLEMRLMAEPELVDKLCIEITETAAVSQLDQATKLLDILRPLNCK
                     LALDDFGAGFSSFAYLKRLNVDFVKVDGQFVVNICEDCADQAIVKSICQLGQDMGFDV
                     VAEFVESQDIGRKLQILGVDYAQGYAINKPIQLAELQSGLSQPWLEKRETFAAYPQL"
     gene            658023..660587
                     /locus_tag="SBAL_RS02965"
                     /old_locus_tag="Sbal_0582"
     CDS             658023..660587
                     /locus_tag="SBAL_RS02965"
                     /old_locus_tag="Sbal_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_011845739.1"
                     /db_xref="GI:500171314"
                     /translation="MLAADVFFLNSLPIHSLLAPLRAAFSRHAQVILEAPTGAGKSTA
                     LPLAMLDWPEISGRILMLEPRRVAARSVAHYIAHCRQQKVGQEVGYRVRGEAKVSANT
                     RLEIVTEGILTRMIQQDPELTGIEMIIFDEIHERHLTTDLGLALALEVQASLRDDLKI
                     LAMSATLSGLALGELMPEAVTLHSEGRSFPVEVEYRPVPTQQHWIDHLGRCVLDLVSA
                     SSANVDKTASNNAVLVFLPGKGEISRLQQFLRERLAQDAFLICPLYGELSGADQDSAI
                     AATTDGRRKIVLATNVAESSLTIEGIGFVIDSGYKRQASFNPKTGVTRLGLKRISQAS
                     ATQRSGRAGRLSAGVCVRLWSQEEHGRMLRADEPEISQADLVAMAHDCAYWGAKSFSD
                     LMLLTPPPSVNEALAWQLLQRLGMVDGDNKLTSHGKAAYELGCHPRLAHMLLGAKSLS
                     VKSLGANYEQTAQLGSLACLLSGVLEARGLPKKGADIMNYLHFACQGQAGQQAKQWQK
                     KLGLTADLVKVATHAHHSDVGLLLALAYPDRIAKARGVEGYQLANGTGVVLTAEDALS
                     QTPWMVVADFQETEGRNAGRIYLASQFQPILFDSELKDLLEIHEICGWDEGKGRVIAE
                     RQYKVGQILVKTETIAKPERKQIVAALLGYIRQQGLQILNWNANLEQFQYRLKLATEF
                     DAGSDWPKVDDGALLASLETWLAPYLENVNNLPQLVKLDCFGFVANCLSWQQKQRLDE
                     LLPTSWPLVTGTSAPIVYDESGRALLRVRLQETFGMAQSPMLAQGKLKVTMELLSPAQ
                     RPLALTADLASFWQGPYVEVKKEMRGRYPKHLWPDDPVNTLPTKFTKKKTLGLAQP"
     gene            660672..662996
                     /locus_tag="SBAL_RS02970"
                     /old_locus_tag="Sbal_0583"
     CDS             660672..662996
                     /locus_tag="SBAL_RS02970"
                     /old_locus_tag="Sbal_0583"
                     /EC_number="2.4.1.129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1B"
                     /protein_id="WP_011845740.1"
                     /db_xref="GI:500171315"
                     /translation="MNDEVDMTTKTTKKTPASRRANNGRGLFRRMWSITWKLALAGLA
                     VVTFYSIYLDQIIAQKFEGQKWHLPAQVFSRSMALYPGAAVSHPQMMAELKLLGYRKV
                     ANPRQVGEFSASSTRIELWRRPFLHPEGDQVEQRVMISFDSNGVSSVSRVSDKRQLAV
                     FHLEPVLLDRIITGDGEDRLFVPTEEMPKSIVQALLLVEDRSFYEHHGVNPFAIARAA
                     FVNISAGRTVQGGSTLTQQLAKNFFLSSERSLLRKVREALMAVIIDFRYSKDEILEAY
                     LNEVYMGQDKSRAVHGMGLASRFYFGRPISELTIAQQAFLVAAIKGPSYYNPWRYPER
                     IQERRDLVLRLLMDAGDLTTAEYKAAVESPLAIRNLNKPAHQKLPSFFALVKQEVNER
                     YGEALLKQSGVKIYTTLDPMAQEAAEIAVTQTLKSLDKSNKSLQVGMVVTDKYTGGIA
                     AMVGDKTPGFDGFNRAVEIRRPIGSLIKPFVYATALAPNSQFTLATPLKDQPITLKSE
                     QGKTWSPQNFDKKFSGQVPLLTALKKSMNVPTVNLGIAVGVDAVATTLAKSGWQEPLN
                     EYPSMLLGAVNGSPLMVAQVYQTLADSGVYRKLTTVTAVLDADKNPLPVTRLPKEQAI
                     SPDTDFLIQYAMQQVVNTGTATRLGNAFPGVGLAGKTGTSNDSRDSWFAGFDERNVAA
                     IWVGRDDNGKTSLYGSSGAMAVYLAFLKERPPISLRSIQVNGVVKGFFDRDTGVAKES
                     DCSNVDALPTLTATYRPVNNCGEPLQWWQKILGQ"
     gene            663149..663427
                     /locus_tag="SBAL_RS02975"
                     /old_locus_tag="Sbal_0584"
     CDS             663149..663427
                     /locus_tag="SBAL_RS02975"
                     /old_locus_tag="Sbal_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_006084190.1"
                     /db_xref="GI:493000406"
                     /translation="MFKTAAAVHILVKHKEQAEDIVKQLNNGANFAVLAKRFSSCPSA
                     KKGGDLGEFKKGQMVPQFDKVAFSGELLVPHIVKTKFGWHVVKVLYRT"
     gene            663518..663913
                     /locus_tag="SBAL_RS02980"
                     /old_locus_tag="Sbal_0585"
     CDS             663518..663913
                     /locus_tag="SBAL_RS02980"
                     /old_locus_tag="Sbal_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080091.1"
                     /db_xref="GI:492987680"
                     /translation="MTFSFNTEDASQVCVGAFALAVPVAFSEEAWHLGETLPVLNLAM
                     LFSLSLLFLGVFTYHSVFQQNISARVPVFIFRIVVAYLLTALVVFLVLLCLDKVPFFE
                     DPLTSIKRIIVITMPASMGAIVVDSFDKE"
     gene            664072..664302
                     /locus_tag="SBAL_RS02985"
                     /old_locus_tag="Sbal_0586"
     CDS             664072..664302
                     /locus_tag="SBAL_RS02985"
                     /old_locus_tag="Sbal_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845741.1"
                     /db_xref="GI:500171316"
                     /translation="MNTGALALLIPILAIVGGYVVAIMKIRDKQGVSSREQEAENQAL
                     RAELVTLRQRVEVLEQLVTDDSFQLKREFKQV"
     gene            664514..665215
                     /locus_tag="SBAL_RS02990"
                     /old_locus_tag="Sbal_0587"
     CDS             664514..665215
                     /locus_tag="SBAL_RS02990"
                     /old_locus_tag="Sbal_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084189.1"
                     /db_xref="GI:493000405"
                     /translation="MFLAPYFSEQNQAISVSAQQASDFAKKIAQDFNPIHNVGAKRFC
                     VPGDLLFAIVLTQYGLSQSMKFSFAGMVGASVELQFPEQVSESFSIRDGREKTYLNVS
                     RQGDVSCCDAQTESFIRQYVAFSGHNFIDILIPLMKQHQVMINPDRPLVIYESMSFDL
                     TTLDFVQVTLSLVDQDLKIDGKRGDVTLHFELHSGDTLVGTGIKTLVMSGLRPYDEAL
                     AQQMCATYEGSKTDY"
     gene            complement(665296..666600)
                     /locus_tag="SBAL_RS02995"
                     /old_locus_tag="Sbal_0588"
     CDS             complement(665296..666600)
                     /locus_tag="SBAL_RS02995"
                     /old_locus_tag="Sbal_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_011845742.1"
                     /db_xref="GI:500171317"
                     /translation="MFNSSLRKSLEVSENKRQEAESVIDAIKQSIATVEFTPEGKVLD
                     ANTLFLKVVGYSLNEVVGQHHKLFCSATYANSPAYQQFWSNLKAGHPQEGHFARVNKN
                     GQEIWLRATYFPVKQAGKVVKIMKTASEITQYKQQLDDQSAIFDALNRSQAIIEFTPD
                     GTILKANANFLKTMGYSKEQLLGKHHRIFCFDEFYRQNPHFWDELKQGRYSKGLFERK
                     NAYGDSIWLEAAYNPIMDEHGKVVKVVKFASDISKRIEQSHAVREAANIALTTSQRTV
                     EQAEQGVKLLNATVNTSNAIAEQTHKTTQAITQLNEQSQSIQAIVATISSIADQTNLL
                     ALNAAIEAARAGEQGRGFAVVADEVRQLASRTSKSTSEIAAVVTKNTQLTTSATDMMN
                     EVEGIAQEGKQQLAEVTLVMGEIRNGAENVSQIVSQLSINGH"
     gene            complement(666937..670047)
                     /locus_tag="SBAL_RS03000"
                     /old_locus_tag="Sbal_0589"
     CDS             complement(666937..670047)
                     /locus_tag="SBAL_RS03000"
                     /old_locus_tag="Sbal_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetrathionate reductase subunit A"
                     /protein_id="WP_011845743.1"
                     /db_xref="GI:500171318"
                     /translation="MDKSKRRFIKGAAVTGGVGLFAAGYSHTLAQMGKGVVNGTSGKP
                     TQDPLHGNSLAPEYKVDLQSGQLISNDDQRVANTMCLGCWTKCGVRARIDQKTDKIIR
                     ISGNPYHPLSSREHIDFDTPIKTAFVGLSAFQEQGLQGRSTACARGNAMLEQLDSPHR
                     VTQCLKRVGKRGSGQWQSISFEQLLNEVVEGGDLFGEGQVEGLRTIRDIATPLDANNP
                     EYGPKANQLLVSNASDEGRDAIIKRFTFNSFGTRNFANHGAYCGFTYRAGAGALLDDL
                     KKYAHLKPDWDHSEFLLFIGTSPQQSGNPFKRQARQLANARVNNSNFSYVVVVSPMLP
                     NTSNQPCAGNNTWLPIRPATDSALAMGMLRWIIDNQRYAAEFLSAPNVDAAKASGYRG
                     FSNAGFLIISEPTHPRYGQYLFASDLGLPFDGKAYGEEDSQLVVDATSGEVVFASQSQ
                     KAKLDVNQSVDTPKGAIAVKSSFKLLSEAAHSFEMEHYAKECDISEAQIIALADKFTS
                     HGTKAAVISHGGTMSANGFYSAWAIMMLNAMIGNINLKGGALASGGSFPAFGKGPRYN
                     LQEFDGMVEPKGVFLSRSKFPYEKTSEYRRKVEAGESPYPAKEPWFPISSPLLGEHLT
                     AAVHGYPYRLKAWINHMGNPIYGQAGLGEAIGEQLKDPKVLPLFISIDSFINETSALS
                     DYIVPDTLTYESWGWTSAWQGTLTKVATGRWPIVEPRVAKMASGDVVCMESFLSQVAM
                     KLQLPGFGENAVKAADGSLHPLTRAADYSLYGAANVAYLGKAVADINAEDMYLSGVSR
                     IQSELNTRLTPDEVKKVSYLFARGGRFEEMRGARDDAGNPSKVWPKPMMLWNPDVGSR
                     RNSLTGEFMSGCPRLYQPALADGTPLDKAFDKSQWPLLISSYKSHTMSSMSIGSDRLR
                     QVHPNNPVRLNEKTATRLGISTGDTVKISTPNGSVIALVECVAGVHPDCIAIEHGYGH
                     KELGARDTVIDEIKIVANPLIRVGINMNDLNLFDPSRHGRYPLVDWASGASARQGLPA
                     KIEKLS"
     gene            complement(670083..671165)
                     /locus_tag="SBAL_RS03005"
                     /old_locus_tag="Sbal_0590"
     CDS             complement(670083..671165)
                     /locus_tag="SBAL_RS03005"
                     /old_locus_tag="Sbal_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysulfide reductase"
                     /protein_id="WP_011845744.1"
                     /db_xref="GI:500171319"
                     /translation="MAIKEIFTPDIAITWLPWAVQYFFMMGLAYASVWVATIHLFSHA
                     KPDDRLLKLCACLMLTAGIVAPIALLADLHQPLRAWHFYAQVRPDSWMWYGAFLLPVF
                     SSTSALFAWLLLRQYLPKHTANQDSDWVSKIGQLLRFGDWNSDKFIKPIALITALSAC
                     SIALYTGMETMAIKARPLWHTYWLPPLMAMSALLAACGTLAVLNRLLKGYQQTTQDKL
                     LLWVRASFGLFALCLIGWALFDKGSAPEAALLLETSPSWQLAAIWVLVTLAVLALMLA
                     IRNLPNVAMLVVSLTAIHLAWGFRWIVLIQAQTDPKYGAGTYLYQLPWGPEGLLGIAG
                     TFGLWLALMALVSELIRHTPTAKLAR"
     gene            complement(671155..671937)
                     /locus_tag="SBAL_RS03010"
                     /old_locus_tag="Sbal_0591"
     CDS             complement(671155..671937)
                     /locus_tag="SBAL_RS03010"
                     /old_locus_tag="Sbal_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetrathionate reductase subunit B"
                     /protein_id="WP_011845745.1"
                     /db_xref="GI:500171320"
                     /translation="MDKSKRQFLGKMASVSVGAALIPVVQVYAQDNKRSPQMHSASEG
                     QVGKRYGMVIDLRRCVGCQACTVACTIENQPPLGQFRTTVQQYEVSQQEDTTPPAFLM
                     LPRLCNHCEKPPCIPVCPTGATFQRKDGIVVVNNEWCVGCGYCVQACPYDARFINHDT
                     NTADKCTFCAHRLDAGLLPACVETCVGEARVIGDLNDPHSQISQLLATNKTDIKVLKP
                     TANTSPRVFYIGMSSAFEHKISGQAPVRTLLTDTGEEIHHGH"
     gene            672343..674277
                     /locus_tag="SBAL_RS03015"
                     /old_locus_tag="Sbal_0592"
     CDS             672343..674277
                     /locus_tag="SBAL_RS03015"
                     /old_locus_tag="Sbal_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011845746.1"
                     /db_xref="GI:500171321"
                     /translation="MAPRMILRMALAVVLACLLASANVFAAEPQNQSAPSDGMDAKVV
                     APVATEEPGYQVVDVGVLAIRGYKATINRWQPLMGWLETQIPNSYFRLHPLSLDELAK
                     GVETQGLDFVITNPGQSVLLARQYSLTWLATLRSPLNNGAAMQVGSALVVRADSPYQT
                     LTDLKGRRLGIVSKNAFGGYLTLVYEAQLKGIDLPRFVGEIIPLGFPLDNLLYQLDDQ
                     KSGDDAAKDNRLDAAVVPVCQLEQMQAEGLINIGHYRVLDNQTPVGFHCQVSTRLYPN
                     WSMAKTNRASQSLAKSVTQALLALPEDHLAAKTADSAGWTTAVSQLAIDQLLKDLDMH
                     PLQTPWWQRAWQWVKLHQQWAWFVLAILVLLNAYHFWLEYRFSRRGRELINTQRQLNE
                     NRALLEHAQRIAIAGELGASLSHELNQPLAAIGHYCHGAEVRLQRGTSPEELQSVLTL
                     IQQEVTRADSIISRLRNLLKKRPVSKQPLYLHELVNDTVPLLAYEFEQHQINLAVNVS
                     GEPYLQSLDEVGMQQLLLNLLKNAADACVQRLELESSGTEQIITQKPYTPTIDIDLRY
                     QERILLLTVTDNGTGLTEAASLLMQAFYSTKSEGLGLGLVICRDIAESHGGTFSLESA
                     MGGGCQAQVAIPRKLEPNGA"
     gene            674280..674900
                     /locus_tag="SBAL_RS03020"
                     /old_locus_tag="Sbal_0593"
     CDS             674280..674900
                     /locus_tag="SBAL_RS03020"
                     /old_locus_tag="Sbal_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011845747.1"
                     /db_xref="GI:500171322"
                     /translation="MSLELPVYLIDDDDSVRRSLRFMLESYGLKITDFDSAEAFFTAV
                     DLTLPGCALVDVRMPGLSGPQLHLELVAKNSPLAVIYLTGHGDVPMAVEALKLGAVDF
                     FQKPADGAKLAEAVLKALEHTKAHHQDNQYLETYQALTPREREILNLIAQGLKNQEIA
                     DSLCIAMRTVEIHRANLMKGMQVGSLAEMMLIYSRIAERLRLEDNR"
     gene            675261..678935
                     /locus_tag="SBAL_RS03025"
                     /old_locus_tag="Sbal_0594"
     CDS             675261..678935
                     /locus_tag="SBAL_RS03025"
                     /old_locus_tag="Sbal_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845748.1"
                     /db_xref="GI:500171323"
                     /translation="MASLIRIVLIDTHLPGVVELALNGHTNICGTNASGKTTLQRLVP
                     VFYGEYPSRVVPSTRDSFERWYLPHDSSYIIYEYQKADGLLYQAVLASAGDGKGVNYR
                     FIAKGFELSDYIKSQNGDTILCHTMAELGRDLKRAGIATTNLLNTREYRAIIQNDRTL
                     LSTGSNRSELRGYARQFALCEGEHSLRHIEKLAKAVHSKEGKMETVKSMIAAILEEDG
                     VNPPSSRLNPQRVEAWIRESQLIQGFEVIRPEFEKLEQEFNQLLSAELRLSSLSRGYR
                     NDETLEADRQDIQQTLSKELNLKLRLLDDEWKEQRDELNLDLSAAKGDVAKCEYELDA
                     IEDQHSAFLDANIEQAKADLEMLPNWRTDVENLSERHKLQTEKHQDIEAAYNARRSKI
                     GEQLNRELEGLHSDQDKQREARDKQREVARTDIDALELQWRNQMDAGKASFSEQEYQF
                     KLTAAELKLRVDGVTYTEEEKLSLAIFDERIHRADEEQESCNAKVERLSSDERKLRAK
                     RDQANEALRIATLRVNERQTALDELHHMLFPQSHTLLEFLRKEAQGWEQSLGKVIAPE
                     LLHRTDLHPSLVTESSEAFFGVHLDLKAIDVPEYAASEQELRIRLSKAEEAHTSAQEM
                     QAEAESQLVAINGELDNLSRELTFARTAYKNSRDDLRRLFDEKRSEQDKINKALSDRK
                     AHAGQRLTQLDGELKQLKHQHELWLEEQKEQALEARMEKQAYWQEVIGALDNQLGQIK
                     ATIEGRRESAKIEQKACETWYKNELKSRGVDEENILKLKQQIRELETKISRAEQRRSD
                     VLRFDDWYQHTWLMRKPKLQTQLADVKRAVSEIDQQLKAKTLDVKTRRQQLETERKAS
                     DAAQVEASENLTKLRAVMRKLAELKLPSNNEEAQGSLGERLRQGEDLLLKRDYLMGSV
                     KQYVEHFDSVIASKSGSGLAETWERAREESSFINDKGIRLLDYRKLVPQLEQLLNVIV
                     PQSITALREQGRIFGVDLTAFYDVLADIDRRIASQSARITREVGEELFLEGVSESAVR
                     IRSRISELEFWPELEQFVKAFKHWKADGFNGLPDEDYTNSMRRALDIIGRAALTGGIS
                     KLLEIELRLKEGNSDLIIRTDRQLNESSSHGMAYLILCKFLLAFTRLLRGRADVTIHW
                     PIDELGTLHHTNVKKIFDACENNNICVLGAFPNPESEVLNLFANRYIINKQTKKLQVV
                     KPKVNPIADMLNKRLSKEAI"
     gene            678935..679588
                     /locus_tag="SBAL_RS03030"
                     /old_locus_tag="Sbal_0595"
     CDS             678935..679588
                     /locus_tag="SBAL_RS03030"
                     /old_locus_tag="Sbal_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011790751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845749.1"
                     /db_xref="GI:500171324"
                     /translation="MSDATQTVLVGTGALIELLLKGEFICRTTNEEGWRALKNSSTRE
                     RVEAYLNQINRSVASAAEGDVFFCGYLQLGDSERKVISSQFKDICQALIPLVEWLVLV
                     QEASGQDAPLSEGAPVRLTELQSRIEDTPAFREQLAKLSQYRLFGSTSTNSDAQIKLV
                     FKRLVELGYLVRPNAEKQIYIATGKLDYLYEVIRFIDETEGLSLEAQAETATQRDLI"
     gene            679637..680857
                     /locus_tag="SBAL_RS03035"
                     /old_locus_tag="Sbal_0596"
     CDS             679637..680857
                     /locus_tag="SBAL_RS03035"
                     /old_locus_tag="Sbal_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011627215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="WP_011845750.1"
                     /db_xref="GI:500171325"
                     /translation="MSSNLHQAGVKLLKQLGRHADIIMDAYLAGSLNEDAHDPSVVEK
                     LKQAGILWRPEPDQELRLKRSVRALLEEGLSDERNRQIDSNVGSALATIKTLADHYKE
                     ARHSSDYSAAEAYLSDLSEHVYSFADSLRYSIRVLWGRINNEFGYVGTINAKIRENEL
                     AQSQVSELLNGLEMFQFSELGEIAGDIRELRKLLVTTLQETMSDCAQELSVVQGRLLE
                     LLGRFRQIRGRTRLLKGWLLYTDLHPDYRPADHVSHKEIPSLFNRAEILLAPAAVDVH
                     NASQELELMGIVAHIKAISRHPVIEAVRERDASVSLTQSEDFDVPDNPLKQAVDEYFV
                     DVIESGLRQSALEYLVDKALPWEAESWIYQVIGGYEGLPDEHKAYFELEPLGEPHPIY
                     SGNFIIRDVELWLA"
     gene            680845..681717
                     /locus_tag="SBAL_RS03040"
                     /old_locus_tag="Sbal_0597"
     CDS             680845..681717
                     /locus_tag="SBAL_RS03040"
                     /old_locus_tag="Sbal_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845751.1"
                     /db_xref="GI:500171326"
                     /translation="MASLGRQQLQLLEKAFIKRSPKVKLTANWRAIYRELEVGELDES
                     EKYLCFSPRDFDLLRQGVLALMGLDLRDLDFNVDRMAMSAKSHNEKLAKIRPEAEYVL
                     LKFLGFQSPPVAISALSSLRIPLDEAQKHCRELHVAAILVVENLDVFDVIHQARLPED
                     LTNLMVIYRGSGHHSPIGVRHFLQAMAGELPIIAFTDLDPAGLQIAHTLMGVTHCLVP
                     QLALTAAAELLGIGQINSTYDFDKQAKQTKYLQHADLKRWQELAFWLTQHSISIKQQH
                     LLAHGLELVLVPYI"
     gene            682120..>683121
                     /locus_tag="SBAL_RS03045"
                     /old_locus_tag="Sbal_0598"
     CDS             682120..>683121
                     /locus_tag="SBAL_RS03045"
                     /old_locus_tag="Sbal_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845752.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:glutamate symporter"
                     /protein_id="WP_041409054.1"
                     /db_xref="GI:752761936"
                     /translation="MMKSLSTRIFIGLFAGLIFGTIVQYFLNDIGFFSDNLVELAGGV
                     GTMFVNMIMMLVVPLVFVSIVCGVCELQDLKSFGRLGGKTFGFYIINTFVAIATALLV
                     VLLLDPGKGVDMSSTDGLAITATELPSLMALVIDIVPRNPVAAFMSGNMLQVIFMALM
                     LGGVIKSLGEHVAGAVQGFQTANKIMMKLISVVMSLAPYGVFALMFKLGATLDAGVFM
                     SVVEYMVLILALLLLWIFVVYPMAVGIFTPISAKTFREKTQEQVLFSLSTASSNATIP
                     VTMRTLTEKLGVNRAVAGFGVPLGATMNMGGVAIYITIAIFFVANAFGMPITSDQLPS
                     "
     gene            complement(683919..685421)
                     /locus_tag="SBAL_RS03050"
                     /old_locus_tag="Sbal_0600"
     CDS             complement(683919..685421)
                     /locus_tag="SBAL_RS03050"
                     /old_locus_tag="Sbal_0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011839977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011839977.1"
                     /db_xref="GI:500165361"
                     /translation="MPGHRITDQQIRLFMSKRKDHLQVTAASKAGISERSARRIESGQ
                     RQLGPSKPRNYRTRTDPLELVWDPVVLPLLQLSDTITPVGVFDYLCEEYSDVFAVTLR
                     RTLERRIQKWRQINGQDKEVIFRQVKEFGQLGIMDFTWADFIVTIRGTTLKHRFFNYR
                     LPASGWSYVQVVYGGESFVAVATGLQNAFEQSNGVPQEVRTDSLSAAYKNHSNETLFT
                     ERFSELSIHYGFKPSKNNTGIAHENGAIESANNHLKNQIRQALAIRGSSDFDSIDEYE
                     TFIDDVVQRRNRRIMALLIDEQRQLQPLPKFESVNYEIYPVKVSSTSTFQLKRVTYSV
                     PSRLVGATLRVHLFDKKLDIYCHGVHTATLTRVHASANNRGHQINYRHLIGALMKKPR
                     AFRGGQWRDQLLPNEDYRQIWKNVDALLSADEASLYMVRLLNIASKSDREEAVGRFVL
                     EGINLGQRPNIVDCEERFLKDEEWEFNPKVQQHSLASYQQILDEVNEYVS"
     gene            <685500..686171
                     /locus_tag="SBAL_RS03055"
                     /old_locus_tag="Sbal_0601"
     CDS             <685500..686171
                     /locus_tag="SBAL_RS03055"
                     /old_locus_tag="Sbal_0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011718303.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_041409060.1"
                     /db_xref="GI:752761942"
                     /translation="NCRAIALTMRVRNLYTAKDRSGPQKITYEELADPKYKGKICTRS
                     GKHPYNIALVASMIAHHGEAEAKTWLTGVKSNLARKPQGNDRAQVKAVKEGLCDIAIG
                     NSYYYGNMMQDPEQKSWAEAVTINFPNQADRGAHVNVSGMVLARHAPNKANAIKLMEF
                     LSADVAQKAYADVNMEYPVKADVAPSTLVASWGEFKSDQLPIFKLAEYHQAAVKLLDE
                     VQFDL"
     gene            686255..687886
                     /locus_tag="SBAL_RS03060"
                     /old_locus_tag="Sbal_0602"
     CDS             686255..687886
                     /locus_tag="SBAL_RS03060"
                     /old_locus_tag="Sbal_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_011845754.1"
                     /db_xref="GI:500171329"
                     /translation="MILGLARSWSLAGYAVATILVLPLVALILQALQPDEAVFGHLMA
                     TVLPTYIINSLLLIFWVSLGALLLALPCAWLMARCEFVGRRYLQWALLLPLAMPGYIV
                     AYVYTDLLDYAGPVQRSLRSIFGWSSPQDYFFPDIRTLGGAACMLSLVLFPYIYLLAR
                     TAFMEQSLSLAHASRIMGCSPWQSFWRLSLPMARPALAVGVALVAMETAADFATVNYF
                     AVPTLTTAVYDTWLGYGNLTAAAKLSAIILLVVFSLIGFERFARRKQQLFQKQSRIQA
                     SDLYRLSAAQTAVALSFCATLLLLAFLLPFGILLSYAIGYFEQSWDESFWQLSLNSLS
                     LALITSFICCLIALLLMFVRRISPRASDALPSRLASTGYALPGTVLAIGVLVPLTMLD
                     FAINDLADLLGLDGPGLILTGSVVALIFAFCVRFVAIAIGSVESSYKRISPSLDMVSL
                     TMGQGPRQLLQRVHLPLLGKGLFAGALLVFIESMKELPAALLLRPIGFENLATYVFQF
                     VSDEKLEHGALAAIVIVLVGLVPLIYLNRSLEQHS"
     gene            687886..688935
                     /locus_tag="SBAL_RS03065"
                     /old_locus_tag="Sbal_0603"
     CDS             687886..688935
                     /locus_tag="SBAL_RS03065"
                     /old_locus_tag="Sbal_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011845755.1"
                     /db_xref="GI:500171330"
                     /translation="MANTLKLMQVHSDYQGQQVLKGLSLTLDQGEILALLGPSGCGKT
                     TLLRAVVGLQAISQGEIQINGRVVSGDSQFVPSEQRGIGMIFQDYALFPHLTVAENIL
                     FGVAKLSAAERQARLDDMLTLVKLEGLAQRYPHELSGGQQQRVSIARALAYEPQLLLL
                     DEPFSNIDAQVRYEMMAEIRSILKQRNVSAVFVTHSKDEAFVFADTLAIFNQGIIVQH
                     GSAEALYAAPNSRYVADFLGSGNYLPAAVLDGHRVATPIGHLTSLTPLGLPSEFSGTV
                     FLRPQQLTLSADEQGVGTITERRFLGAFCHYWVKIEAASHAYYVEVRSQMMQLTIGQK
                     VGVTTEPHSLVLFES"
     gene            689113..690825
                     /locus_tag="SBAL_RS03070"
                     /old_locus_tag="Sbal_0604"
     CDS             689113..690825
                     /locus_tag="SBAL_RS03070"
                     /old_locus_tag="Sbal_0604"
                     /EC_number="2.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_011845756.1"
                     /db_xref="GI:500171331"
                     /translation="MIKTIKSICTLVTVATAISSSGVMAMDRITGKAFATRSEVYATH
                     GMAATSQPLATQVAIDILKQGGSAVDAAIAANAMLGLVEPTGSGVGGDLFAIVWSAKD
                     QRLYGLNASGRSPKSLSLEKLKSLGLDYLPPLGPLPVSVPGAVDGWYELHNKFGKLAM
                     AANLAPAIHYARDGFPVSELIAYYLEGSGKKLAKFPGFKETYMPNGKMPAVGEIFKNP
                     ALANTYEKIAKGGRDAFYKGDIAKSIDKYMKSQGGYLSYDDLASHTSDWIEPVSVNYR
                     GYDVWELPPNGQGIAALQILKTMEPFNVAAMGFNSPEYVHLFVEAKKLAFADRAKFYA
                     DMAFNKVPVNELISQQYNYDRAKLIDPNKAAKSVDAGNPALQHGDTVYLTTADKDGNM
                     VSLIQSNYRGMGSGMTPPDLGFVLQDRGQMFDLTEGRFNTYAPGKRPFHTIIPAFVTK
                     DGKPWLSFGVMGGATQPQMHAQIVMNLIDFKMNLQEAGDAPRILHMGSTEPTGEVMND
                     GGYVSLESGFPVETRRELIKKGHVLRDGLGDFGGYQAIGFNAETGVYRAASESRKDGH
                     AAGY"
     gene            691072..692007
                     /locus_tag="SBAL_RS03075"
                     /old_locus_tag="Sbal_0605"
     CDS             691072..692007
                     /locus_tag="SBAL_RS03075"
                     /old_locus_tag="Sbal_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase"
                     /protein_id="WP_011845757.1"
                     /db_xref="GI:500171332"
                     /translation="MDIQNMPREQLGVCAEGNLHSVYLMFNANDNVESQLRPCLANVA
                     QYIYELTDQYSDSAFNGFVGIGANYWDSLYPNARPEMLKPFPAMQVGSREAPAIEYDL
                     FVHIRCDRYDILHLVANEISQMFEDLVELVDEERGFRFMDSRDLTGFVDGTENPKGRH
                     RQEVALVGDEDPEFRGGSYIHVQKYAHNLSKWHRLPVKKQEDIIGRTKQDNIEYESED
                     KPLTSHIKRVNLKDANGQSMEILRQSMPYGSLKEQGLMFISNCRTPEHFEKMLHSMMF
                     GDGEGNHDHLMHFTKAMTGSSFFAPALDFMLQFDE"
     gene            complement(692080..692982)
                     /locus_tag="SBAL_RS03080"
                     /old_locus_tag="Sbal_0606"
     CDS             complement(692080..692982)
                     /locus_tag="SBAL_RS03080"
                     /old_locus_tag="Sbal_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_006080171.1"
                     /db_xref="GI:492987938"
                     /translation="MDKIAAIRSFVEVANCGSFTKAAEHLDLSRLQVSRHIQEVEQWL
                     SLRLLHRTTRSVSLTLQGEEALQFCQRILSEVAAMESRAHSHNSELVGSIRIATPIGL
                     GQHSLFDVVDRFIKIHPKVSIQLVMSDSFAQLVDERVDVALRYTEQPDENLIARRLMT
                     IDAVICAAPSYLDSNTPLVEPIDLLAHNCLIHSAQQNWPFLKELQAEHVKVTGNLKAN
                     DMGVLVSAALRGHGIVRLPCDLANQYLASGQLKEVLPDFTTPGQTLWAVYLSRSYQQN
                     LVRAFIDFTAQQWQLDIKKWLPAH"
     gene            693089..693721
                     /locus_tag="SBAL_RS03085"
                     /old_locus_tag="Sbal_0607"
     CDS             693089..693721
                     /locus_tag="SBAL_RS03085"
                     /old_locus_tag="Sbal_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_006084142.1"
                     /db_xref="GI:493000315"
                     /translation="MKIAILGATGWIGGAILKEALSRGHQVTALVRDPSKLSATDVAV
                     HAVDLEQPLVAQTFAGVDVVIAAVGGRAQQNHDLVASTVQHLLDVLPNAKVPRLLWVG
                     GAGSLEVAPGVTLVSSPDFPAAYKDEALAQGEALQVFRAAQTAINWTFVSPAAEIYPG
                     ESEGPYRLGGDSFFTDANGRSRISVTDYAKAMLDEAEQGTHANQRISVAY"
     gene            complement(693862..694332)
                     /locus_tag="SBAL_RS03090"
                     /old_locus_tag="Sbal_0608"
     CDS             complement(693862..694332)
                     /locus_tag="SBAL_RS03090"
                     /old_locus_tag="Sbal_0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0HEW1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine repressor"
                     /protein_id="WP_006080175.1"
                     /db_xref="GI:492987950"
                     /translation="MQTTKNQDDLVRIFKSILKEERFGSQSEIVTALQAEGFGNINQS
                     KVSRMLSKFGAVRTRNAKQEMVYCLPAELGVPTAGSPLKNLVLDVDHNQAMIVVRTSP
                     GAAQLIARLLDSIGKPEGILGTIAGDDTIFICPSSIQDIADTLETIKSLFNYAE"
     gene            694627..695562
                     /locus_tag="SBAL_RS03095"
                     /old_locus_tag="Sbal_0609"
     CDS             694627..695562
                     /locus_tag="SBAL_RS03095"
                     /old_locus_tag="Sbal_0609"
                     /EC_number="1.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q07YA5.1"
                     /note="oxidizes malate to oxaloacetate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_011845758.1"
                     /db_xref="GI:500171333"
                     /translation="MKVAVLGAAGGIGQALALLLKTQLPAGSHLSLYDIAPVTPGVAV
                     DLSHIPTAVEIKGFAGEDPTPALVGADVVLISAGVARKPGMDRSDLFNINAGIVRNLI
                     EKVAATCPTALVGIITNPVNTTVAIAAEVMKKAGVYDKNRLFGITTLDVIRSETFIAE
                     LKGLNVADVKVNVIGGHSGVTILPLLSQVEGVTFTDEEVASLTTRIQNAGTEVVEAKA
                     GGGSATLSMGQAACRFGLSLVRGLQGEANIVECAYVDGGSEHAEFFAQPVLLGKNGIE
                     KVLPYGEVSAFEANARDSMLDTLKGDIKLGVDFVK"
     gene            complement(695659..696057)
                     /locus_tag="SBAL_RS03100"
                     /old_locus_tag="Sbal_0610"
     CDS             complement(695659..696057)
                     /locus_tag="SBAL_RS03100"
                     /old_locus_tag="Sbal_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014611324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="WP_011845759.1"
                     /db_xref="GI:500171334"
                     /translation="MELRIFYDGNCPLCSAEMRQLKARDPNNLIALEDLNASDFSERF
                     SHIDKDYANTILHGETAKGKVLLGLDVTCKAWALTGTRAWIQLLRLPVIKTVADWTYL
                     RFAKHRYRISYLLTGKARCDDNCQIPTKRR"
     gene            696341..697087
                     /locus_tag="SBAL_RS03105"
                     /old_locus_tag="Sbal_0611"
     CDS             696341..697087
                     /locus_tag="SBAL_RS03105"
                     /old_locus_tag="Sbal_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydromonapterin reductase"
                     /protein_id="WP_011845760.1"
                     /db_xref="GI:500171335"
                     /translation="MTSPIIITGVGKRIGYALAKHFLAQGQQVIGTYRSHYDSIDELN
                     ALGATLYPCDFYDDTQVQSLIDELTQLPQIRAIIHNASDWLPDPVLTKNEPLKSTTFA
                     PSQVLQRMMQVHVSVPYQLNLALEAQLRAAAGDEIGGSDVIHITDYVAEKGSQKHIAY
                     AASKAALHNLTLSFAAKFAPEVKVNSIAPAMILFNTGDDAAYQQKTLAKALLPKEAGN
                     AEIIELVDYLLNSRYVTGRCHNVDGGRQLK"
     gene            complement(697119..697826)
                     /locus_tag="SBAL_RS03110"
                     /old_locus_tag="Sbal_0612"
     CDS             complement(697119..697826)
                     /locus_tag="SBAL_RS03110"
                     /old_locus_tag="Sbal_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_011845761.1"
                     /db_xref="GI:500171336"
                     /translation="MSTSSKLSHLNTQSDTAHLAVEVATVGEMTDVASHAADIAIHTQ
                     ENRNQLRKSIRTARKSLSETEQIQASLSASQRMLDALLAQNAQHVALYLTHDGELATP
                     ALIAALWQLGIHTYLPRLHPFNAGQLLFLHYSADTPMQANQFGILEPKLDVRAIIPVT
                     ELDVVITPLVAFDLMGNRMGMGGGYYDRTLANWQLKGKPLPMGYAHDCQQVVSLPCEH
                     WDVPLPFIITPSRVLTF"
     gene            complement(698133..698435)
                     /locus_tag="SBAL_RS03115"
                     /old_locus_tag="Sbal_0613"
     CDS             complement(698133..698435)
                     /locus_tag="SBAL_RS03115"
                     /old_locus_tag="Sbal_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011624068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapA"
                     /protein_id="WP_006080182.1"
                     /db_xref="GI:492987969"
                     /translation="MSNSAVEITLLGRTYSIACPKGQEDALRTVALGVEQQLTALKTR
                     TNSLSREEIAIMAALNIGHELFQEKQKNKHYMQQMDDRISLLQSTLENALVERSTK"
     gene            698671..699246
                     /locus_tag="SBAL_RS03120"
                     /old_locus_tag="Sbal_0614"
     CDS             698671..699246
                     /locus_tag="SBAL_RS03120"
                     /old_locus_tag="Sbal_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845762.1"
                     /db_xref="GI:500171337"
                     /translation="MATPPSLRIDSLKLALDAAEIGQHPVEVHGALVGLICGGVAQTG
                     DTWIKPLFDLMNDGQPLPAQLHQLVCDLFNDSVARLVDFEFGFMPLLPEEEEPLSQRV
                     EALSLWTQSFLTGMAIIQPKLNQASAEVREVINDLAEIAQVEFDVADDEESEAAYTEL
                     LEFVRIAAIMCYSEFGPEIPLGETDDTAVVH"
     gene            699437..700663
                     /locus_tag="SBAL_RS03125"
                     /old_locus_tag="Sbal_0615"
     CDS             699437..700663
                     /locus_tag="SBAL_RS03125"
                     /old_locus_tag="Sbal_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
                     /protein_id="WP_014620588.1"
                     /db_xref="GI:504433486"
                     /translation="MTATNHMDTSVQHVDIAIVGGAMAGATLALALARLSLSAARPLS
                     IALIEAHLPDKQHPGFDARSIAIAHGSIFELSRLGLWPKLAHLGTAIENIHVSDRGHF
                     GMTELNAAQFHLDALGQVVELERVGQVLFNELNKSEVKLYCPAKLAQVEPAVEGHTLV
                     LDTGKRLKAKLVVAADGLQSKVRSSFDLPVTQVAFEQTAIIANIQTDKPHQHLAYERF
                     TQTGPLALLPMADSQGKPRLSLVWALDDARAKQMQTAPKAEFLAALQQAFGYRAGTFI
                     DVSARHAYPLNLSYMPRPIHHRCVFIGNAAQTLHPIAGQGFNLGLRDVVSLLEVLKTA
                     LDQGDDIGSAAVTHAYLNAREHDRNSTIRNIEFLVRGFSNQYWPMALGRNLGLRLLSW
                     FPPLKTPVAQKAMGWK"
     gene            700708..701931
                     /locus_tag="SBAL_RS03130"
                     /old_locus_tag="Sbal_0616"
     CDS             700708..701931
                     /locus_tag="SBAL_RS03130"
                     /old_locus_tag="Sbal_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_011845764.1"
                     /db_xref="GI:500171339"
                     /translation="MLSSQAYDIAIVGGGMVGLATAIGLAQANLNVVVIDAGHTDAVV
                     GEPRLRVSAINKASQRLLENLGAWSYLYTSRATPYQKMAVWDKDGFGKIAFDANSISE
                     TSLGAIIENDAISFALAKRVAEFDNITHIENQRLERIAFGEREAWLTLANGAHSQIES
                     VSAALVIAADGANSWVREQCKIPLTFWDYGHHAIVATIRTEMPHLATARQVFLKDGPL
                     AFLPLYEDNLCSIVWSVPPERANELLAMDKVQFERNLTAAFDGRLGICQLESERQAFP
                     LRMRYARHFARHRLVLAGDAAHTIHPLAGQGVNLGFLDAASIIEVISELQQAGKDIGD
                     YAQLRALERWRKADAMEMIAAMEGFKRLFEGTNPLKKAIRDLGLNLVDNVAGLKTVFI
                     QQAMGNKSALPKLCR"
     gene            702382..703476
                     /gene="gcvT"
                     /locus_tag="SBAL_RS03135"
                     /old_locus_tag="Sbal_0617"
     CDS             702382..703476
                     /gene="gcvT"
                     /locus_tag="SBAL_RS03135"
                     /old_locus_tag="Sbal_0617"
                     /EC_number="2.1.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1S967.1"
                     /note="catalyzes the transfer of a methylene carbon from
                     the methylamine-loaded GcvH protein to tetrahydrofolate,
                     causing the release of ammonia and the generation of
                     reduced GcvH protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyltransferase"
                     /protein_id="WP_011845765.1"
                     /db_xref="GI:500171340"
                     /translation="MANKTILFNKHLESNAKMVDFHGWDMPLNYGSQIEEHNAVRQDA
                     GMFDVSHMTVVDVIGNDACAFLRKLLANDVAKLKVPGKALYGGMLDENAGVIDDLITY
                     YLTDTNYRVVVNSATREKDLAWIAKQSQGFDVTVTERPELAMIAVQGPNAKAKAAAVL
                     SAEQNAAIEGMKPFFGKQAGSLFIATTGYTGEAGYEIIVPENEAEAMWQALLDQGVKP
                     CGLGARDTLRLEAGMNLYGLDMDETINPLAANMGWTIAWEPSDRDFIGRKALETLRDA
                     GTDKLVGLVMEEKGVLRHDMPVFFTDSAGVEHQGVITSGTFSPTLGYSIAMARVPNSI
                     GDTAEVEMRKKRVAVRVVAPNFVRNGKQAF"
     gene            703503..703892
                     /locus_tag="SBAL_RS03140"
                     /old_locus_tag="Sbal_0618"
     CDS             703503..703892
                     /locus_tag="SBAL_RS03140"
                     /old_locus_tag="Sbal_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WSL2.1"
                     /note="part of multienzyme complex composed of H, L, P,
                     and T proteins which catalyzes oxidation of glycine to
                     yield carbon dioxide, ammonia, 5,10-CH2-H4folate and a
                     reduced pyridine nucleotide; protein H is involved in
                     transfer of methylamine group from the P to T protein;
                     covalently bound to a lipoyl cofactor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein H"
                     /protein_id="WP_011845766.1"
                     /db_xref="GI:500171341"
                     /translation="MSNIPTELKYASSHEWIRKEEDGSYTVGITEHAQELLGDMVFVE
                     LPEVGDTVTAGEDCAVAESVKAASDIYAPISGEVIAVNEALEDSPELVNSSAYGEGWF
                     FRVMPSDESEVDALLDAEGYQAVIDEE"
     gene            704015..706903
                     /locus_tag="SBAL_RS03145"
                     /old_locus_tag="Sbal_0619"
     CDS             704015..706903
                     /locus_tag="SBAL_RS03145"
                     /old_locus_tag="Sbal_0619"
                     /EC_number="1.4.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014611317.1"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase (decarboxylating)"
                     /protein_id="WP_011845767.1"
                     /db_xref="GI:500171342"
                     /translation="MTKQTLTQLEQHDLFLRRHIGPDSNQQQAMLNFVGAESLEDLTA
                     QIVPESIRLSQDLSIGDSCGEAEGIAYIRGLADQNQVFKSYIGMGYYGTQVPNVILRN
                     VFENPGWYTAYTPYQPEIAQGRLEAILNFQQVSMDLTGLDLASASLLDEATAAAEAMA
                     LAKRVSKAKKANIFFVADDVFPQTLDVVKTRAECFGFEVVVGPASEAVNYELFGALFQ
                     YTNRFGQITDFTELFATLRAKNVIVTVAADIMSLVLLKSPGSMGADVVFGSAQRFGVP
                     MGFGGPHAAFFVARDEHKRSMPGRIIGVSKDARGNRALRMAMQTREQHIRREKANSNI
                     CTAQILLANMASFYAVFHGPDGLKTIASRINRFADILAAGLQAKGVSLVNSTWFDTIS
                     IKGLDVAAVNARALAAEMNLRFDADGTVGVSLDETTLRTDIEALFDVILGAGHGLDVA
                     ALDAQIVSQGSQSIPAALVRQDAILSHPTFNRYQSETEMMRYIKRLESKDLALNYSMI
                     SLGSCTMKLNAAVEMLPVSWPEFANMHPFSPLDQAKGYTQLIEELSTWLVNITGYDAV
                     CIQPNSGAQGEYAGLLAIKKYHESRGDAHRNICLIPQSAHGTNPASAQLAGMQVVVTA
                     CDKQGNVDLDDLKTKAAEVAGNLSCIMITYPSTHGVYEESIREICDIVHQHGGQVYLD
                     GANMNAQVGLTSPGFIGADVSHLNLHKTFAIPHGGGGPGMGPIGVKSHLAPFVAGHVV
                     VKPGRESDHNGAVSAAPYGSAGILPISWMYIKLLGSNGLKKSTQTALLNANYVMKKLS
                     EHYPVLFRGRNDRVAHECIIDLRPLKEASGVTEMDIAKRLNDYGFHAPTMSFPVAGTL
                     MIEPTESESKVELDRFIDAMVSIRAEIAKVESGEWPVDNNPLHNAPHTMADIMDPEFD
                     TRPYSREVAVFPSAAVRTNKFWPTVNRIDDVYGDRNLMCSCAPLSDYE"
     gene            complement(707498..708130)
                     /locus_tag="SBAL_RS03150"
                     /old_locus_tag="Sbal_0620"
     CDS             complement(707498..708130)
                     /locus_tag="SBAL_RS03150"
                     /old_locus_tag="Sbal_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_011845768.1"
                     /db_xref="GI:500171343"
                     /translation="MKPKNLPESLAARGRPRNFDRQEALVSALGVFWRRGYEPASLNE
                     LCAAMNIKPPSLYAAFGNKAALFLEAVNYYEDTFWDATWERMLKEADLHQAISDFFCE
                     AADILTSQSVPCGCLVVLAAINVSPDSQEVYEAVKALREEGRGYFLARLKQGVEDGQL
                     DKNEDINGIAMTLNTLLEGMSIPAQDGISRKELAKIAVQAVKLLPRSSKA"
     gene            708224..708886
                     /locus_tag="SBAL_RS03155"
                     /old_locus_tag="Sbal_0621"
     CDS             708224..708886
                     /locus_tag="SBAL_RS03155"
                     /old_locus_tag="Sbal_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845769.1"
                     /db_xref="GI:500171344"
                     /translation="MIAILNEYFVTLINWVQSAGWIGLLSYGLLFIIATSLFVPASLM
                     AATAGFLFGPVIGSLLISCVGVLTAAIGFAIGSHAKHSWGLSPMKSRAGIRIIKEAME
                     KQAFRSVLLLRLSSVIPFAPMNYVLGGSKITFGRFVFASWLGMFPGTVVYVYMGSILP
                     SVNQLLGDDNIALKSAHPTLFWTGFIVSVLVLALLARTATQALKRDAIDVEKLTNNVS
                     SK"
     gene            708968..709351
                     /locus_tag="SBAL_RS03160"
                     /old_locus_tag="Sbal_0622"
     CDS             708968..709351
                     /locus_tag="SBAL_RS03160"
                     /old_locus_tag="Sbal_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845770.1"
                     /db_xref="GI:500171345"
                     /translation="MTNTTYVQEYHAIVEVLSKYNEGGKKADSTIMRPAFSSQATIFG
                     VDVDNKLTGGPIQGLFDVIDNVFHPSPEAKAAIARIDIVGTAASARIDTDDISGFRFT
                     DFFNLLKVEGKWTVVSKIYHTHPSA"
     gene            709472..710128
                     /locus_tag="SBAL_RS03165"
                     /old_locus_tag="Sbal_0623"
     CDS             709472..710128
                     /locus_tag="SBAL_RS03165"
                     /old_locus_tag="Sbal_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_011845771.1"
                     /db_xref="GI:500171346"
                     /translation="MSKVFIVGAAGNVGRRLTQQLAQRGHTLMAMHRHPDQADAIQAA
                     GGVSVLGDITQISATDLATLMSGNDAIVFSAGAGGKGIQLTNDVDGKGLELAVEAAQL
                     AGIQRFILVSVFPDALRGGSVSASFENYMLVKKHADVHLVSTDLDWVILRPGTLLDEV
                     GTGKVNAAVAIPYGSVSRDDVAATLVELIEQPKVNRIIIELTQGEIPINDAISRLVAQ
                     "
     gene            710171..710800
                     /locus_tag="SBAL_RS03170"
                     /old_locus_tag="Sbal_0624"
     CDS             710171..710800
                     /locus_tag="SBAL_RS03170"
                     /old_locus_tag="Sbal_0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_011845772.1"
                     /db_xref="GI:500171347"
                     /translation="MKLILIGASGLVGQHVLQIALDDARIERVIAPTRQPLPTHPKLF
                     APIVSFDDLPANADWWSADALICTLGTTMKKAKFQAAFKRVDYDYPLMAAKLAKQQGT
                     ETYVLNSAIGANVSSRFFYNQVKGELEQSLTQCHFTSLSFVRPGMIGGNRQESRPSER
                     LMMLTLMLLGPILPKKCCINPAHTIAKALLEAAIAKRAGIHEINSEALI"
     gene            710836..711270
                     /locus_tag="SBAL_RS03175"
                     /old_locus_tag="Sbal_0625"
     CDS             710836..711270
                     /locus_tag="SBAL_RS03175"
                     /old_locus_tag="Sbal_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide cyclase"
                     /protein_id="WP_011845773.1"
                     /db_xref="GI:500171348"
                     /translation="MPMVEYSAVFDGDAERVWSVLKQFGEIHQWHPEIRNSVIEAGLT
                     DGLVGGVRRLELNDGAILRERLLSVDDSLRRLSYCFEESPLPLDNYVASIHVISLTGT
                     KQSVIHWSASFELAEPDPAQLNAKAIQALIIAGHDNLQRFLR"
     gene            711304..711900
                     /locus_tag="SBAL_RS03180"
                     /old_locus_tag="Sbal_0626"
     CDS             711304..711900
                     /locus_tag="SBAL_RS03180"
                     /old_locus_tag="Sbal_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase"
                     /protein_id="WP_011845774.1"
                     /db_xref="GI:500171349"
                     /translation="MHHQRKTHVDNNIAAVELAKAYRLLNHGPTVLVSARSQGIDNVM
                     AAAWCCALDFAPPKLTVVLDKMTKTREFIEQSGMFVIQVPTVAQLQLTHRVGSQSLAD
                     DANKLLNCGVELFEMAGHDLPFVAGCSAWLACKLIPEPNNQLQYDLFIAEVIGAWADT
                     QVFNHGHWHFDTAPADKRSLHYIAGGQFYAIGESFNAD"
     gene            712058..713161
                     /locus_tag="SBAL_RS03185"
                     /old_locus_tag="Sbal_0627"
     CDS             712058..713161
                     /locus_tag="SBAL_RS03185"
                     /old_locus_tag="Sbal_0627"
                     /EC_number="1.3.1.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620590.1"
                     /note="FMN-linked; catalyzes the formation of
                     N-ethylsuccinimide from N-ethylmaleimide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylmaleimide reductase"
                     /protein_id="WP_014620590.1"
                     /db_xref="GI:504433488"
                     /translation="MIDNSTRTDLFSATQLGKIAIANRIIMAPVTRSRYAENGIPNEL
                     HATYYAQRASAGMLIAEATNISPQGRGYAATPGIWSDEQVEGWKKVTDAVHANGGKIV
                     VQLWHVGRFSCVELQPDGAAPVAPSAIKAEGSTYTVDGFVPVSMPRALETDEIPRIIE
                     QYKIAARNAMRAGFDGVEVHSANSYLLDQFLRDSTNHRTDEYGGSIENRARLTLEVTQ
                     AVVNIWGSDRVGIRLSPVTPDAGNTPPDSNVMALYGYLIQQLNQFNLAYLHFVEGATA
                     TSREVPEGVDMDTLSVQFNGPFIGNNNYDLEMAIERRAQGKIDAVAFGRLFISNPDLV
                     ERLRRGAELTIAERESYYGGGAKGYTDWPKGNY"
     gene            <713464..714687
                     /locus_tag="SBAL_RS03190"
                     /old_locus_tag="Sbal_0628"
     CDS             <713464..714687
                     /locus_tag="SBAL_RS03190"
                     /old_locus_tag="Sbal_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012762125.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="WP_041409062.1"
                     /db_xref="GI:752761944"
                     /translation="QERMMKTHREIAEQLDLFHSEPQAPGMIFWHPNGWALFRDIQEH
                     MRRVYRRNGFEEVNTPVFMKKELWQTSGHMDMFAENMFFGGGKENIDEYVLKPMSCPA
                     HILLFKRGVHSHRDLPLRLFEFGLVHRNESSGSLNGCLRARQFTQDDAHVFCCWSQAE
                     EEIRGFLQRAKQVYGDYGYHNLDVKISTKPEKSLGSDEQWCRAQKLLDSACHIEGFDA
                     EYQAGEGAFYGPKIELSLTDSMGRRWQCGTIQFDFNLPERFDVQYANEQGEFERPVIM
                     HQAMYGSIERWLGILLEVSQGNLPVWLHPVPVAIASVNESNSQFVRQLATLCLARDIR
                     VLVDISQNSVARKMKRFHKQKVPYILTVGDKEEAENRVSVKCRKDGVITHVPLAELAD
                     YLADKLEGKLKRKED"
     gene            715486..715836
                     /locus_tag="SBAL_RS03195"
                     /old_locus_tag="Sbal_0629"
     CDS             715486..715836
                     /locus_tag="SBAL_RS03195"
                     /old_locus_tag="Sbal_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845777.1"
                     /db_xref="GI:500171352"
                     /translation="MVVQKRHCFLSFILGCAIITGCSDEAPSCSDDETQGLVIQISKD
                     ELKKQVGQGVVDLVTLELTGIRTTDFNEKTGAQECAAELVFSGKNGKDSIDITYKSEL
                     VDNEDQFYVTVYGL"
     gene            715853..716320
                     /locus_tag="SBAL_RS03200"
                     /old_locus_tag="Sbal_0630"
     CDS             715853..716320
                     /locus_tag="SBAL_RS03200"
                     /old_locus_tag="Sbal_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620592.1"
                     /db_xref="GI:504433490"
                     /translation="MSAITELKDKTNTKTLNLVLLTIATAGIYPILWLYSNYSVIDSI
                     TKKKTADNTFVIWIAVCAGLGGALAGNGESLLDIISLILTLASSVLYIVWAFKAKSAL
                     QEYALTEHKIDLRMNGFYTFFFTVYYINYCINDLPEAQRKQRILTGHTAEVES"
     gene            complement(717161..718051)
                     /locus_tag="SBAL_RS03205"
                     /old_locus_tag="Sbal_0631"
     CDS             complement(717161..718051)
                     /locus_tag="SBAL_RS03205"
                     /old_locus_tag="Sbal_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_006080194.1"
                     /db_xref="GI:492988007"
                     /translation="MMKRNLNDLLCFVTVAREGSFTRAAALLGVTQSALSQAISGLET
                     RLEIRLLTRTTRSVSATEAGERLLNAIGNRFDEIESELDALTAMRDKPAGTVRITCGD
                     FVLRTLLIPKLSPLLHNYPDIKVEFDVNYGFRDIVADRFDAGIRLGDTIDKDMIAIPI
                     GPHQTMAAVATPAYFAQHPIPKHPQDLIEHNCINIRFPTHGGLYVWEFEKDGKQLNVH
                     VDGQLIFNASHHIVDAALQSNGIAYLPEAEFEPHIKAGRLVKVLEDWSLSFAGYYLYY
                     PSRRQPSPAFTLVADALRLR"
     gene            718191..719423
                     /locus_tag="SBAL_RS03210"
                     /old_locus_tag="Sbal_0632"
     CDS             718191..719423
                     /locus_tag="SBAL_RS03210"
                     /old_locus_tag="Sbal_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011845779.1"
                     /db_xref="GI:500171354"
                     /translation="MTTQVCETSEPRCAIQQASQQQTANWSGVLAMSLCVFALVASEF
                     MPVSLLTPIAADLNVSEGLVGQGIAISGFFAVLTSLSIASIAKVTDRKSLLLGLTSLM
                     LVSGIVIAYAPNYAVYMLGRSLIGVVIGGFWSLSGASAIRLVPTEKIPKALAIFNGGN
                     ALAMVIAAPLGSYLGAHIGWRGAFFGLVPVALIAFVWMWFSLPAMKPEKRVAGSANVF
                     SLLNKPLVRLGMLAIVLFFMGQFSLFTYVRPFLETAIHVESNNLSFILLVMGVAGFMG
                     TLLVSVFLKNNLYRTLIFIPLVMAVIALALILFSDSSVAVTTLLALWGGVATAAPVAW
                     WTWLARTMPEDSEVGGGLMVAVIQLAIGLGSTLGGVLFDFNGYHSTFMLSATLLAAAA
                     LLAYWTQRSTPEPLLHAQ"
     gene            719439..720488
                     /locus_tag="SBAL_RS03215"
                     /old_locus_tag="Sbal_0633"
     CDS             719439..720488
                     /locus_tag="SBAL_RS03215"
                     /old_locus_tag="Sbal_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_011845780.1"
                     /db_xref="GI:500171355"
                     /translation="MKIKAFGANASHLPLEPMTITRRLPGEDDVQISIDYCGVCHSDL
                     HQVRSEWAGTLYPCVPGHEIVGRVTAVGGHVSKFNVGDLVGVGCIVDSCKHCHECIDD
                     QENYCDHMVGTYNGPTHDALGHTLGGYAEQIVVDERYVLRISHPQEQLAAVAPLLCAG
                     ITTYSPLRHWHAGPGKKVGIVGIGGLGHMGIKLAHAMGAHVVAFTTSESKRDAAKALG
                     ADEVVVSKNADEMAKHLQSLDLIVNTVAAPHDLDAFLSLLKRDGTMTLVGAPATNHPS
                     PNAFNLIMKRRSLAGSMIGGIRETQEMLDFCAEHNIVSDIELIRADEINTAYERMLKG
                     DVKYRFVIDNATLAR"
     gene            720532..721041
                     /locus_tag="SBAL_RS03220"
                     /old_locus_tag="Sbal_0634"
     CDS             720532..721041
                     /locus_tag="SBAL_RS03220"
                     /old_locus_tag="Sbal_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041409064.1"
                     /db_xref="GI:752761946"
                     /translation="MVLRMPMVLLLLMVSIEVASAATFASASQYNESMTMPLAKKSSE
                     KSAVKIRIIIAGTTLTATLENTQAARDFVALLPLDLTLADYNGTEKIADLPAKLLHKD
                     APEGYTPKVGDIAYFAPWGNLAFFYHDFGYSRGLIRLGQIDGSVDALMGDSDIKVRIE
                     QSQNGDDSE"
     gene            721022..722104
                     /locus_tag="SBAL_RS03225"
                     /old_locus_tag="Sbal_0635"
     CDS             721022..722104
                     /locus_tag="SBAL_RS03225"
                     /old_locus_tag="Sbal_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845782.1"
                     /db_xref="GI:500171357"
                     /translation="MAMIQNREPTMYMKNLNKITKAIIMLGLLSTASLTAFAQDMSNG
                     ADNFYQSDSVAMQRVTFKNQYNMEVVGNLFIPKNLDKKMTHPVIVVGHPMGAVKEQSA
                     NLYATKMAEQGFITLSLDLSFWGESEGQPRNAVSPDIYAEDFSAAVDYLGTNKLIDRT
                     RIGVLGICGSGSFVISAAKIDPRMKAIATVSMYNMGAVNRHALNHSQTVEQRKKLIAA
                     AAKQRDLEFGGGEIQYTSGTVHQLDKDTHPIQREFYDFYRTPRGEYTPASSSPQLTTH
                     PTLTSNIKFMNFYPFNDIETISPRPMLFITGDKAHSKEFSEEAYRLAGEPKELYYVKG
                     AGHVDLYDRTALIPWNKLTEFFSKTL"
     gene            complement(722339..723310)
                     /locus_tag="SBAL_RS03230"
                     /old_locus_tag="Sbal_0636"
     CDS             complement(722339..723310)
                     /locus_tag="SBAL_RS03230"
                     /old_locus_tag="Sbal_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014620594.1"
                     /db_xref="GI:504433492"
                     /translation="MINQLQEKYQLSLLLLLSSVAVMGVFPFVVIRYLSGNYIAAIID
                     ITLIIGMISFVAYAHYSKKIRMVSAILAVFINTGVVVIVVANGIGSFLWIYPVFASTF
                     ILVKPIEAFLINVIASIALVALANIFDVISLFSFVITILMMSMSAFVYALHGVKQFRL
                     LETLNSVDPLTGAFNRRAMGSDMEAALSNAKHNGVKHLLAILDLDYFKTVNDKFGHAV
                     GDQVLKRFVAITTSHLGKNDRLYRFGGEEFVLLIPEISEQDEFIQNLRMAIKKELTTP
                     DGKEITVSFGVAPWVPGTTTDTWLQRADEALYLAKQQGRDCAVFSNQ"
     gene            complement(723700..724266)
                     /locus_tag="SBAL_RS03235"
                     /old_locus_tag="Sbal_0637"
     CDS             complement(723700..724266)
                     /locus_tag="SBAL_RS03235"
                     /old_locus_tag="Sbal_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014620595.1"
                     /db_xref="GI:504433493"
                     /translation="MNSNQLILIGLGFALIILLPLLLRIFTNLLVPSSDNTYRYRKQD
                     ALFSSAERSFLGILDQAVGDQYRILGKVRIADVITPEKGMNRRHWQIAFNRISAKHFD
                     YLLCDKHTLEVIAAIELDDKSHKQTRTQQRDLLIEQACESAKLPLIRFDAKRSYQLEL
                     IRSTIHTALPAKTHAAEESSLILTASKT"
     gene            complement(724429..724674)
                     /locus_tag="SBAL_RS03240"
                     /old_locus_tag="Sbal_0638"
     CDS             complement(724429..724674)
                     /locus_tag="SBAL_RS03240"
                     /old_locus_tag="Sbal_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="WP_006080205.1"
                     /db_xref="GI:492988045"
                     /translation="MTDTTSLPALPDRLSVNPRSPHHVAEIFEHDIGIKLNGKERFDV
                     EEYCISEGWVKVPSKSLDRRGQPLLLTVKGTVEAFYR"
     gene            725006..725422
                     /locus_tag="SBAL_RS03245"
                     /old_locus_tag="Sbal_0639"
     CDS             725006..725422
                     /locus_tag="SBAL_RS03245"
                     /old_locus_tag="Sbal_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845785.1"
                     /db_xref="GI:500171360"
                     /translation="MNDDISISLPSLIHRIGREAVKQAQAIATQYDCELKRVRRSRNW
                     CMVGGAIKIQSCSAHLQAESLPAKQLTAKDGQFGYLIKKLETALLQHADKLEPLDAKL
                     IRLITDNPAITLGELMQLTQCTITEARLARFQADSW"
     gene            complement(725454..725633)
                     /locus_tag="SBAL_RS03250"
                     /old_locus_tag="Sbal_0640"
     CDS             complement(725454..725633)
                     /locus_tag="SBAL_RS03250"
                     /old_locus_tag="Sbal_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845786.1"
                     /db_xref="GI:500171361"
                     /translation="MFSIFKKNPLKKLTQQYNAKLEEAMHAQRKGDIRSYSMLTAEAE
                     QIENQIKVLEKAAKQ"
     gene            complement(725848..727512)
                     /locus_tag="SBAL_RS03255"
                     /old_locus_tag="Sbal_0641"
     CDS             complement(725848..727512)
                     /locus_tag="SBAL_RS03255"
                     /old_locus_tag="Sbal_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_014620596.1"
                     /db_xref="GI:504433494"
                     /translation="MSNFSLRNKLLLLSLFPLILTLCILMTVSYYVEQSALADEVTTF
                     RTKLIGERKTQIKEATEIAAGIVQYQLSLKENGNVNQALRDIRFGSSGYFFIYDSQGK
                     NLFHAVMPNLEGQNKIDMTDPRGTKIIVGLLDAAKRGDGNFSFYFQKPNTNEQIEKIG
                     YSMMIPGTDWMLGTGAYIDDIDAVVEDYRATVTEQMIDKSYAILLIALLLAAMTAVVI
                     LATAQRMVAPIKNMADNLNDIAKGEGDLTKRLTVKGEDEIAQLGQSFNLFVDKLQTII
                     GDVANATAKVKSAANAIHDQTKVMSSQLISHNNETDQVVTAITEMSATASEVAQNTTQ
                     VAEATHAATGDVANAQRCVDASLEEISALMAQINNAAGNIQSLSEQSKKINNVLSVIG
                     GIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLASRTQSSTLEINEMLSELHKL
                     VALAVKTMEESQQSCVRSVDSSRAISESLGSVTSAVTAINDMSTQIATAATEQSSVTE
                     EINRNVFAIQEIVNELLHSSEDAARVSQTVSQEGINLGKLVGQFKI"
     gene            727822..728052
                     /locus_tag="SBAL_RS03260"
                     /old_locus_tag="Sbal_0642"
     CDS             727822..728052
                     /locus_tag="SBAL_RS03260"
                     /old_locus_tag="Sbal_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845788.1"
                     /db_xref="GI:500171363"
                     /translation="MTNEKLILTLKICISVGICLIALGIYLHNFNDTVEAMGVQGIIF
                     SAMCVAFGMALSLPTKMYLTFMLVKRETEKHQ"
     gene            728312..730501
                     /locus_tag="SBAL_RS03265"
                     /old_locus_tag="Sbal_0643"
     CDS             728312..730501
                     /locus_tag="SBAL_RS03265"
                     /old_locus_tag="Sbal_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845789.1"
                     /db_xref="GI:500171364"
                     /translation="MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFL
                     ASSALCAAYFVKVYCKARDIPTDNIRLSQNNIVDPEDRYNQIFQIQVELPEDISDKDR
                     EGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQPNGASSTFILGKDLPLE
                     QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSA
                     LGEFIERLNNNFFYNDQFFGTEIANSEFVHYPNEKWFALEEDDALPAGILDDYCLEIY
                     NPDDELCGSHLIDTNSGNIKRGICAIPYTRKSDGETVYFPSNLIENLFLSNGMSAGNN
                     LQEAHVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGINGLEEQGFPVVV
                     KDASLGGQFPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVP
                     KPTFNSMAVSEPENFVEHFIDSTGVISWRFFSSKFDYEFCEWDFSGSSEEEASGLFGI
                     LEALGKEVYIAEFTDLGASACRILVPDYSEIYPVDDLIWDNTNKALAYREDILNLHSL
                     STKQLVNLVNRLEESQLDNYTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGAHED
                     AIELVGEFLQFNDNTVKRGLFYQAMNAVLEVTLDDELELDDFIHNFNRMFGKDVMDNV
                     VGSVKGKVRFYGLTKTSMQLEGIEPHLRLIESYKKLHQARKAAKDAN"
     gene            730913..732391
                     /locus_tag="SBAL_RS03270"
                     /old_locus_tag="Sbal_0644"
     CDS             730913..732391
                     /locus_tag="SBAL_RS03270"
                     /old_locus_tag="Sbal_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845790.1"
                     /db_xref="GI:500171365"
                     /translation="MRTITVLSIAGTLFAVCTLSASANQDYPSVSAKCPVEESWLTSP
                     SLPQEVKTSASDGSSTFCDFYQFSTQTFLYLMSQGKSGLRNYQDEANYPVLEFNDDGS
                     PANSCDREITGKVLRTHLLKTAGASSITTGQAGGGATIYAQDGNVVYYSVRFSKALCD
                     LSSSAVELQKKNITNFPAGSMELKLGWKVLSSAEIASNSFVTQEQVVANKKVTLGLAG
                     MHLVTATANHPEFIWSTYEHKTNTPDCTPATPQTGTDWTFASATCTAGLPDTAAKGNT
                     CNFNSPLKNQTSPTGVPTNICRVYPDGTSPDDLKAGENIADITAQNTGLLALLAQPST
                     PAGMKVLSNYFTVGALWVSDTGKNSGGVGVPNERGSLRLANSVAETDYQHVDLTSTFA
                     SNCFGCHNYIGNSQTVSNNITSQALSHIFKDIKIGQGQSIDVNSPDTINSQNAASTIC
                     QSGPTSTSQVGVCPSTASYLTWNGQWTNSNASAGSVCGCVSK"
     gene            complement(732617..733525)
                     /locus_tag="SBAL_RS03275"
                     /old_locus_tag="Sbal_0645"
     CDS             complement(732617..733525)
                     /locus_tag="SBAL_RS03275"
                     /old_locus_tag="Sbal_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidine triphosphate deaminase"
                     /protein_id="WP_011845791.1"
                     /db_xref="GI:500171366"
                     /translation="MINIEQMALILDALPDPALILSKSGRYVAVFGGKDGRYYHDGSG
                     LVGLYLADVLNPDKTNYFLGIIEQALASRALLIEEYELSNKDVKGLPDAGPDQPIWFE
                     GRIQALDFLVNDEPVVLWVASNISQRHELELQLRQLSDTDQLTGLYNRRRLERDLTVQ
                     FDTFQRHRTPTSILILDLDHLKSINDQLGHHAGDKIIIAVAETCRTQFRKTDSAYRFG
                     GDEFVIALPGVEQSQAVKFAEYLCDCFYSALQQHAVNGLFATVSIGVASIEALDTSYE
                     DTLKRADAALYQAKRNGKNRVISNTA"
     gene            733909..734379
                     /locus_tag="SBAL_RS03280"
                     /old_locus_tag="Sbal_0646"
     CDS             733909..734379
                     /locus_tag="SBAL_RS03280"
                     /old_locus_tag="Sbal_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_006084120.1"
                     /db_xref="GI:493000274"
                     /translation="MHTADDFIEHLALEQHVEGGYYRSSYRSETPFDQTRALWSSIYF
                     LLRTGEVSHFHRLTADEMWYFHAGQSLTIYMIAPDGVLTTAQLGLDLAAGERPQFLVP
                     KGCIFGSAMNQPGFSLVGCMVSPGFTFDDFELFSQKTLLAHYPQHSEIIKRLSR"
     gene            734606..735385
                     /locus_tag="SBAL_RS03285"
                     /old_locus_tag="Sbal_0647"
     CDS             734606..735385
                     /locus_tag="SBAL_RS03285"
                     /old_locus_tag="Sbal_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglyceryl transferase"
                     /protein_id="WP_006080213.1"
                     /db_xref="GI:492988065"
                     /translation="MEHLVWELDPVLISFMGLKIHWYGVLFAVAITAGFQVMKRIYIK
                     ENLDVESLDNLLIYCVVGIIVGARLAHCIFYDPAYYFAHPLKILAIWEGGLASHGGGL
                     GAILALYYYQRKVKLPFLFLLDRLAIATAIFGFFVRMANFANSEILGDPTTQPWGIIF
                     ARVDMLPRHPAQLYEAFAYLAIFVALYALYQFTQIKQRHGAIFGLFLVSVFSARIAIE
                     SIKVSQAAYSESVLSAGQLLSLPFLAVGIVLLFLAYRKKAV"
     gene            complement(735469..736386)
                     /locus_tag="SBAL_RS03290"
                     /old_locus_tag="Sbal_0648"
     CDS             complement(735469..736386)
                     /locus_tag="SBAL_RS03290"
                     /old_locus_tag="Sbal_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011845792.1"
                     /db_xref="GI:500171367"
                     /translation="MSQLYLEEGIKQLVSEFIAAGCPSVREQTIEQRRQGYIASTVLA
                     GEAEDVFEVRAVSIDGAELTLFKPSAAKDLPVVIYYHGGCFVSGGVETHNQQLRKLAN
                     DAGALVIAVSYRLAPEHVYPAAHDDACHAAEVIYQHCQQWGGDKDKITLMGDSAGGHL
                     ALVTCLRLKAKGQWLPQKQVLIYPMLDATAKSQSYSDNGEKYIITRDTLLTGFDLYLD
                     WHPRTDAEASPLRSTDLAGLPETHIITAEFDPLVDEGEQLFRHLLEAGVNAHCRRYLG
                     AIHGFFQLSGVSRSARDAMVQVSNIVKTA"
     gene            736905..738266
                     /locus_tag="SBAL_RS03295"
                     /old_locus_tag="Sbal_0649"
     CDS             736905..738266
                     /locus_tag="SBAL_RS03295"
                     /old_locus_tag="Sbal_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MatE"
                     /protein_id="WP_011845793.1"
                     /db_xref="GI:500171368"
                     /translation="MAKAPKTLQQRMSIVALTWPIFVETLLQSLLGISDIFMLSHYSD
                     NAVAAVGLTTQLMFFMMVMSMMVSTGASILISQNNGAGQSQQAVDIGVASVALSLGLA
                     LIMGASMFFGAKGIIGLFALEHDVAGFGYDYLVICGSLSIGLVMNIAFAAILRSYGFT
                     RSAMLVTSSTGLMNVIGNYIALYSPFDLPVYGVTGVAISTVTSQIIGAVIMLMVIRFK
                     KIPLPLQRLKLLPRSTYWSVMRIGLLNAGEMLSYNVAQMTIIYFISQMGTLSLTAYTY
                     GLNISRFIYCFAVALGQATQIQTGYYVGKQWFDEITARVQRYCLVGFVASLAIVLVFY
                     WQRFTIVGWLSENEEVIQLTALLLAGSIALETGRVFNLVIISALKGAGDVAFPVRVGL
                     FSMWGIGVLLAWFFGLHLGYGVLAAWLAVAADEWIRGLIMVYRWRSCRWQRFTRIPAA
                     TAV"
     gene            complement(738326..738751)
                     /locus_tag="SBAL_RS03300"
                     /old_locus_tag="Sbal_0650"
     CDS             complement(738326..738751)
                     /locus_tag="SBAL_RS03300"
                     /old_locus_tag="Sbal_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845794.1"
                     /db_xref="GI:500171369"
                     /translation="MKVSDIMSDQVICISDGASLKDAHHLMQTRGVRHLPVISEIDGT
                     LVGVLTHKKMIASVMTMLNKYGQGALERKERYTPITTVMDQDFQHLTADEPLTVVVEY
                     FIENKLGCLPVVDADKKVLGIVTSSDFIKLCRTLLKQQS"
     gene            739007..740773
                     /locus_tag="SBAL_RS03305"
                     /old_locus_tag="Sbal_0651"
     CDS             739007..740773
                     /locus_tag="SBAL_RS03305"
                     /old_locus_tag="Sbal_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_011845795.1"
                     /db_xref="GI:500171370"
                     /translation="MNRTVTRRDFLAMSAKGVGVAVISYGLMGCSDSNDDNSVPAQFL
                     HGIASGDPAIDAVILWTRVTPESEGDVKVSWQVASDAAFSQLVTTGEMVTNASRDYTV
                     KIDARGLRAGQNYFYRFMTGDKTSAVGKTRTLPEGDVSSVKLAVMSCANFPAGYFNVY
                     ELAAAQDDLDAVVHLGDYIYEYARGGYASEHAAELGREVLPATELLTLGDYRTRYGQY
                     HTDASLQKLHAKVPFITVWDDHEVANDTWRDGAENHNEGEGDFAARKEAALQAYFEWL
                     PIRPWREGNHEEIYRSFSYGNLVDLHMLDTRVLARDKQLDYADYMDPTTGSFAGERFL
                     ADVTSTTRTMLGLTQLLWLQGTLLQATGKWQVLGQQILMGKMSLPAAIATQQMSIPQY
                     AMLGALAKLAARAAANDPTLTAQELQYLQANQALLTPEVIALLQLPAIPYNLDAWDGY
                     AYEREVILGTAKSKNLNLVVIAGDTHNAWANELKDVNGDTVGVEFATSSVSSPGLEYY
                     LNLPAEQIPATEAAIVELVPDLKYANLRDRGFMTLTFTADEVRSDWHYVDTILSKDFQ
                     AATARGYSAKAKVGEHVITPIV"
     gene            741064..741630
                     /locus_tag="SBAL_RS03310"
                     /old_locus_tag="Sbal_0652"
     CDS             741064..741630
                     /locus_tag="SBAL_RS03310"
                     /old_locus_tag="Sbal_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_006080219.1"
                     /db_xref="GI:492988085"
                     /translation="MSEKYFVTAQQLLEDSFLLASQVYESGFRPQFIVGIWRGGAPIG
                     IAVQEFFDFKQVETDHIAVRTSSYYGIGTDKQSKEIKVHGLHYIVENANASDGLLIVD
                     DVFDSGRSIHALKEKLGQLMRLNMPTDIRIACPYYKPKNTAVPLKPDYYIHASEDWLV
                     FPHEVTGLTPEEIAEGKGDLKNIQHLFK"
     gene            complement(741722..742999)
                     /locus_tag="SBAL_RS03315"
                     /old_locus_tag="Sbal_0653"
     CDS             complement(741722..742999)
                     /locus_tag="SBAL_RS03315"
                     /old_locus_tag="Sbal_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="WP_011845796.1"
                     /db_xref="GI:500171371"
                     /translation="MKLRPLSSLSLGLLIATSALLAGCNSDDNNTEVTPPASKPVPAQ
                     VGERPLFLVRQMQDSTLKTRLEQCTTDNFYRSEFSIGHRGAPMQFPEHTKESYQAAID
                     SGAGIVECDVTFTADKALVCRHSQCDLASTTNILAVPELANKCSIPFTPADAANGVSA
                     SATCCTSDITLAEFKTLKGKMEGSNPKATTAAEFINGTPSWRTDLYAGNGTLMTHAES
                     IEMFKKAGVKMTPELKAASVSMPFDGFTQQDYAQKMLDEYTAAGVDASQVFPQSFILD
                     DIKYWVANAPEFAKQAVFLDDRYDYNSAFDPQNSATWSPSMADLKTQGVEIIAPPLWV
                     LVALDADKKIIPSEYAKAAKGAGLKIITWSLERSGLLKNGGGFYYQSITKAIDNEGDT
                     FELLDVLAKDVGVIGVFSDWPATVTYYANCMDL"
     gene            743370..743672
                     /locus_tag="SBAL_RS03320"
                     /old_locus_tag="Sbal_0654"
     CDS             743370..743672
                     /locus_tag="SBAL_RS03320"
                     /old_locus_tag="Sbal_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011788140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080221.1"
                     /db_xref="GI:492988091"
                     /translation="MSKGKKYDFRVTQGDKGWKTEITRRMTSTKTVVSKSHDGFATEA
                     EAQAWGLTELQVFLGTLTERNKRRSEKQAKAKLAAALAAEAATDAEDLDEDDFDEE"
     gene            743997..744287
                     /locus_tag="SBAL_RS03325"
                     /old_locus_tag="Sbal_0655"
     CDS             743997..744287
                     /locus_tag="SBAL_RS03325"
                     /old_locus_tag="Sbal_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011840012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011840012.1"
                     /db_xref="GI:500165396"
                     /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLY
                     NWKEKHEALKQGITLEESERDELKRLRRENKELRMEKEILKKASAFFAREMK"
     gene            744347..745156
                     /locus_tag="SBAL_RS03330"
                     /old_locus_tag="Sbal_0656"
     CDS             744347..745156
                     /locus_tag="SBAL_RS03330"
                     /old_locus_tag="Sbal_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011494884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011840011.1"
                     /db_xref="GI:500165395"
                     /translation="MSVSKSGYYDWHKRPANVISLETLKLYRLVRQLFKQSRGSLGNR
                     EMVKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNP
                     VSANEVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALIKAYNL
                     RQPARGLVFHSDRGSQYTSKQFGRLLLSYGIRASMGDVGACWDNAVVERFFGSLKHDW
                     IFKVNQPTREFMKQDVTAYMKYYNLERLHSANGDLSPVEFENSQLKVSSLG"
     gene            745277..746461
                     /locus_tag="SBAL_RS03335"
                     /old_locus_tag="Sbal_0657"
     CDS             745277..746461
                     /locus_tag="SBAL_RS03335"
                     /old_locus_tag="Sbal_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845797.1"
                     /db_xref="GI:500171372"
                     /translation="MKLLQSSLLLCLSASATMSYGQALDGEALRLLQASLKDSTLDAQ
                     AQLTNTKRALALDLSHQYAQLAPILQTEINQYQLAVNADDILSQHRLNDNVITKADAS
                     IRRVKGLSAKADSLVQVRLADETMLTPWQQGESPLFAYEPDGDESQWDYIEAFDIHGQ
                     VHQLDVYNLPQQPVFVVGIDSKKAFVAGLEVMRATFAEAQSAKKDGALLSRAQTQAVA
                     DKPISTTVIKQISLKDDHEPWISGRAEIYGIVIGVDPSREEPVLDIVEMPYLDYADTT
                     YYPNQIIIHWERYRWAAADMILMEHDDGTNYKVLASKLLEAAEQILKSIPDPEAQGYA
                     LIPQITNGILSVMPDAWFTNDDDFVDVYYTLQEGVEYPNLNGANGNAMTSFAPLVIQP
                     RP"
     gene            complement(746561..747037)
                     /locus_tag="SBAL_RS03340"
                     /old_locus_tag="Sbal_0658"
     CDS             complement(746561..747037)
                     /locus_tag="SBAL_RS03340"
                     /old_locus_tag="Sbal_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="azurin"
                     /protein_id="WP_006080224.1"
                     /db_xref="GI:492988098"
                     /translation="MKAKSTALRNVTSTSLIGLGLLFASQASANECELKIAATDAMQF
                     DTKELSVPASCKEVTLTLTHSGTLPKAAMGHNWVLTKAADMSAVATEGMSAGPDAAYV
                     KAGDTRVIAHTPLVGGGESTSITFSTAGMSATEAYQFFCSFPGHWAIMQGSFKLKA"
     gene            complement(747351..748262)
                     /locus_tag="SBAL_RS03345"
                     /old_locus_tag="Sbal_0659"
     CDS             complement(747351..748262)
                     /locus_tag="SBAL_RS03345"
                     /old_locus_tag="Sbal_0659"
                     /EC_number="2.7.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588538.1"
                     /note="catalyzes the formation of D-ribose 5-phosphate
                     from ribose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_006084108.1"
                     /db_xref="GI:493000246"
                     /translation="MSQILVIGSANADHVMKFEYLPAAGQTLMSRDYRLELGGKGANQ
                     AVACARLAKPGTRTDFICHLGQDSIGDDMRQSWIKDGISTEGISQVAEQSTGTAMIFI
                     GDNGENTIGVAAGANATLSPDDLEHHYALFANAQYLLAQLETPAATVAKALKMAKNLG
                     VTTVLNPAPATALGHDVLKWVDVITPNETEAEALTGVEINHLDDAQMAAQLLHQQGVG
                     IVVITLGSRGAYISSPGFTGLVPALEVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVG
                     FANAASAITVTRQGAQRAIPYRQELSY"
     gene            complement(748282..749238)
                     /locus_tag="SBAL_RS03350"
                     /old_locus_tag="Sbal_0660"
     CDS             complement(748282..749238)
                     /locus_tag="SBAL_RS03350"
                     /old_locus_tag="Sbal_0660"
                     /EC_number="3.2.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine-specific ribonucleoside hydrolase
                     RihA"
                     /protein_id="WP_011845798.1"
                     /db_xref="GI:500171373"
                     /translation="MTRHIILDCDPGHDDAIALILALAHPDLVPLAVTTSAGNQTPDK
                     TLNNALRILTLLNRGDIPVAGGATKPLTRELIIADNVHGETGLDGPALPEPSFSPQAI
                     TAVELMAQQIRQSTQPVTLVPTGPLTNIALLLASHSELHPKIERIVLMGGAAGVGNWT
                     PAAEFNIFVDPEAADIVFKSGIPITMCGLDVTHQAQIMDEDIERIRAIPNPIAQCVAE
                     LLDFFMIYHRDPKWGFIGAPLHDPCTIAWLLKPELFEAQDCWVGIETQSELTLGMTVV
                     DRYQLTGKTANATVLFGLDRLGFVDLLVDSLRVYDPTYLNRR"
     gene            749473..750915
                     /locus_tag="SBAL_RS03355"
                     /old_locus_tag="Sbal_0661"
     CDS             749473..750915
                     /locus_tag="SBAL_RS03355"
                     /old_locus_tag="Sbal_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845799.1"
                     /db_xref="GI:500171374"
                     /translation="MLTHRITWPMALLAGMVAMQISGCSDPQPMAIIESNNESLLQFD
                     NGKLIQFKEKPSPQYRHIPCDLPAVNTVVANDMAVAALTPNGDVITWGNSFSGGDSRE
                     VAAELKHVKQVVPVKEGFAALREDGTVVYWGRAGKLSLDKALQSRMTNITKLYANREA
                     VAALDASGKVHTWGYGPEGGNSQHVQDKLVDIVDIFAKGRSFTALKKDGSTVIWGQIE
                     RSTNMKKLLPQLMDVVRVEYTQGTYAALKKDGSVVTWGQSSDIYPIRSALQDVVSITS
                     NSCAFAILSPAGEAHFWGNETNCGIDWLKQTDIKGVNSIVSVGTGFLLLRDNAVPQIL
                     VDDSDYAYLYGFHYAQEILNRYWQEGSKITIGSASFVFTRPDGKVVPVGYRANLENVE
                     KLIERIPLLTWLARAGEGYVGISEKGEWVSWSMNNEMLAKSPLQPADSLVIKPLDFAP
                     VAQCETPEQRQAILSQERPKPEVKMWLFSE"
     gene            751131..751799
                     /locus_tag="SBAL_RS03360"
                     /old_locus_tag="Sbal_0662"
     CDS             751131..751799
                     /locus_tag="SBAL_RS03360"
                     /old_locus_tag="Sbal_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845800.1"
                     /db_xref="GI:500171375"
                     /translation="MKLALCSPIGLFQGASVLLLCSLIGSEPVQATLDMPRSESGAAH
                     THVLPVFGQQLGFNLPAGWKQAYHEEQAGMFMAEFVPEQEALNQWSALFCVQGFKDMA
                     ESISPERFLDTMAETYKSTCDGEVVYQKLGDTEVDGHAGFHAILGCTAMPNMHGVTPL
                     NPKAYASTPQGEIGYYTVVSGNKDLYLLHKSMRGAVFSADKPPLQADNSQDFISTLVP
                     FSLK"
     misc_binding    751936..752170
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            752279..754237
                     /locus_tag="SBAL_RS03365"
                     /old_locus_tag="Sbal_0663"
     CDS             752279..754237
                     /locus_tag="SBAL_RS03365"
                     /old_locus_tag="Sbal_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011845801.1"
                     /db_xref="GI:500171376"
                     /translation="MGTNPTKIALLIGSLCSFSVIAPAMAADDTSTAKVNEHLVVIGR
                     SDNTPLNIAANVNVIDAAAIEMSGATSVTEVLRGQSGIQISDNNIGTSFAMRGFSAST
                     AVNNTLILLDGRRLNNIDIAAPSLNAIPLNQVERIEILSGSAGVLYGDQAVGGVINIV
                     TKSPENTGGSVQLSGGSFDTYEGRGDVSGAINKDWRYFFTGSYNQGDNYRKHNANETG
                     SILGRIQYKTATDSFFVETSYYDNDRENPGSLTEKQFKDNPRYSGNDKQYSHEMTTAA
                     RTGYQHQLNPNWALAADLDYSDTLVSSLNWGQSRNTRSLLMFSPKALANYSTRQGELN
                     LVTGLDISRGKADFDTMARSNVQQMQSAYLQATVPLSHTLSYVVGGRYARVTDELVDG
                     NVYPNGMDLDENAHAFELGLNYRPTAEHRLYVRADDNFRFAKVDEQAYTSPGVLGLKP
                     QTGRSYEAGWDWTLASQTLRVSLYRLDLEDEIVYDSSATKPIGGNFDGANVNADASRR
                     YGASADWDWQVTKAVQLGLEYNYIDAEFTDGNNDGKELSWVAKHTGRGYVSMDFAEHF
                     QVFAEAIYTGDHFVEGDNGNEGDKLASYVLGNLALNYNRDAWLASLRIDNLFDKDYVS
                     AGYYGGLWGDSYYSGRGRDIRLTLGYRF"
     gene            754518..755246
                     /locus_tag="SBAL_RS03370"
                     /old_locus_tag="Sbal_0664"
     CDS             754518..755246
                     /locus_tag="SBAL_RS03370"
                     /old_locus_tag="Sbal_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011845802.1"
                     /db_xref="GI:500171377"
                     /translation="MTDLEQQVFTQIRAIIANEEQVIGRRGILIPLKKAILAEGDIRN
                     VIDIISSDPALAAHMLMRSNSAQASGVINPKTRSLKEALVRLGQVNIYRYAFTFYLQE
                     RLDELPQPYKKLVQGYWKLTEDIATDAVDSLAEMEGVEVDADEVQTLALFSVFGQIIA
                     LTAFAYLNANAEQSFPLSVIKSLIDNQQQTLTIESFEALDLDQDLRQEFMIAHNLRQT
                     RNSNSPGLILRRVLSMRGLLMNPL"
     gene            complement(755334..756656)
                     /locus_tag="SBAL_RS03375"
                     /old_locus_tag="Sbal_0665"
     CDS             complement(755334..756656)
                     /locus_tag="SBAL_RS03375"
                     /old_locus_tag="Sbal_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011846320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014620597.1"
                     /db_xref="GI:504433495"
                     /translation="MQLSEALARTHITRLTEFTCLADVLEPELIQSCLDSQGVATLRR
                     RKLPMDAMIWAVIGMALFRGESVRSLINKLDIVLPQEIDYVARSAVTQARKRLGSEVI
                     REVFSRSANTWHARAEHPHWCGLNLYGVDGVVWRTPDSVQNQAAFARTANASGEAAYP
                     QIRMVCLMELSSHLLVNSAFDSVAENEMNLASQLITSIPNHSLTLFDRGFYSLGLLHA
                     WQQAQPDSHWLLPLKKGTQYEVVRTLGKHDQWVKLTTTPQARKKWPQLPDTLEARLLT
                     KTVKGKSVAILTSLTDPMRYPSEDIVDLYAHRWEIELGYREMKQHLLESRFTLRSQLP
                     ELVTQELWGVLLAYNLIRYKMLLMAKSLPSVHPNQLSFRDAASYIIFKLTQLPSQTPG
                     NVPRDVLDIERNARQFKLDGNRERAYPRVLKMSKNKYPVRPKKNAVHS"
     gene            complement(756777..757682)
                     /locus_tag="SBAL_RS03380"
                     /old_locus_tag="Sbal_0666"
     CDS             complement(756777..757682)
                     /locus_tag="SBAL_RS03380"
                     /old_locus_tag="Sbal_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_006080231.1"
                     /db_xref="GI:492988116"
                     /translation="MIELRHLRTLMALKESGSLAGAAKKRFVTQSALSHQIKELEQRI
                     NSPIFVRKSKPLSFTQEGARLLHLAEEILPKVLETETDLKNGLETETNQLRVGIECHS
                     CFRWLMPVMEQFRQDYPQAELDLSSRHLFDSLNALEMGELDIVLTSDPVPGHSLAYQH
                     LFDFEVKLVVAKDHPLAKEAYVTPKQLAHLPIISYPVPLTRLDIYRHFLEPAGIEAGE
                     QKTCDLTMMLLQRIACKDGIAALPNWSINEGHGLSLTTVKLGQEGLKRPLFGAYRRHS
                     ANSALIQNWLQLVASEGLSRQQKTN"
     gene            757883..760153
                     /locus_tag="SBAL_RS03385"
                     /old_locus_tag="Sbal_0667"
     CDS             757883..760153
                     /locus_tag="SBAL_RS03385"
                     /old_locus_tag="Sbal_0667"
                     /EC_number="2.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011624034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_011845804.1"
                     /db_xref="GI:500171379"
                     /translation="MQLNSLGFPRIGRRRELKFALEKYWRGEITQAELREVASELRRT
                     HWQWQTAAGIEQVPVGDFAFYDQVLTLSATLNAIPDRHRGEGAIDLDTLFRVARGRAP
                     TGQDAPASEMTKYFNTNYHYLVPELTQNQDFSIAYEQFFDEVSEAQALGYKAKPVLLG
                     PVSYLHLAKTVGQEFDKLSLLPNLLTAYADILARFAAQGVEWVQLDEPVLALELDTHW
                     QAAMTKTYQALSTANVKVLLASYYGGIAHHQAFVSALPVAGLHLDLVTAPEQLAVFAD
                     ALGQDQILSAGVVNGRNVWAADIDLIAERIGAVAGDLGDRLWIGTSCSLLHSPVDLDV
                     EVKLLPVLRKQLAFAKQKLLELSKVRQLLLAPSSDEAQKISAFCIARRQAKAQAADKQ
                     VVDRVSALTAADYERANDFSVRQSVQQRKYQLPLLPTTTIGSFPQTPAIRGLRSRWRK
                     GELNDAQYTEQLQQVTRDTIDRQLKLGIDVLVHGEAERNDMVEYFGKQLAGVGFSKNG
                     WVQSYGSRCVKPPLIYGDVSRPKAMTVEWAKFAQSLTDKPVKGMLTGPVTILHWSFAR
                     EDISRDAIATQLALAIRDEVVDLQNVGIGIIQIDEPAFREGLPLKQSEWQTYLDWAVN
                     AFKLSAAGVTDETQIHTHMCYSEFNDTIGAIAAMDADVITIETSRSRMELLNAFEDFE
                     YPNEIGPGVYDIHSPNTPSVEAMVHLIEKAAQKVPVRQLWVNPDCGLKTRTWDEVEPA
                     LKNMVDATRELRRRLG"
     gene            760422..760946
                     /locus_tag="SBAL_RS03390"
                     /old_locus_tag="Sbal_0668"
     CDS             760422..760946
                     /locus_tag="SBAL_RS03390"
                     /old_locus_tag="Sbal_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845805.1"
                     /db_xref="GI:500171380"
                     /translation="MSEIIDVIINVDTDNLMKTYPNPSTDPSTPTAIGHNFAYMIAPT
                     AYVKSGQATGDLSISADVGDTIRWRMNSMSGNTSYSADLMNLMRFSGTQVTSVVEGKL
                     TEPQTPIPEGGLGSILLPPTYLCVPQYDFYLSADVVTSGTENYNVSFAVLYYHSGSIN
                     TLGYFVWDPTISAS"
     gene            complement(761045..762232)
                     /locus_tag="SBAL_RS03395"
                     /old_locus_tag="Sbal_0669"
     CDS             complement(761045..762232)
                     /locus_tag="SBAL_RS03395"
                     /old_locus_tag="Sbal_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster binding protein"
                     /protein_id="WP_011845806.1"
                     /db_xref="GI:500171381"
                     /translation="MSTLANQIPNQSYASTLSRLALQIKTWGKALGFAQVGICDTDLT
                     AEEAKLQAWLDKGFHGEMAYMATHGMMRARPQELHPGTVRVISVRMDYLPPEAGFATN
                     LTDPNLGYISRYAGGRDYHKLIRARLKKLGDQISAELVALGFDAADFRPFVDSAPVLE
                     RPLAEKAGIGWTGKHSLILNHEAGSWFFLGELLINLPLPVDIPIQEGCNSCVACITSC
                     PTGAIVEPYVVDGRRCISYLTIELQGAIPEEFRPLMGNRIYGCDDCQLVCPINRQAPL
                     TAETDFHIRPQLKQPDLLSLFAWSEAEFLKQTEGSAIRRIGHKRWLRNIAVALGNAPS
                     SPEIIQALSIRKEQADVDNIVKEHIDWALIQHQSKSPQLITARRKTERLIRTVKKGLP
                     RDA"
     gene            762408..763204
                     /locus_tag="SBAL_RS03400"
                     /note="ABC transporter substrate-binding protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(763201..>764283)
                     /locus_tag="SBAL_RS03405"
                     /old_locus_tag="Sbal_0671"
     CDS             complement(763201..>764283)
                     /locus_tag="SBAL_RS03405"
                     /old_locus_tag="Sbal_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080235.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_041409065.1"
                     /db_xref="GI:752761947"
                     /translation="IKLNRLNEAEKYLTEAAAVINEKDLADYSFMKLFMGNIKFQQAH
                     YEEALTELEQGEKAFRTLQNDRGLTQLLQLKSDVYAAMNNLPAAYGALLEFVALTKKI
                     DDNSFSHQTTELKVKFDTSRIESENQRLIENQNLKEQELALLEKNKSLQHIILLLTGF
                     ILTIVSIFAYKQVQRNRQLQVIALTDYLTKLPNRRHIYAQAAQYFQQALKQQSPFSVI
                     IFDADHFKKINDNFGHELGDRALLTIASAGKALTGNKDLIGRIGGEEFLILLPNTDAE
                     RADELAHQLQAHISRLGAEDLPAELKLTVSAGVATLAPQTNTENTYQDKDFASLLKRA
                     DDALYEAKNAGRNCVKAARNEAVSES"
     gene            complement(764318..765259)
                     /locus_tag="SBAL_RS03410"
                     /old_locus_tag="Sbal_0672"
     CDS             complement(764318..765259)
                     /locus_tag="SBAL_RS03410"
                     /old_locus_tag="Sbal_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011845808.1"
                     /db_xref="GI:500171383"
                     /translation="MNYQQLTEARRYQISVLLEQGFSIAHIAKCIDCHRSSVYREVKR
                     CQGQSRYQPDIAHKQAVTMRRQSSKYAIPSQRIESIILLLQLDWSPEQISQVLRLVKE
                     PVSHEWIYRYIARDKRRGGKLYRHLRQGHKRYRRGKVEQAPTIKNAVSIDDRPAIVDS
                     RERFGDWEIDTVLGLHGTGSIVTLLERKTRFYLIKKVNSKSAADVTKATIELLMPYKA
                     HVLTITADNGREFAHHQEIAEALDTQVYFAHPYRSCERGANENANGLLRQYVKKGVDL
                     RLVSDELIEFAQNRINYRPKKCLKFKQPAVVFHQLAA"
     gene            complement(<765358..766203)
                     /locus_tag="SBAL_RS03415"
                     /old_locus_tag="Sbal_0673"
     CDS             complement(<765358..766203)
                     /locus_tag="SBAL_RS03415"
                     /old_locus_tag="Sbal_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090167.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_041409067.1"
                     /db_xref="GI:752761949"
                     /translation="MLRPLISLSLTFWLLLLPLSHAMAEEKTQVDKIFERFESGETMT
                     REAIKSDLALLSKLIATDDIARNEKLQLLKCWDQSAETDTDIALAVKNTSQTLTNIPP
                     TASPHFITDLMLCHSWFLQLNGDVDSAMEGYNLSVKRAYEHEDLKLIADSRSLRGALY
                     SYIGDFSAALDDLITAQDLYESLNLTGWANINLADMATSFRRYGDPQSAIRYYTKLKA
                     LYLKNNNQEQAMYVTSEIGLALDELGEHQQAIDNFLLSYQYFKEHQLEKAAATMATNI
                     GFSLIQ"
     gene            766359..766883
                     /locus_tag="SBAL_RS03420"
                     /old_locus_tag="Sbal_0674"
     CDS             766359..766883
                     /locus_tag="SBAL_RS03420"
                     /old_locus_tag="Sbal_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_011845810.1"
                     /db_xref="GI:500171385"
                     /translation="MKKLLCAALLMMSGASWAGSDLETSGDVLHLLLPATAMGATLFY
                     EDGYDGSWQLIQAAVSSRLIVEGLKYGVSKDRPDGSGDDSFPSGHTSDSFMAATFIQQ
                     RYGWQYGLPAYVAASYVGYTRVASDQHYLEDVLAGAAIGALAGWYFTQPYEGITVTPI
                     AGNGVYGLYVSGQF"
     gene            766920..767354
                     /locus_tag="SBAL_RS03425"
                     /old_locus_tag="Sbal_0675"
     CDS             766920..767354
                     /locus_tag="SBAL_RS03425"
                     /old_locus_tag="Sbal_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084096.1"
                     /db_xref="GI:493000211"
                     /translation="MSELSAVYRETAEQISYNVANKVLPMAKLPDGLLAAYQSLCAEL
                     LEDREGKFSQAWASLPASARNLMEQAAFHGFYIANAWLQLSRVAQEISEQADTDGEIQ
                     EQEYNGIFTRLADESLKESLRKLKKARTDRSMLNSFKQVMAP"
     gene            complement(767483..769171)
                     /locus_tag="SBAL_RS03430"
                     /old_locus_tag="Sbal_0676"
     CDS             complement(767483..769171)
                     /locus_tag="SBAL_RS03430"
                     /old_locus_tag="Sbal_0676"
                     /EC_number="1.1.1.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005498779.1"
                     /note="malic enzyme; oxaloacetate-decarboxylating;
                     NAD-dependent; catalyzes the formation of pyruvate form
                     malate; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent malic enzyme"
                     /protein_id="WP_011845811.1"
                     /db_xref="GI:500171386"
                     /translation="MDDNKRPLYLPFAGPAILEAPLINKGSAFSEEERIFFNLEGLVP
                     YAIETIEEQASRAYDQFRSFNNDLDKHIYLRNIQDTNETLFYRLVQNNISEMMPIIYT
                     PTVGLACERFSKNYRRNRGLFISYPNKDRIDDILNNSTRQKVKIIVVTDGERILGLGD
                     QGIGGMGIPIGKLSLYTSCGGISPAYTLPITLDVGTDNPQLLEDPMYMGWRHPRIGGE
                     EYAEFIEAFMQAVHVRWPDTLIQFEDFAQKNAMPILERYKDRYCCFNDDIQGTAAVAV
                     GSLLAACKAAGTELNQQRIAFLGAGSAGCGIAEAIVAQMVSEGISDEQARTQVCMVDR
                     WGLLLDNMPNLLPFQQKLAQKCTNIQNWSNFSDNISLLDVVNNTKPTVLIGVSGVPGL
                     FTEEIIRAMHSHCARPIIFPLSNPTSRVEATPKDILHWTSGQALVATGSPFEPVVVDG
                     ETYEIAQCNNSFIFPGIGLGVLASGARHVSDAMLMASSRALAECSPLAIDGSGPLLPK
                     LEDIHAVSKHIAFAVGKVAVEQGLTLPMSDEILQQSIEGNFWSPEYRRYKRTSF"
     gene            complement(769446..769910)
                     /locus_tag="SBAL_RS03435"
                     /old_locus_tag="Sbal_0677"
     CDS             complement(769446..769910)
                     /locus_tag="SBAL_RS03435"
                     /old_locus_tag="Sbal_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080239.1"
                     /db_xref="GI:492988146"
                     /translation="MINNDILRRLRFVFDFNNAKMIKIFAKAGREVPTEEIIALLHKE
                     EEEGYKACNDTTLCQFLDGLIIEKRGLREGAEIPAPVSRLNNNLIFKKLRVALEMREE
                     DIVAALALAEVQMSKSELSALFRNPDHKNFKECGDQILRNFIRGLSLKYRGE"
     gene            complement(770063..771337)
                     /locus_tag="SBAL_RS03440"
                     /old_locus_tag="Sbal_0678"
     CDS             complement(770063..771337)
                     /locus_tag="SBAL_RS03440"
                     /old_locus_tag="Sbal_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845813.1"
                     /db_xref="GI:500171388"
                     /translation="MTESSTTSPSSSWMAHLTLGIKAMGPGVLMAAAAIGASHLVAST
                     RAGAEFGWQLAWVILGVNLLKYPFFAAGARYTAATGESLLHGYLKQGRGYLLLFTGLN
                     VIAAVASTAGVCMLTAAMLTQFIPLPIDWLALLVLLSSLALLILGHYQLLDRLTKIIM
                     FALTLTTLIAVTLAWDHAQPLASNFVSPSPWQWAHVGFLVAMMGWMPAPIEVSAWNSL
                     WLLEKQKSQTVTKAQALLDFNLGYIITAILAIVFLSLGALVMHGSGEHFSDSGAQFAN
                     QLINLYSQVMGGESRYLIGVVAFLCIFSTTVTVIDGYSRTLDMGWQLLTSKARSDKRL
                     TGIMLAISAFGLLLILFFKGALLPLLEFVMILAFMTTVIFAWLNYRLMISKQLPEADR
                     YGTKMKLLSWFGLSYLLIFAALFIYWYNVIKG"
     gene            complement(771489..772028)
                     /locus_tag="SBAL_RS03445"
                     /old_locus_tag="Sbal_0679"
     CDS             complement(771489..772028)
                     /locus_tag="SBAL_RS03445"
                     /old_locus_tag="Sbal_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845814.1"
                     /db_xref="GI:500171389"
                     /translation="MEDKIIHQADFESNLGLYWLLSGASYFSLSIVGIPLLLLWFPIG
                     LWGTRRYIRNISAELTSNKLIVRRGILTRTENSVPLDKITDMALIQGPIMRLFGLHKL
                     TVETAGQSGAGALISLVGIVDAPQFRTRVLEQKERLTQRPHPASPSVQPDDALLQNVV
                     EMAASLKRIEALLSQKLNR"
     gene            772272..774830
                     /locus_tag="SBAL_RS03450"
                     /old_locus_tag="Sbal_0680"
     CDS             772272..774830
                     /locus_tag="SBAL_RS03450"
                     /old_locus_tag="Sbal_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011845815.1"
                     /db_xref="GI:500171390"
                     /translation="MNRPQILPSACAIAIALAFAPTVAHAADKGAEKVERIEVTGSRI
                     KRTDIEGPSPIQSISKDDIANMGFDNLQQLLERMPANGAGAFSTRGNSQDSTANGGAS
                     ISLRGLGPDATLVLINGRRVAASAFAEGITNSFVDINNIPVSAIERIDILKDGASAIY
                     GSDAIAGVVNIILKKDIEGIEVNLGYGDASGTGYNESTANMVWGMKSDKGSASIILDY
                     FKNDTLAATDLGRFGTADQSPYGGEDSRSSRGFPGYFYVDGVPTVDPACPADRNIDGE
                     VCVFDYGPYNLVVPAAERVGAIGQFEYHFNDDLTAFLELAAQHNTSEAGGAPTPLDEK
                     AGLTVPGSHPNNPWGKDIKIGRFRTVDAGARRWDIESDTLRLVAGLRGVVKDWDWEAS
                     MQKGRSESTQTGDRSQGWVRTDYLQREIDAGRYNPFGGTMNSQDVIDDITTSLVRQGL
                     STMTSYAANISGQAFTLADRDIMMAAGVEYREEAISDEPDEQFQRGLIFGTEAVSAKG
                     DRDQWAAYTEFSIPVTDNFELQLAGRYDHYSDFGSTTNPKVAFQWGITDELTARASWS
                     TGFRAPSLAQIGLGPSEESSFLIDKYRCAADGQGCTLSDETTEFAGNPKLKAEESETW
                     NIGMIWAPSQKFDIGFDIYSITQDNKIDKLLLQDIYDANCNDQNSTVCVRLAPQVGQT
                     FGALDVIRSSFVNLGSQQVQGMDVSTHYGFELDGYGDLKFGLEWSYLHNFEKDDTHQV
                     VDYTGEYKYPKNRWLATTNWTMDNFAANLNLSYIGEFEDFNKTRTIDAQILVDMSGTY
                     RFNEMFKLTLGVNNVFDEEPPFAIGDGDTDLYGYVTSVHNPMGRYIYTKLTMNF"
     gene            774990..775622
                     /locus_tag="SBAL_RS03455"
                     /old_locus_tag="Sbal_0681"
     CDS             774990..775622
                     /locus_tag="SBAL_RS03455"
                     /old_locus_tag="Sbal_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_011845816.1"
                     /db_xref="GI:500171391"
                     /translation="MITLYGTPRSRALRVAWVLEELGVDWDFSFVDMTKGAHRSAAFL
                     AINPCGKVPVLTDDELVLSESAAICLYLAEKYGEGKLLPPAGSNASGLHHQWVSFIIT
                     ELEQPLWTLGKHKFALPEEQRHPQIMPCAVWEFDKAAALAEAMLPESDFLLGDDVSVA
                     DILLAHTLMWGTLFEQAIPPKLAAYRDRLSALPSRQSALQKMDAVVAAKG"
     gene            complement(776048..776548)
                     /locus_tag="SBAL_RS03460"
                     /old_locus_tag="Sbal_0682"
     CDS             complement(776048..776548)
                     /locus_tag="SBAL_RS03460"
                     /old_locus_tag="Sbal_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084089.1"
                     /db_xref="GI:493000192"
                     /translation="MSKNIGLNAIEMSYLRQSLSLSAAQVGTLTNHSEADVLAWESGE
                     QAAPELAQKKLLDIDDIIEMQVLNTCDGIEELFKKEPKRHLAFVVYPTQATYTQYNPE
                     FLSSLPFTELYNTAAWRIKKECKLVLEVDVSLVALDVEAYKAFREPTKMSESRESRAK
                     WAATQL"
     gene            complement(776579..776986)
                     /locus_tag="SBAL_RS03465"
                     /old_locus_tag="Sbal_0683"
     CDS             complement(776579..776986)
                     /locus_tag="SBAL_RS03465"
                     /old_locus_tag="Sbal_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007645391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall assembly protein"
                     /protein_id="WP_011845817.1"
                     /db_xref="GI:500171392"
                     /translation="MHDIIEQLQERSETVPVPLELPTFEQLVEVEEQILISLPRELKE
                     YLLYASDVIYGTIEPVTASDPYSHTYLPEVTCYAWSIGMPRDMIAICQQGDAFYCIDQ
                     DGQVHFWKNGGFTDIYWESFWEWVEEIWLKIKY"
     gene            complement(777161..777946)
                     /locus_tag="SBAL_RS03470"
                     /old_locus_tag="Sbal_0684"
     CDS             complement(777161..777946)
                     /locus_tag="SBAL_RS03470"
                     /old_locus_tag="Sbal_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="WP_011845818.1"
                     /db_xref="GI:500171393"
                     /translation="MTKLFRTFFIFLLLLSSRAGVANSLDVSDTKTERGNYSARQAQS
                     HDLQGLYALSSQTFDAPRQTSNDLSVLHHQAYDAQAELAQLLTRIAHHSQTQVIIPPV
                     KSYQRAADKVAIKFNGDASQITDLARASIVTDSIQDLMQAYQALNEQTQVVKQKNRFA
                     EPKASGYRDLNLLVRLPQSGMIAEVQLHLQDIADIKNGPEHKVYEKVQTIEANARKQQ
                     RLLSEFELAQIAKLRQESHKLYHKAWLNYKRVDEASLLRVSVA"
     gene            complement(778174..780258)
                     /locus_tag="SBAL_RS03475"
                     /old_locus_tag="Sbal_0685"
     CDS             complement(778174..780258)
                     /locus_tag="SBAL_RS03475"
                     /old_locus_tag="Sbal_0685"
                     /EC_number="3.4.24.71"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007645397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M13"
                     /protein_id="WP_011845819.1"
                     /db_xref="GI:500171394"
                     /translation="MRKVLIGGLCASLIAGLTACNDKPADVKAPETAKTATAVAVTQV
                     LGSGIEFANFDKAVRPQDDFYKYVNGTWLKNTEIPADRTSIGAFYDLREKSRDDVKAI
                     IEEVAATPNLATGTDEQKVADLYRSFMDTDTLNKLGVTPIQGEFDAINALKDKNELVK
                     YFAHSQIAGAGTPMAFYIDIDAKNSSRYATHLYQYGLSLPEKDYYFNESERFVNIRKA
                     YVAHIEKMFTLAGLANPKASAESILALETAIASKHWDVVENRDSTKTYNLYQVKDLPT
                     LAPDIDWTVYLTALGADKQTDIIINQPSYIQGLNEVLKTTDLATWKTYMQWQVLTHAA
                     NYLSEALDNENFDFFSKTLNGQEEQEPRWKRGVASVNGMLGEVVGKVYVKRHFTPEAK
                     DRMQALVENLRGAYGESIKDLTWMSDSTKVAAADKLAKFNPKIGYPNKWEDYSKLSIK
                     ADDLIGNAIRASEVEHAKSLAKLGAPIDKDEWHMTPQTVNAYYNPTMNEIVFPAAILQ
                     PPFFNLAADDAVNYGGIGAVIGHEMGHGFDDQGAKFDGEGNMRDWWTEQDLKEFSARG
                     QALIAQYDGYFVFDDLHVNGGLTLGENIGDLSGVTIAYRAYKKSLNGQEAPVIDGLTG
                     DQRFFIGFTQIWRAKAKEEAMRNRVATDPHSPAEFRALGALSNMPEFYTTYDVKPGDA
                     MYIAPEKRVKIW"
     gene            complement(780521..781075)
                     /locus_tag="SBAL_RS03480"
                     /old_locus_tag="Sbal_0686"
     CDS             complement(780521..781075)
                     /locus_tag="SBAL_RS03480"
                     /old_locus_tag="Sbal_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose O-acetyltransferase"
                     /protein_id="WP_006080249.1"
                     /db_xref="GI:492988187"
                     /translation="MTEFQKMIAGQEYDCLASELLSLRAQQQRLNRQLNQIIDHDTPE
                     YSQLCQQLIPHKSPAATISTPIFISYGANLSLADKVFINVNVTLQDNAPISIGEQTMV
                     GPNAQFYTSSHPLDAELRCSGLETAKAIKVGKRVWIGGGAIIMPGVIIGDDAIIGAGA
                     VVTKNVAAKTVVAGNPAKPIRQLI"
     gene            781153..781905
                     /locus_tag="SBAL_RS03485"
                     /old_locus_tag="Sbal_0687"
     CDS             781153..781905
                     /locus_tag="SBAL_RS03485"
                     /old_locus_tag="Sbal_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615398.1"
                     /note="catalyzes the synthesis pseudouridine from
                     uracil-516 in 16S ribosomal RNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA pseudouridylate synthase"
                     /protein_id="WP_014620598.1"
                     /db_xref="GI:504433496"
                     /translation="MPFEVVGLIIWQFSLLKLSINVRLDKFICESTPLTRSLAKKALH
                     RGDITCDGIVVKDSGFKVTEGMRVCLQGEPIALVGVRYLMLNKPVDTICSTIDETYPS
                     VLSLVDVPKPETLHIAGRLDADTTGLVLVTSDGQWSHKITSPKKECGKRYLVQLADPV
                     DAGLIAIFAAGVELRGEDGLTKPALLEIIEPQLVRLTITEGKYHQVKRMFAAVGNHVQ
                     ELHRESVGQIELDPALALGEWRYLTAEEIASV"
     gene            complement(781982..782938)
                     /locus_tag="SBAL_RS03490"
                     /old_locus_tag="Sbal_0688"
     CDS             complement(781982..782938)
                     /locus_tag="SBAL_RS03490"
                     /old_locus_tag="Sbal_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845821.1"
                     /db_xref="GI:500171396"
                     /translation="MSNLNLTKASLLVSTLYLGLMGNVFAAQSVDKKLNISSDTQLQI
                     KVQRGDVTIQTWDKSEVSVTGTLDELSEGFVFEQQGNSLNIEDKMPRHYNGSNDKGSQ
                     LTIKVPKTVKLSADTISANLQVAEAQGELDLNTVSGDIKANNLSGKPELHTVSGDIIT
                     QALDGKVKLETVSGTIQDTDSKGEMNYRLVSGDLKSQTQAEKVTVEQVSGEVNANFSL
                     AKEIVLRTVSGDSKVSLAKNFNRANLESVSGDIIVTFADMPDASFDLDGGPGGKIKNT
                     LTQDEPKKQKYVPRAELSFQTGSGAASVKMNTISGDLVLKKQ"
     gene            complement(782935..783519)
                     /locus_tag="SBAL_RS03495"
                     /old_locus_tag="Sbal_0689"
     CDS             complement(782935..783519)
                     /locus_tag="SBAL_RS03495"
                     /old_locus_tag="Sbal_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845822.1"
                     /db_xref="GI:500171397"
                     /translation="MTLTPLSREQQLEQLINSAPNAMPPTHDLWQGIEKRMDKPLVSQ
                     TRQSQNGRQWAIAASFIMLVALGYSQLPYFNQLTTQQPELAQNSAMPEQQGDAALQLL
                     LTQIAASHQAQVDNLEQTTNALAWQTSSFSAPVEQGLAELRRAATQIYQALQANPTDK
                     QLWQLWLWVQQRELDLLQQGQKLPIRNSTQGNTL"
     gene            complement(783519..784052)
                     /locus_tag="SBAL_RS03500"
                     /old_locus_tag="Sbal_0690"
     CDS             complement(783519..784052)
                     /locus_tag="SBAL_RS03500"
                     /old_locus_tag="Sbal_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_011845823.1"
                     /db_xref="GI:500171398"
                     /translation="MTAGILPLNSAMSDFELVTLASQGNRAAFKLLYQSHHQRIYTLS
                     LRLCGHKNMAEEITQECFILVWQKLPQFRGESQFSTWLHSICVNQALSSIRKQQSFWA
                     RFIPLENETEPMSSDESYSGLDKLIFKLPQRARMVFVLCAIEGYQHDEIADLLGIAVG
                     TSKTQYHRAKQLLQEML"
     gene            784491..786353
                     /locus_tag="SBAL_RS03505"
                     /old_locus_tag="Sbal_0691"
     CDS             784491..786353
                     /locus_tag="SBAL_RS03505"
                     /old_locus_tag="Sbal_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011845824.1"
                     /db_xref="GI:500171399"
                     /translation="MFIRSKLLLSAAVSISALVAMFGLQLHSNSVKSELSHAAQNVLE
                     LERDVLILRKNEKDFFARKDLKYAELHKQSHMKIDSIVPELEKVFKEYGVSKASLESF
                     DSHLNQYQAAFSEVVQLQQEIGLTPKTGLYGTLRSAVHNVETLLKQYNQLELEVAMLQ
                     LRRNEKDFMLRRELSYVETFDANIGKFNDKLRSSSLDADTQNKIAELITQYQKDFKSL
                     TNKEQQLGLTEKDGTMARLVAANLQIESSANDLHNLALKAIDDAESSSVNVGIAVFIF
                     ITLLLSFITYLIIRSIIAPVERITQIIARIEVSKDLTLRCDASTQDELGEIAQHFNSM
                     VSSFQQLIEQVIESVATINTSCKRVSENAMLASEGVGQQLNETDMVATAITEMGATID
                     EIAKTTELAASKAGQTHDNAQSGQLEVEQTIHKIQSLAEQLNSSAAVVNELERDSETI
                     GSVLDVIRGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAMRTQSSTQEIAN
                     IIQTLQTRTRSIVQLMESSQKQGVESAEQAASAGALLKLINTDVRNIMDMSTQIAAAI
                     EEQSMVAAEVNKNVVVIRDIAEESSHAADANASASDELKAQAEFLFRAVSNFKI"
     gene            complement(786552..787499)
                     /locus_tag="SBAL_RS03510"
                     /old_locus_tag="Sbal_0692"
     CDS             complement(786552..787499)
                     /locus_tag="SBAL_RS03510"
                     /old_locus_tag="Sbal_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080255.1"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-phosphate from D-ribose 5-phosphate and ATP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_006080255.1"
                     /db_xref="GI:492988206"
                     /translation="MPDIKLFAGNATPSLAKKIADRLFCKLGDAVVGRFSDGEISVQI
                     NENVRGADVFIIQSTCAPTNDNLMELIVMVDALRRASAGRITAVIPYFGYARQDRRVR
                     SARVPITAKVVADFLSSVGVDRVLTCDLHAEQIQGFFDVPVDNVFGSPVLLEDMLAKN
                     LDNPVVVSPDIGGVVRARAVAKLLDDSDLAIIDKRRPQANVAQVMHIIGDVQGRDCII
                     VDDMIDTGGTLCKAAEALKEHGANRVFAYATHPVFSGKAAENIANSVIDEVIVTDTVP
                     LSPEMLKVAKVTQLTMSAVLAEAIRRVSNEESISAMFRH"
     gene            complement(787612..788466)
                     /locus_tag="SBAL_RS03515"
                     /old_locus_tag="Sbal_0693"
     CDS             complement(787612..788466)
                     /locus_tag="SBAL_RS03515"
                     /old_locus_tag="Sbal_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3D0F8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="WP_011845825.1"
                     /db_xref="GI:500171400"
                     /translation="MPAAISRNWPAPAKLNLFLHINGRRADGYHALQTLFQFIDCCDM
                     LDFKVTETPELILHSNMSGVVADSDNLILRAAKSLQQTTGFNGGAEIWLDKRLPMGGG
                     LGGGSSDAATTLVALNKLWHTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGVGERLQ
                     AVNPSEPWYLVIAPDAHVSTADVFQDPLLPRETPKLAIDTLMSQPWANDCQKLVVSKY
                     PQVAKALGWLLEYAPSRMTGTGACVFGEFTQQQQALAALAKLPSEMQGFVAQGMNLSP
                     LITRLSHP"
     gene            complement(788468..789112)
                     /locus_tag="SBAL_RS03520"
                     /old_locus_tag="Sbal_0694"
     CDS             complement(788468..789112)
                     /locus_tag="SBAL_RS03520"
                     /old_locus_tag="Sbal_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845826.1"
                     /db_xref="GI:500171401"
                     /translation="MNNLKRLTKTIFSCFTLSALLLLAGCETLPPMTDLSPITVTDAR
                     QATAWELQGKLAIKTPDDKLSANIYWRHSEDRDELTLTTMLGTTVLTLNSTPNSAHLH
                     IDGKDFRDDNAQRLLERVSGWSIPLADLPLWITGQVGPNDQVIARDSQGKPKQLTNTQ
                     TPPPWQVAFLSWQSQSGASVPHQLKLERGDLQLKLQLNQWQALGKPAILVGEQP"
     gene            789366..790616
                     /gene="hemA"
                     /locus_tag="SBAL_RS03525"
                     /old_locus_tag="Sbal_0695"
     CDS             789366..790616
                     /gene="hemA"
                     /locus_tag="SBAL_RS03525"
                     /old_locus_tag="Sbal_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q087I5.1"
                     /note="catalyzes the formation of glutamate-1-semialdehyde
                     from glutamyl-tRNA(Glu) and NADPH; the second step of the
                     pathway is catalyzed by glutamate-1-semialdehyde
                     aminomutase which results in the formation of
                     5-aminolevulinic acid; functions in porphyrin
                     (tetrapyrroles) biosynthesis; the crystal structure showed
                     a C-terminal dimerization domain that appears to be absent
                     in Chlamydial proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="WP_006084077.1"
                     /db_xref="GI:493000154"
                     /translation="MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEA
                     VIVSTCNRTELYCNNGDEADIIAWLEEYHGLDHKDVAPCLYNYHGQDAVRHLMRVASG
                     LDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTDTEIGAAAVS
                     VAFAAVSMAKHIFSSISTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGM
                     CEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIA
                     VPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAEVITEEQSFLFMDWIRS
                     LESVDSIREYRSQSMAVKDELVERALNKLAQGSDTEQVLIELANRLTNKLIHAPTQAL
                     TAASRQGDLNTLGQLRSALGLDKN"
     gene            790631..791722
                     /gene="prfA"
                     /locus_tag="SBAL_RS03530"
                     /old_locus_tag="Sbal_0696"
     CDS             790631..791722
                     /gene="prfA"
                     /locus_tag="SBAL_RS03530"
                     /old_locus_tag="Sbal_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007645412.1"
                     /note="recognizes the termination signals UAG and UAA
                     during protein translation a specificity which is
                     dependent on amino acid residues residing in loops of the
                     L-shaped tRNA-like molecule of RF1; this protein is
                     similar to release factor 2; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="WP_011845827.1"
                     /db_xref="GI:500171402"
                     /translation="MKESVIRKLEGLLERNEEVMALLGDASVISDQDRFRALSKEYAQ
                     LEDVVAGFKAYQQAQVDLDSAKEMLEEDDAEMREMAQEEMKAAKAKLEHLEDELQILL
                     LPKDPDDDKNAFVEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQIEIMSCNEGEHGG
                     FKEVIMKVSGDGVYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVLHEVPEAEAIS
                     INPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVL
                     AARIQALEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEV
                     MEGDLDAILLPLMQEHQADQLAALADEQG"
     gene            791725..792573
                     /locus_tag="SBAL_RS03535"
                     /old_locus_tag="Sbal_0697"
     CDS             791725..792573
                     /locus_tag="SBAL_RS03535"
                     /old_locus_tag="Sbal_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5-glutamine S-adenosyl-L-methionine-dependent
                     methyltransferase"
                     /protein_id="WP_011845828.1"
                     /db_xref="GI:500171403"
                     /translation="MSDQSSIAEALQWAYVQLASTSESAHLDAEVLLLYCLNKSRSYL
                     YTWPEKSLTVEQWKRFQQMVQKRQKGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEI
                     LVETALNMPLSTYANVLDLGTGTGAIALALASERESWQITAVDKVDDAVALAIANREN
                     LKLPQVDILQSDWFSAVKSRDFDLIVSNPPYIDETDEHLHQGDVRFEPQSALTAAEEG
                     FADLYYIANTARDYLKPNGYILLEHGFEQAVRLRAKLIELGYENVATVRDFGSNDRCT
                     MGKWAE"
     gene            complement(792881..793432)
                     /locus_tag="SBAL_RS03540"
                     /old_locus_tag="Sbal_0698"
     CDS             complement(792881..793432)
                     /locus_tag="SBAL_RS03540"
                     /old_locus_tag="Sbal_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein"
                     /protein_id="WP_011845829.1"
                     /db_xref="GI:500171404"
                     /translation="MKRLFLLLTLLISTTAYSADETHGFSAGLGFGSTENYGAITHYD
                     FAYRYQFTPNWGVEVGYTPFQSEPFTGAINAIFDDYVLVNSYSSRLAGTYTYQISARH
                     NAILKVGLSQSKTNYELDDYTNNSDDAITIDEYSDDGYGLYAALGWRCRFYNGFEFMT
                     TLAYQDSGTLEMTSFTVGIGYSF"
     gene            complement(793903..794316)
                     /locus_tag="SBAL_RS03545"
                     /old_locus_tag="Sbal_0699"
     CDS             complement(793903..794316)
                     /locus_tag="SBAL_RS03545"
                     /old_locus_tag="Sbal_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_011845830.1"
                     /db_xref="GI:500171405"
                     /translation="MNLSLINDESTEFADAVKQKIVEFNQAQWQGLSRKNLGIKLQDA
                     EGKLLAGISGKTFGNWLLIDYLWVDDALRHQKIGTRLLLEAESQAKARGCQFALLDTL
                     DFQAKPFYERYGYRVQWIQQAYPETDSKFFMVKAL"
     gene            794436..794831
                     /locus_tag="SBAL_RS03550"
                     /old_locus_tag="Sbal_0700"
     CDS             794436..794831
                     /locus_tag="SBAL_RS03550"
                     /old_locus_tag="Sbal_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="invasion protein"
                     /protein_id="WP_006080263.1"
                     /db_xref="GI:492988243"
                     /translation="METFYSLYPAVKHLHFTFIALSVLLLTVRFVLHLRQSALMEKKL
                     LKIAPHVIDTFLLLSGLTLCFMIQQFPFVDPWMTEKIGAVVAYIVLGAIAIKANRNKL
                     FKVFAYLGAIGWLVYAAKLAHFKQAVLLG"
     gene            794831..795619
                     /locus_tag="SBAL_RS03555"
                     /old_locus_tag="Sbal_0701"
     CDS             794831..795619
                     /locus_tag="SBAL_RS03555"
                     /old_locus_tag="Sbal_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080264.1"
                     /db_xref="GI:492988246"
                     /translation="MGNYTLQDGISLPESALDVGAHLGFSKLEAAKWAWFEMAGAVLS
                     HYLVDQQQRFNALLHWFYEDLGFCVRDNYFSTEAADLGTCLISRQGNSTTLATVLMLL
                     AKQLDLELEPILLPGNTVLRCKIAGEVSYLDPLTGKELSRHQLHVLVRGELGNAAELK
                     ASYLKPATVKKLLTRMLHELKAGCIVSHQFEAAMECCSLLLQWHSDDVHLNRERAFIA
                     QQLGCINVAAADLQHFVDNSPHDPVIEIVKMQLKELNEHAEIYH"
     gene            795774..797021
                     /locus_tag="SBAL_RS03560"
                     /old_locus_tag="Sbal_0702"
     CDS             795774..797021
                     /locus_tag="SBAL_RS03560"
                     /old_locus_tag="Sbal_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845831.1"
                     /db_xref="GI:500171406"
                     /translation="MTSTALVTNDATALGILATILGFVFYTSSSSHPFWQKFYRFIPA
                     LLLCYFLPSLLNTFGVIDGNTSQLYFVASRYLLPACLVLLILSVDLKAILSLGPKALI
                     MFLTGTVGIVIGGPIALLLVSIIEPSLIGVDGPDAVWRGMTTLAGSWIGGGANQAAMK
                     EIYAVGGNIFSVMVTVDVIVANIWMAVLLFMASKAKEIDARTGADTSAIEALKDKVEK
                     YHAENARIPNLRDLMLIVAVGFGITGIAHMAADFLGPFFEANYPWTEDYSLTSKFFWL
                     VVIVTTIGLAMSFSPVRHLEAAGASKVASAFLYILVATIGLHMDVSKVLDTPLYFLVG
                     IIWMLVHAGFMLLVAKLIKAPLFYMAVGSQANVGGAASAPVVAAAFHPALAPVGVLLA
                     VFGYALGTYMAWLCGQLLQVVAT"
     gene            797086..797934
                     /locus_tag="SBAL_RS03565"
                     /old_locus_tag="Sbal_0703"
     CDS             797086..797934
                     /locus_tag="SBAL_RS03565"
                     /old_locus_tag="Sbal_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013052629.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-octonate 8-phosphate from
                     phosphoenolpyruvate and D-arabinose 5-phosphate in LPS
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphooctonate aldolase"
                     /protein_id="WP_006080266.1"
                     /db_xref="GI:492988252"
                     /translation="MSNKIINLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEV
                     TQKLGIPYVFKASFDKANRSSINSYRGPGMEEGLKIFEEIKKTFNLPLITDVHEVHQC
                     APVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGN
                     DEIILCERGSSFGYNNLVVDMLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQ
                     ATELARSGMALGLAGLFIEAHPDPDNAKCDGPCALPLHQLENYLKQMKAIDDLVKSFE
                     PIDTSK"
     gene            798122..798994
                     /locus_tag="SBAL_RS03570"
                     /old_locus_tag="Sbal_0704"
     CDS             798122..798994
                     /locus_tag="SBAL_RS03570"
                     /old_locus_tag="Sbal_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_011845832.1"
                     /db_xref="GI:500171407"
                     /translation="MWILLTLLAAFMQAWRNAFQSQLSKEVSVAGVTLARFIWAGPIA
                     AVYLVGLYLWQDVGVPDFSGRFIGFILGASAMQILATGLMVKLFKQQNFAIGAGLAKS
                     EAVVAAILGTVFFGTHLSPLGWSGVLLGGVAIFLMSAKQGLRSLSLNTVLIGLACGTS
                     FALTSLWVREASLCLNIGFPHSAAWVLLFVISLQTLVLVSYLLLKDKSTLAALWQRPK
                     LTLLTSTASCLGSIGWFSAMSLQAVPYVKTLGQVEVFFMILIATFWLKEKVKIKDMLG
                     LVLIAMAAILVMWE"
     gene            799168..800688
                     /locus_tag="SBAL_RS03575"
                     /old_locus_tag="Sbal_0705"
     CDS             799168..800688
                     /locus_tag="SBAL_RS03575"
                     /old_locus_tag="Sbal_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_011845833.1"
                     /db_xref="GI:500171408"
                     /translation="MRRKIAKLNLPLWQWLAVILFPIGVAVVASYLSAQYFVEDKVKG
                     VGGIYVGNIDTLISHADEISHYALALKDTECQELHNYMLFQPYFRSALIFDSQRVYCS
                     SKTGDIDVPLGIVSTTENLEIPNQFIIGGTPFMPEVPAIVASNWEPISKHGAAVIIEG
                     QYLLDSFVQPNVFPSAVINVALSINGKTIPESPEFKQNEVMTLDSDKHNFSVLLAMSP
                     AFFWHFFWIFLAISLPVSIVLITGTILFVLYSRVTRHSLADDIRSGIENEEFFLVYQP
                     VICAEDGKAKGVEALVRWQHPQMGLVRPDLFIPIAEEGKLIVPLTNYIFERALKDFAD
                     MKVEPGFRIAFNVAPEHFTQDDIESKFIHLRDSLERIGVKPLIEITERQLLTPDICQC
                     IESLRQLGILVAIDDFGTGQTTLSLLQTMPLDYLKIDKCFIDTIGQDSVTSHVLDTII
                     ELSHKMNYVVVAEGVETQEQADYLTSRQVHFLQGYLFAKPMKLADLKLWLVEHFKH"
     gene            complement(800856..802169)
                     /locus_tag="SBAL_RS03580"
                     /old_locus_tag="Sbal_0706"
     CDS             complement(800856..802169)
                     /locus_tag="SBAL_RS03580"
                     /old_locus_tag="Sbal_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="WP_011845834.1"
                     /db_xref="GI:500171409"
                     /translation="MILANFRLSFKYLLILFSMLATNAVADEGQFSAANTAWILNSSA
                     LVLLMTLPGLALFYGGLVRSKNVLSILMQCFSIAALVSVLWFAIGYSLAFDAGNSFIG
                     GLGKALLSGIGRDSLSGDIPEPLFMLFQMTFAIITPALIIGGFAERMKFSAVLIFSGT
                     WLLLVYAPITHWVWGGGWLAQLGLYDFAGGTVVHITAGVAALVAAKVLGPRKGFLNSA
                     IMPHNLTMTVTGAGMLWVGWFGFNGGSALGANGTAAMAILATHLAASMGAMTWAAIEW
                     IKFGKPSALGIVTGMVAGLGTITPASGYVGPAGALVIGLLGGIVCFYSTVYIKQKLKI
                     DDSLDVFPVHGVGGILGTLLAGVFSSTQLGVFSGYGFAAVNETMIDQLGVQIIGVAAT
                     FTYTAVVTWLLFVIIRKLLGGLRVSTEQEVNGLDLSEHEETGYSL"
     gene            complement(802166..802504)
                     /locus_tag="SBAL_RS03585"
                     /old_locus_tag="Sbal_0707"
     CDS             complement(802166..802504)
                     /locus_tag="SBAL_RS03585"
                     /old_locus_tag="Sbal_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615386.1"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of NR-I,
                     the transcriptional activator of the glutamine synthetase
                     gene (glnA); at low nitrogen levels P-II is uridylylated
                     to form PII-UMP and interacts with an adenylyltransferase
                     (GlnE) that activates GlnA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="WP_006080270.1"
                     /db_xref="GI:492988266"
                     /translation="MKLVTAIIKPFKLDDVREALTQLNVHGMTVTEVRGFGRQKGHTE
                     LYRGAEYAVDFLPKMKLEVAIHSDQEEAVIEAIIAAAHTGKVGDGKIFVTELQQVVRI
                     RTSEEGVDAL"
     gene            802627..802845
                     /locus_tag="SBAL_RS03590"
     CDS             802627..802845
                     /locus_tag="SBAL_RS03590"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041408852.1"
                     /db_xref="GI:752761734"
                     /translation="MQNGAKQNQIALIWCVLLVQDKFCWQVSVQIVPSGYKARGVSVL
                     IRCMSAGNQIVIYRLSLLNIWLNLIELG"
     gene            complement(802856..803791)
                     /locus_tag="SBAL_RS03595"
                     /old_locus_tag="Sbal_0708"
     CDS             complement(802856..803791)
                     /locus_tag="SBAL_RS03595"
                     /old_locus_tag="Sbal_0708"
                     /EC_number="1.1.1.169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_011845835.1"
                     /db_xref="GI:500171410"
                     /translation="MTHAVDIAILGAGAVGQLICRQLTVAGMDVGFIGRNALESGQQV
                     LSFTPLASADDHQQIQAIPYSVPILTADALDNIRLVIVCVKAYQVLDALSPLLKQLPS
                     QCHILLLHNGMGPHLALAPLINAQANGRGLSLGTTSQGVLRQAPWQIKQTGQGLTQLG
                     HFAGAELTKHYRNALLAAIPSSEWVDAIVPCLWQKLAVNAAINPLTALYQCPNGKLAE
                     PDFSEVIKSILDELVMVAAHDGVSLDKSFLHDRVYQVIRLTAGNFSSMHQDIAHKRRT
                     EIDQINGYICERAQAHGLSAPVNAELWARVKHLAV"
     gene            complement(803841..804203)
                     /locus_tag="SBAL_RS03600"
                     /old_locus_tag="Sbal_0709"
     CDS             complement(803841..804203)
                     /locus_tag="SBAL_RS03600"
                     /old_locus_tag="Sbal_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="teicoplanin resistance protein VanZ"
                     /protein_id="WP_011845836.1"
                     /db_xref="GI:500171411"
                     /translation="MITKNTLFKLALAVAFIVISYLVFSRPTYSQSIPNIDKVGHLGS
                     FFCLSYLSYLAFKPKWYWLSLTLAIYAILIELVQSRLPYRSASVADVIADFAGIALFY
                     FCNWAYGKYFRAAQLRED"
     gene            804359..804844
                     /locus_tag="SBAL_RS03605"
                     /old_locus_tag="Sbal_0710"
     CDS             804359..804844
                     /locus_tag="SBAL_RS03605"
                     /old_locus_tag="Sbal_0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3D0H5.1"
                     /note="nucleotide binding property based on structural
                     studies of Haemophilus influenzae crystallized protein in
                     PDB Accession Number 1IN0 and NMR studies of Escherichia
                     coli YajQ; the YajQ protein from Pseudomonas synringae
                     appears to play a role in activation of bateriophage phi6
                     segment L transcription; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding protein"
                     /protein_id="WP_006080274.1"
                     /db_xref="GI:492988286"
                     /translation="MPSMDIVSEVNEVELRNAVDNTKRELATRFDFRGKTADVEYKDH
                     VVTLTAEDDFQCQQLVDILRMQLSKRNVDPSSMEVDEKAIHSGKTFSLKVKFKEGIET
                     LIAKKLVKLIKDSKLKVQASIQGEKVRVTGKKRDDLQAVMALARESELGQPFQFDNFK
                     D"
     gene            complement(804965..806380)
                     /locus_tag="SBAL_RS03610"
                     /old_locus_tag="Sbal_0711"
     CDS             complement(804965..806380)
                     /locus_tag="SBAL_RS03610"
                     /old_locus_tag="Sbal_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011845837.1"
                     /db_xref="GI:500171412"
                     /translation="MSATGFIQRTLDALSVYYHKRVLILLLLGFSAGLPLMLVFSTLS
                     FWLREAGVDRTSIGYFSWIALAYAFKWAWSPLVDRLSLPLLTRFLGRRRSWMLFAQLL
                     LVGAILGMSFSDPLKDLERLALFALMVAFASATQDIVIDAFRIESAPEKMQAALAAAY
                     QVGYRSAMIIATAGALTIAAWVEPGNTAYNLVAWQTSYLIMAGLMSVGILTTLFSREP
                     EVDTRAADATELALKQRLSATYPRVIAAGMSWVYTASILPFIDFFKRYGRSAILILLL
                     ISCYRISDIVMGIMANVFYVDMGFTKEEIAYLSKIYGLIMTLVGAAFGGVLLARYGTM
                     KILFLGALLVAVTNLLFAWQAVIGYNVPFLTFAISVDNFSAGIATAAFIAYLSSLTSS
                     GYSATQYALLSSIMLLFPKFIAGFSGAYVDAFGYVNFFVAASVIGFPVLFLVILVNKY
                     TPHPSTSLTDGTSKDTAANSD"
     gene            complement(806677..806997)
                     /locus_tag="SBAL_RS03615"
                     /old_locus_tag="Sbal_0712"
     CDS             complement(806677..806997)
                     /locus_tag="SBAL_RS03615"
                     /old_locus_tag="Sbal_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014620600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080276.1"
                     /db_xref="GI:492988291"
                     /translation="MTATEFIDNKAPQLAFYGKAFLSEELDFHEVQLYLWDTLEEWQQ
                     LNSTGEAQTETEKVFWHLLHSFNRWPDCVIRGNQYLRKQVNDCCDYLSLGGRVPQGCV
                     GIRP"
     gene            complement(807071..807655)
                     /locus_tag="SBAL_RS03620"
                     /old_locus_tag="Sbal_0713"
     CDS             complement(807071..807655)
                     /locus_tag="SBAL_RS03620"
                     /old_locus_tag="Sbal_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011845838.1"
                     /db_xref="GI:500171413"
                     /translation="MLRWISALLFLFMSHNSFALDIQADTLYPRVEFDTSLGKIVVEL
                     DRTRAPITVDNFLTYVVKGEYDNTIFHRVISDFVVQGGGLTPKYEELPDGKPIVNESG
                     NGLTNSIGTIAMARENEPHSATRQFYFNVADNTKLDPSKRRWGYAVFGEVIEGKTVLE
                     AMAVVETGTNAKLNWPDVPVTPIILKTAKLLPKQ"
     gene            complement(807685..808251)
                     /locus_tag="SBAL_RS03625"
                     /old_locus_tag="Sbal_0714"
     CDS             complement(807685..808251)
                     /locus_tag="SBAL_RS03625"
                     /old_locus_tag="Sbal_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011625278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080278.1"
                     /db_xref="GI:492988296"
                     /translation="MKRLLLTLTFPLLFAGCASQNPTHMAFSPQVPNISQQTAQRVPI
                     SLETVDTRTVDYVARFIEEGTKTRLVGPSEPPKLLLDEVFRAGFSQAGYQIDPSATNS
                     VQIQLEELQMDVTKKTFGYEAKHSVLIAVQAKNSTQELVKRYKAKGTLKGPLTPDFAT
                     LELDMNKLLGQLTGEILNDPELNQFLQQ"
     gene            808398..808961
                     /locus_tag="SBAL_RS03630"
                     /old_locus_tag="Sbal_0715"
     CDS             808398..808961
                     /locus_tag="SBAL_RS03630"
                     /old_locus_tag="Sbal_0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011845839.1"
                     /db_xref="GI:500171414"
                     /translation="MPKLSLISFIVGLALASSIMSTNAFAGDSAHILGGSLGYGSQEF
                     ETKNGKYDAGDTLSGDLYYRYMLNEHFGVEAGYLAGSGGVASAFVSIISEIKNLSYNG
                     VRTTAYGEYALSRGNSLYAKLGAAYTQVSYEMDKQEMDSNDVGFYGAVGWQYRFKSGF
                     GLNLEYEYLPMKELELQGINFGMSYRF"
     gene            809178..810209
                     /locus_tag="SBAL_RS03635"
                     /old_locus_tag="Sbal_0716"
     CDS             809178..810209
                     /locus_tag="SBAL_RS03635"
                     /old_locus_tag="Sbal_0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845840.1"
                     /db_xref="GI:500171415"
                     /translation="MLTIATQIAPDSLINPKGLPHFGHFDGIVKTLGLADFAYFDTMD
                     KPASAWAKHFDYKQFQFVSLVTPRYVLGIALADIAYVGSAFCYLYDIKTNTLTQLDWL
                     KPLRFGYQMTPSPAEGRSSIGRKGAQLSFEIVEGGWRLIIDTKNIQADVTLHSAPLSL
                     PMAMCSPTGYNGWTYTQKHNGLTVKGSLTVAHEPQPLNHALAGYDFSAGYMRRDTSWR
                     WASINARIHEGIMGLNLAAGVNETGATENVFWINGERHLLGPVQFEFDRHATLGAEVW
                     RVYSQNGQVDLQFAARNCRSEKRNLLLLKSNFRQFIGHFSGTIIDNQGRSYQLNNVLG
                     LAEDHYARW"
     gene            810353..811219
                     /locus_tag="SBAL_RS03640"
                     /old_locus_tag="Sbal_0717"
     CDS             810353..811219
                     /locus_tag="SBAL_RS03640"
                     /old_locus_tag="Sbal_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase"
                     /protein_id="WP_011845841.1"
                     /db_xref="GI:500171416"
                     /translation="MDIASLIQHPEVLLLVLAPLFFVCILLEWYFGDKRQKLPLTARY
                     RGQEVLCNFSLAAMHQGADLLTGLLIAKLYLAMFGWKLFDIEMGPLSFIALMIAQDFC
                     YYWFHRASHRVRWMWAAHVVHHSSENMNFSTAFRQSLMYPFAGMWVFWLPLVVIGFDP
                     NWVVFVVLLNLGLQFFVHTQAIKSLGPLEWVFNTPSHHRVHHGRNPQYIDKNYAGVLI
                     IWDKLFGTFEPEVETVIYGITKPVNSFNPLKVTFSEWRDMFAEVTATGLSVKQRLRIL
                     FAPPSSSLKSEE"
     gene            811389..812012
                     /locus_tag="SBAL_RS03645"
                     /old_locus_tag="Sbal_0718"
     CDS             811389..812012
                     /locus_tag="SBAL_RS03645"
                     /old_locus_tag="Sbal_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845842.1"
                     /db_xref="GI:500171417"
                     /translation="MMDEPRLSAEELACFSELFSPTRVGTALTNDPLVNHLLTVTTEV
                     PQVIASILGKAKLTLLAEVGPYKLWFPLLMKVDDFGQFQPTLGVPEVLDASGVERSWR
                     LTQADDVWIFDHDQGEQWSVASLSSSGMAIRAKSQQQFKQLLGSKDLQLQLPNGETMR
                     VDIEPIRSEKGLAFVKFQAETEEREALRQFLFSRHRSQHAQLYRDLR"
     gene            812211..813602
                     /locus_tag="SBAL_RS03650"
                     /old_locus_tag="Sbal_0719"
     CDS             812211..813602
                     /locus_tag="SBAL_RS03650"
                     /old_locus_tag="Sbal_0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090139.1"
                     /note="ligates
                     L-alanyl-gamma-D-glutamyl-meso-diaminopimelate to
                     UDP-N-acetylmuramic acid for reincorporation into
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_011845843.1"
                     /db_xref="GI:500171418"
                     /translation="MHVHILGICGTFMGGLALLARAKGHRVTGSDANVYPPMSTQLED
                     QGIELIQGFDPSQLGEAGHYPDLVVIGNAMSRGNPCVEAVLNIGIPYTSGPQFLADHI
                     LPERWVLAVSGTHGKTSTSSMLAWILDDCGYEPGFLIGGVPQNFGVSARLGKTAFFVV
                     EADEYDSAFFDKRSKFVHYHPRTLVINNLEFDHADIFADLAAIQKQFNHLVRTVPGEG
                     KIVWPADSHAVKQTIDMGCWSEQETYHLAESANGWYGKALSDDCHRFEVFFDGESQGI
                     LEWDLIGQHNIENAMMAIAAARHVGVKPSAAIEALAKFMPPKRRLELLGTVNGVSVYD
                     DFAHHPTAIATTLKGMRAKVGQSKITVVLEPRSNTMKSGVHKDTLAFSMMQADEAFLY
                     QADTIDWNMKEAMEAAVIPVTVLHQIDDVVAKVTATAKAGDTIVVMSNGGFGGLHKKL
                     LAALELRSTVELV"
     gene            813604..814263
                     /locus_tag="SBAL_RS03655"
                     /old_locus_tag="Sbal_0720"
     CDS             813604..814263
                     /locus_tag="SBAL_RS03655"
                     /old_locus_tag="Sbal_0720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012090138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic acid decarboxylase"
                     /protein_id="WP_006080284.1"
                     /db_xref="GI:492988317"
                     /translation="MSYTKSTKAISLAWTGASGAPYGLKLLECLLVSGYQVFLMISSA
                     ARVVLATEHGLQLSANSDKAHAQLLALLHEKGVIITGELVVLGKDEWFSPPASGSAAP
                     KQMVICPCSTGTLAAVATGMSNNLLERAADVVIKERGQLILVPRETPFSAIHLEHMLS
                     LSRLGATIMPAAPGFYHNPKSVEDLVDFMVARILDHLGVDHALTSRWGYDKQSNRDLD
                     N"
     gene            814271..814801
                     /locus_tag="SBAL_RS03660"
                     /old_locus_tag="Sbal_0721"
     CDS             814271..814801
                     /locus_tag="SBAL_RS03660"
                     /old_locus_tag="Sbal_0721"
                     /EC_number="2.4.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845844.1"
                     /note="catalyzes the formation of inosine monophosphate
                     from hypoxanthine and 5-phospho-alpha-D-ribose
                     1-diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_011845844.1"
                     /db_xref="GI:500171419"
                     /translation="MKHTTEVMISAEEISQKLDQMAELINAHYAHSERLLMVGLLKGS
                     VVFMADLCRRIKGHVEIDFMSVSSYGNAMTSSRDVKVLKDVQSDIAGRDVLIVEDLID
                     SGNTLSKVREMLLLREPKSLALCTLLDKPERREVDVKVDFIGFTIPDEFIVGYGIDYA
                     EQYRNLPYIAKVVPLD"
     gene            815008..815946
                     /locus_tag="SBAL_RS03665"
                     /old_locus_tag="Sbal_0722"
     CDS             815008..815946
                     /locus_tag="SBAL_RS03665"
                     /old_locus_tag="Sbal_0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011845845.1"
                     /db_xref="GI:500171420"
                     /translation="MANITHALVLEGLKKTYKGGVEAVKGISLTVNQGDFFALLGPNG
                     AGKSTTIGIISSLVQKSSGSVKVFDYDIDKQLEHAKLCIGLVPQEFNFNQFETVLQIV
                     VNQAGYYGVPKPVALERAKKYLSQLDLWEKRNSQSRELSGGMKRRLMIARALMHEPKL
                     LILDEPTAGVDIELRRSMWEFLKQINQQGVTIILTTHYLEEAEMLCRNIGIIDKGILV
                     ECTSMKALLSKLNMETFILDLRRDTVTAPVLDGIACRLTDSHTLEVDVVKEQNLNDVF
                     SQLSAANIEVLSMRNKSNRLEELFVELVKKTQGVSA"
     gene            815943..816713
                     /locus_tag="SBAL_RS03670"
                     /old_locus_tag="Sbal_0723"
     CDS             815943..816713
                     /locus_tag="SBAL_RS03670"
                     /old_locus_tag="Sbal_0723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007645477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006080287.1"
                     /db_xref="GI:492988333"
                     /translation="MNQLYFIAFKSILSKEINRFTRIWIQTLVPPAITMTLYFLIFGN
                     LVGSRIGEMGGVSYMEFIAPGLIMMSVITNSYSNVASSFYSAKFQRNLEELMVAPVPH
                     YVLIAGYVGGGVARGLCVGLIVTLVAMFFVDISLHHAGLVVMTVFLTSVLFSLGGLIN
                     AVFAKSFDDISIIPTFVLTPLTYLGGVFYSLSLLPPFWQGVSALNPVVYMINVFRYGF
                     LGFADISVPLSIAIMIGFCVALWTLAYYLVSRGIGLRS"
     gene            complement(816771..817907)
                     /locus_tag="SBAL_RS03675"
                     /old_locus_tag="Sbal_0724"
     CDS             complement(816771..817907)
                     /locus_tag="SBAL_RS03675"
                     /old_locus_tag="Sbal_0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011845846.1"
                     /db_xref="GI:500171421"
                     /translation="MTTTLRSLINKLDIVLPQEIDYVARSAVTQARKRLGSEVIREVF
                     SRSANTWRARAEHPHWCGLNLYGVDGVVWRTPDSVQNQAAFARTANASGEAAYPQIRM
                     VCLMELSSHLLVNSAFDSVAENEMNLASQLIPSIPNHSLTLFDRGFYSLGLLHAWQQA
                     QPDSHWLLPLKKGTQYEVVRTLGKHDQWVKLTTTPQARKKWPQLPDTLEARLLTKTVK
                     GKSVAILTSLTDPMRYPSEDIVDLYAHRWEIELGYREMKQHLLESRFTLRSQLPELVT
                     QELWGVLLAYNLIRYKMLLMAKSLPSVHPNQLSFRDAASYIIFKLTQLPSQTPGNVPR
                     DVLDIERNARQFKLDGKRERAYPRVLKMSKNKFPVRPKKNAVHS"
     gene            complement(817904..818743)
                     /locus_tag="SBAL_RS03680"
                     /old_locus_tag="Sbal_0725"
     CDS             complement(817904..818743)
                     /locus_tag="SBAL_RS03680"
                     /old_locus_tag="Sbal_0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001909078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037392505.1"
                     /db_xref="GI:739534104"
                     /translation="MLTICNAFKVHRSSYKYWLKRKEHIDADFTILCSEVKAAHRISH
                     GSAGARTIAQLVTNKGIGLSRYRARNLMKKLGLLSCQQPKHSYRKATQEHVAIPNTLN
                     RQFAVTQPDQVWCGDVTYVWVGNRWAYLAVVLDLFSRKPVGWALSLSPDSELTCKALK
                     MAFELRGKPENVIYHSDQGSHYTSLKFRQLIWRLQIEQSMSRRGNCWDNAPMERFFRS
                     LKSEWIPASGYGNFTEADKEITNYITGYYSETRPHQYNGGLTPNESERLYWNDSKTVA
                     NFT"
     gene            complement(818770..819081)
                     /locus_tag="SBAL_RS03685"
                     /old_locus_tag="Sbal_0726"
     CDS             complement(818770..819081)
                     /locus_tag="SBAL_RS03685"
                     /old_locus_tag="Sbal_0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006085772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_006080123.1"
                     /db_xref="GI:492987772"
                     /translation="MRSTTRKTFSAEFKLEAAQLVLDKNHSIIEAAKAMNVGKSTMDK
                     WVRQLKLERQGGTPKASPITPEQIEIRELKKQIARLEEHNLILKKATALLMSDSMNNL
                     R"
     gene            complement(819476..>822661)
                     /locus_tag="SBAL_RS03690"
                     /old_locus_tag="Sbal_0728"
     CDS             complement(819476..>822661)
                     /locus_tag="SBAL_RS03690"
                     /old_locus_tag="Sbal_0728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080289.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_041410796.1"
                     /db_xref="GI:752763680"
                     /translation="DASFCNNKLIVARWSQPTFPVCADEYMSPLGFGGHGTHVAGTAV
                     GNKVSTTFKEIPVELSGVAPAAYLMVYKALYSKADCTGGSGSNIMLMEALEHAVNDGA
                     DVINNSWGGGAGGDPASSPYKTMFEAAEAAGVVVVTAAGNDGNGPQTIGCPACIESGI
                     TVANTTTGRFFANSFNAGGDDLLAIPSSDAVLSEDITAPVIAAVNLDAENANGCDAFA
                     ADSFKDGIALISRGTCNFSLKATNAKAAGAKALVVYNNAAGAPTTMSMPGEPFPAVMI
                     TKDAGLAVIEAMGDTVTTGTIVAKTKRIMVSELADNLNSTSSRGPDGNQNILKPDIAA
                     PGTNILSAFSPDDGGEDFNMISGTSMASPHVAGAAALMSQLHPEWSANDIKTALTSTA
                     KFEGILDDDAVTPATPFDMGAGRMDLDAAAKAVLTFDKPSIASDSCVGPCTFTRTVYN
                     KSDATTSWSLSTSSDSTGITVSPSTLELAAGASATFTVTVDSTFATYGEWIFGNVLIN
                     STEGLQNAHLPLAILAKESSNASLISTLTTKTDITASDVIPLVATVNNNVFANTVTVT
                     AQAPKGTKLTSKDDVKVTLAGATQNGLQVNEDLGAVTWVGQLDLPKMATTKGAQRFPS
                     IVDLGVVPVTCLEGCDEQAFTFTVPSFKYNGVSYGNITISDNGLAIVGGGSASGTYTN
                     KQLPDGSNPNNILAPFWSDFDLSDKSVGDTGGGDLAVGVFTDGAGVKWLALEWNKGQL
                     YGDTSGTSYTFSIWIRTGDTEEVVFNYIDIPNMPANVTIGAENVGGTIGTTYNFNGTG
                     GSIATGDALTLKNTTAGNVTINYDVKATTLNVGQADVIETNEEALVSINVLENDTKPD
                     MKVARVSITGDGITANAQRIIDIMPKGALGNLAIVQAPSHGTAVINSTGGIDYTPSKD
                     YFGSDMLSYTSADEDGNTGGAATVTIDVKNVNDAPVVAPQPQSGVAGNAITLKPNPLD
                     VDGDVLSYVWAQTGGETLEFTPTNENITVTPSSAGTYTFTVIANDGKLQSNTGELVLT
                     VKSKPDTSSGGALGWLTALLLPLAAMRRRMK"
     gene            822731..823231
                     /locus_tag="SBAL_RS03695"
                     /old_locus_tag="Sbal_0729"
     CDS             822731..823231
                     /locus_tag="SBAL_RS03695"
                     /old_locus_tag="Sbal_0729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011845426.1"
                     /db_xref="GI:500171001"
                     /translation="MNYQRHSGQFKEAILNKLSQSGLSVRQFAEQEGINLSTLYSWQK
                     QFNTSGLNVSKVSSSDKWSSEEKFSVVLETASLSAVELSEYCRAKGLYPEQVNGWKQA
                     CIAGNTSTTLTSKAKTTPGQKTDKKRINELERELRRKDKALAEAAALLVLGKKFDAYW
                     KEKEED"
     gene            823354..824271
                     /locus_tag="SBAL_RS03700"
                     /old_locus_tag="Sbal_0730"
     CDS             823354..824271
                     /locus_tag="SBAL_RS03700"
                     /old_locus_tag="Sbal_0730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041410793.1"
                     /db_xref="GI:752763677"
                     /translation="MDGDISADKRPTATRPEPGNKLSQAERQAVIDVCNSEEFASLPP
                     SQIVPILADRGEYIASESSFYRVLHTENMLHHRGKAKPRNVHKKPTSYTAKKANEVWS
                     WDISYLPTTVIGKHYYLYMIEDIYSRKIVGWEVHDSETGEQAAALLERTVWSEKCLKK
                     DVVLHSDNGAPMKSLTMRAKMYDLGVVTSRSRPRVSNDNPYSESLFRTVKYHPRWPSE
                     GFKSLEAARKWVNEFVYWYNNEHRHSRIKFVTPNQRHDGLDVGILAKRKALYQTKRNE
                     HPKRWSKEERNWQPIGAVELNPEQHKEAA"
     gene            complement(824276..824983)
                     /locus_tag="SBAL_RS03705"
                     /old_locus_tag="Sbal_0731"
     CDS             complement(824276..824983)
                     /locus_tag="SBAL_RS03705"
                     /old_locus_tag="Sbal_0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845848.1"
                     /db_xref="GI:500171423"
                     /translation="MKTKLSIAISAALLSSAAIANSEFTFKPYSPEITSHDKFSKPKV
                     ATTNLGAPQRFIVEMESPALAKYQGGIGSFAATASAKEGQKINVQSAEVKNYANHLTK
                     EQNNFSSALAKTVPNAKVERHFQTLFNGVTVVGQGLTAEKLAQMPGVKSVYPETMYEI
                     SMDASHQIINTQAMWDAVSGMENAGKGVKVAVIDGGIRPENPMFADAGFTAPSGNLPS
                     DDYCSTVDAAFFKTVVA"
     gene            complement(825189..825650)
                     /locus_tag="SBAL_RS03710"
                     /old_locus_tag="Sbal_0732"
     CDS             complement(825189..825650)
                     /locus_tag="SBAL_RS03710"
                     /old_locus_tag="Sbal_0732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609941.1"
                     /note="transcriptional repressor of asnA which codes for
                     aspartate-ammonia ligase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_006080290.1"
                     /db_xref="GI:492988349"
                     /translation="MDTAFQRDQLDNHILEALMQDARTPFAELAKRFSVSAGTIHVRV
                     EKMKQAGIITGAQITVNPKALGYDVCCFIGINLKSAGDYPAAIAKLNALEEVVEAYYT
                     TGNYSIFVKVMCQSIDGLQHVLINRIQSIDEIQSTETLISLQNPIVRAVKP"
     gene            complement(825746..826423)
                     /locus_tag="SBAL_RS03715"
                     /old_locus_tag="Sbal_0733"
     CDS             complement(825746..826423)
                     /locus_tag="SBAL_RS03715"
                     /old_locus_tag="Sbal_0733"
                     /EC_number="4.2.1.70"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA/tRNA pseudouridine synthase A"
                     /protein_id="WP_011845850.1"
                     /db_xref="GI:500171425"
                     /translation="MTDFIYQPPTTPWLDILYQDKDIIVINKPSGLLSVPGRDPAHYD
                     SVYARVKAEHPHSQIVHRLDMATSGVIVVALIRSAERELKRQFHDRETSKTYFARVAG
                     HVKNDTGSVDYPLICDWPNRPKQKVDHLVGKPSLTHYQVISRAKRSTLVKLTPITGRS
                     HQLRVHMMALGHPILGDGFYADPLAKSLAPRLLLHAAELTIKHPYTGVSMTFSAEVPF
                     CEPLGEQ"
     gene            826640..828556
                     /locus_tag="SBAL_RS03720"
                     /old_locus_tag="Sbal_0734"
     CDS             826640..828556
                     /locus_tag="SBAL_RS03720"
                     /old_locus_tag="Sbal_0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011845851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_011845851.1"
                     /db_xref="GI:500171426"
                     /translation="MSLPEIYTPENLSHVHNRLELLAPAKNADYGIEAIRHGADAVYI
                     GGPAFGARATAGNSVEDIARLCTYAHQYHAQVFVALNTILMDNELADAEKLIWQLYEA
                     GADALIVQDMGVLQLNLPPIALHASTQMDNRSPEKVAFLEQVGFSQVVLARELGLSQI
                     RDVAAHTNMQLEFFIHGALCVAYSGLCNLSHSFSNRSANRGECSQMCRLPGNLKTRQG
                     DVLAQNEHLLSLKDNNQTENLEALIDAGIRSFKIEGRLKDLSYVKNVTAHYRQKLDAI
                     MARRPEFKASSHGRCEHSFIPDPEKTFNRGSTDYFVNERSQGIKDFRSPKYIGEEVGK
                     VVSIGKDFIQVSSTHEFNNGDGLAFFPANFAMAKQSDDKLQGLRVNRAEGLKLHILQV
                     PKDLKVGMTLYRNHNQAFEALLSKESSKRIIGVDLRLSDTQDGLALTLTDIYGLSATV
                     NLVVEKTPATDVDKALQNTRTQLGKLGSTDFVARSISIDTAQAWFLPASVLNGLRRDG
                     VAALEAARVQGYVRPLPWKHNQDAVYPVKHLSYLGNVANEKAKDFYQRHGVIEIQDTY
                     EKNGVTEDVPLMITKHCLRFNFNLCPKEVPGIKADPMVLEIGNDVLKLVFDCPKCEMM
                     VVGENRQVRGQKHL"
     gene            828745..829119
                     /locus_tag="SBAL_RS03725"
                     /old_locus_tag="Sbal_0735"
     CDS             828745..829119
                     /locus_tag="SBAL_RS03725"
                     /old_locus_tag="Sbal_0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007645492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006084057.1"
                     /db_xref="GI:493000087"
                     /translation="MGLLDGLLGNASEVDLQELAEELRPIMGIQEELKLAYKVIRDLF
                     IFTNKRLILIDKQGLTGKKVTYHSIPYKSITHFEVETTGHFDMDAELKIWISGQSEPL
                     VKELKRGTDVVGIQKTIATFAL"
     gene            829152..829919
                     /locus_tag="SBAL_RS03730"
                     /old_locus_tag="Sbal_0736"
     CDS             829152..829919
                     /locus_tag="SBAL_RS03730"
                     /old_locus_tag="Sbal_0736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection protein"
                     /protein_id="WP_011845852.1"
                     /db_xref="GI:500171427"
                     /translation="MEVKVMRLNLALFFVGFLGIMSVIPFVSQILAMQQGELPMPLFL
                     LQIISVAQSSLMLLLMVFMGSIFAKKVGLTTPVISAMVHSNSIYTALRPQLIPALVGG
                     VLGGVFILVFLGMLSGYLPADFIQAGAKLAPPWYTKVLYGGITEELLIRWGLMSFLVW
                     CSYRLTQRKGADIKVHNYVLAIILSGIIFGVGHLPVAFALTSEATIPLVLYIILGNAG
                     FGFIAGYLYWKYGLECAMGAHMLAHVTMIICALLVPL"
     gene            complement(829923..832433)
                     /locus_tag="SBAL_RS03735"
                     /old_locus_tag="Sbal_0737"
     CDS             complement(829923..832433)
                     /locus_tag="SBAL_RS03735"
                     /old_locus_tag="Sbal_0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011845853.1"
                     /db_xref="GI:500171428"
                     /translation="MSLFRALKAKLFPSSKTSCDPKDIYLHTEPQVPSQEQTQEPLVT
                     APLFQRHFSLKIHATKADATACEENANHGLTLYHYDTPQVIELLGWENANECCDFHQT
                     EFDRLEIGNQLPFPEQHFWLGKEKVCSIIPKKSDLVKELWQVELNNLEALLISHFTLD
                     ADNIVQGDIQDYASLTGQLHRTYHQLHSEDGAGMLRIITQSPGLTQAVDSNYFGERNG
                     ISRQFDALGTLLFEGHFVNDLQLGKQTWYDHEGKKTQSEDRHANGMYVTRYHTNGKIR
                     ETAELDRSGNYINNLARFYESGNLWLNRPMVANKIHGIEYMYYECGALQAEITHEHDH
                     IVQEFWFHTNGLIKQTIFINDMGKSVETFNESGHIAWREQFNAEGLIEGERKEWHPNG
                     KLAKQLNFNNGIAHGDREKWYANGQLEEKIPFENGKEQGTAYWYHDNGQLALEIYLEK
                     GLREGLFKSYYQSGVLSGEGQYQNNLSVAPFIEYYENQQVQMYLPHTQGNRDGTARWF
                     YEDGTIRTISEYEVRDGQGYLRESSFYNKKGILESYQSHSNTRCGYHLENNQREYYQD
                     GIADTRIEYYEDGAIRWLLTRTQGDLFSSKSLSPQGLILETGTIQIIDGRYLDIGHWQ
                     RFTPQGQVYREVWLDEEGQLIESRHYFDANQPLSTQEDDEAEWDNAEPRNYGYDNCDI
                     SDYDESEDEGDDFDYDRADWENDGLNQRSDNSEHSASHSSNSAYLSRNKYHRLNGDTT
                     AKQAQTQAAADVDAKEPILSYHLKFDDESKLYSMKRYHPNSHIAEEGNLQIQGEEQFW
                     VGIHNQYDEQGKLKLSETYTMAGEPIEHTTSTNAILLN"
     gene            832614..832742
                     /locus_tag="SBAL_RS03740"
                     /old_locus_tag="Sbal_0738"
     CDS             832614..832742
                     /locus_tag="SBAL_RS03740"
                     /old_locus_tag="Sbal_0738"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_006080295.1"
                     /db_xref="GI:492988369"
                     /translation="MLDNFFAKLPTDLSAEVFEKLAGNDTVTIERIVSNGQYTQAT"
     gene            833045..833269
                     /locus_tag="SBAL_RS03745"
     CDS             833045..833269
                     /locus_tag="SBAL_RS03745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_041408855.1"
                     /db_xref="GI:752761737"
                     /translation="MFRWFGYLPEAQWYDQTQHEWVMLLKGEATLEFEQDEPVTLTPG
                     DYLTIVPHQKHRVASTSNSSETLWLAVFYD"
     gene            complement(833297..834469)
                     /locus_tag="SBAL_RS03750"
                     /old_locus_tag="Sbal_0740"
     CDS             complement(833297..834469)
                     /locus_tag="SBAL_RS03750"
                     /old_locus_tag="Sbal_0740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012588497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011845855.1"
                     /db_xref="GI:500171430"
                     /translation="MLTTLAIFNYRSLREIVLPLGQLNLITGANGSGKSNLYKALRLL
                     AQTAQGGVVNALAQEGGLDSSFWAGPENFTKSMLAGDTAIEATVRQAPKRLKLGFAGE
                     DFSYLIELGLPEPDATTLFGLDPQIKREAIWNGPKYRPSTVLVERRGPMVKSRSADGK
                     GWIILGAHLQTGDSLFTELADPERCPEVLKLRDSIRAWRFYDHFRTDAEAPARRPQLG
                     TATPVLHHDGRDLASAIQTIFEIGDKSAFDHAVSDAFPGAKVRIEPQAGGILVLAFHQ
                     HGLLRPLNASELSDGTLRYLLLIAALLTPRPPELMVLNEPETSLHPDLLPALARLIAK
                     VSEECQLWVVSHANRLINALSQFEHCNTLALDKTLGQTQIQGQDLLNTPSWLWQNR"
     gene            complement(834553..835719)
                     /locus_tag="SBAL_RS03755"
                     /old_locus_tag="Sbal_0741"
     CDS             complement(834553..835719)
                     /locus_tag="SBAL_RS03755"
                     /old_locus_tag="Sbal_0741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M19"
                     /protein_id="WP_011845856.1"
                     /db_xref="GI:500171431"
                     /translation="MPIKAVNHHRRTLLKGLGAATLLSPLASLPSFAAAQRRIYVDGL
                     SFLPDDLSDVTASKLDAYICDISAIETIEQADGTQNYKRTYKACMESIKQAAKRVSDH
                     PDILLQGLRGRDIQRARDSQRTAVFFQIQGADCVEEDSEANQWARVDEFHQQGLRVLQ
                     LTHHYGNTFAGGALDSDANGGLNKPLTAHGRELIAKLNHANILVDVSHSSAQTALDVA
                     KITKSPIVQSHGAARGIVNHARCSPDEVIRAIGDSGGVFGVFMMSFWLTNNAVPTIDD
                     YIRQLEYVSRVGGVDSVAIANDFPLRGQENLLALGNDNAKGIKEYQEWWYSLRAKGVL
                     GFDAEPRHVVIPELNHIDRMSRIDDALAKARFKATDRDRFMGGNWQRVLNKVLL"
     gene            complement(835918..836364)
                     /locus_tag="SBAL_RS03760"
                     /old_locus_tag="Sbal_0742"
     CDS             complement(835918..836364)
                     /locus_tag="SBAL_RS03760"
                     /old_locus_tag="Sbal_0742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S metabolism protein SufE"
                     /protein_id="WP_011845857.1"
                     /db_xref="GI:500171432"
                     /translation="MTDSTMPMPSETDFHYSVQDAEILLTRFTKAPNWQERYRQIMLL
                     GKDLPSLSPELRVEAAQVKGCESDAWIYHLEQAGKHYYLADSDARIVKGLIGLLLGAC
                     HSKSLDEIQAFDPTAYFKQLGLEGQLSPSRTNGLNSLAKAMLEATL"
     gene            complement(836446..837783)
                     /locus_tag="SBAL_RS03765"
                     /old_locus_tag="Sbal_0743"
     CDS             complement(836446..837783)
                     /locus_tag="SBAL_RS03765"
                     /old_locus_tag="Sbal_0743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional cysteine desulfurase/selenocysteine
                     lyase"
                     /protein_id="WP_011845858.1"
                     /db_xref="GI:500171433"
                     /translation="MTQPASPTPNTVTHTATNTVASHPSASAAPDATAVICSSESEQR
                     NAKIRSQFPALNQLLDGYPLCYLDTAATSQKPQMVLDAMAQFYANDNANVHRAAHQLS
                     ARSTLSYEKVRDQLQQFLKAERREEIIFTHGTTESINLVAFGLTAHVSAGDVILIDAA
                     AHHANIVPWQELAKRTGAVIKPIPLDQACRLDVSAYKTLLELKPKIVALCHVSNALGT
                     VNPVAQLVQLAKAQGAITLVDGAQAVAHLTLDVAEIDCDFYVFSGHKMYGPTGVGVLY
                     GRFDVLDNLAPLLTGGEMIKRVSFEATEFGSLPNRLEAGTPPIAEVIGLGAAITFLQT
                     ELTPQVQAYEAELVNYLQSQLRALGEVHLYGAFDDNIGVVAFNLADEHHQDVGILLDQ
                     QGIAVRCGHHCAMPLMQSLNLKGCCRASIGIYTNKDDIDRFIAALASVKDLLL"
     gene            838131..839831
                     /locus_tag="SBAL_RS03770"
                     /note="chemotaxis protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(840011..842287)
                     /locus_tag="SBAL_RS03775"
                     /old_locus_tag="Sbal_0745"
     CDS             complement(840011..842287)
                     /locus_tag="SBAL_RS03775"
                     /old_locus_tag="Sbal_0745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011845859.1"
                     /db_xref="GI:500171434"
                     /translation="MKLALSSIALAVAGVCSPVMAAQLQGQVTDLQGAPIAGALVSID
                     GGTSTSTNPQGQYQLTVADNSHIHLHISNADFKHVDRDLQITTGAMTQDISLTKTAME
                     NIVVTASPLARSALESTTPISVLTEDQLKLNIEPTLGDTLEKLPGVQASHFGAGASRP
                     IIRGMGGPRVQVLENGLSVGDASTVSADHAVTAEAASAQQIEILRGPGTLLYGNGAIG
                     GVVNVVDKRYHESPVDELSGQFGTRYDTASNGRTFNGDIDGGNGQFNWHVDGTHRITD
                     DVDIPGNAIANLPETHGKLANSNQKLDDYAAGVGYTRDTGFVSVSGARTESNYGIPGR
                     GEADAPDITIDLKKTAWQLHSGLLDPFAGFSKLRFDAGYTDYQHAEEEDGVAGTTFFN
                     KQSEARLSLNNRPWGEWQGTMGLHAVHRDFAVEGEEALTPDSKTDTLAAFIVQERKVG
                     DFRFELGGRLEHYRLAPDSMTLDTLNGEQNYQAEDLVDNDLTVSAGMVWDFDPAYNLG
                     LSLTRAQRSATAEELYSYGPHDATQSFELGSQFSVENGQIITNSGNNDKEVANNIDLT
                     LRKLEGAWTGSLSMAYNRVNNFYYEKNTGLIASDIVNGDAEGDLPVYQYTQGDAELYS
                     LEAQASIPFNDTWSLDMFSDYTRGKLVDGGNLPLISPMRIGSTLNFDQQQWHAEVGAI
                     GYAKQTDTAENETETAGYALVNAAVTYRLYTSAGDMLFYVKGTNLLDQDARPHTSLLK
                     DYAPLMGRNFMLGVTYNF"
     gene            complement(842342..842638)
                     /locus_tag="SBAL_RS03780"
                     /old_locus_tag="Sbal_0746"
     CDS             complement(842342..842638)
                     /locus_tag="SBAL_RS03780"
                     /old_locus_tag="Sbal_0746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080303.1"
                     /db_xref="GI:492988402"
                     /translation="MTHSSSPTHRKWLWLLLGVWLIVIQSVALSHSAEHSLEHEHAHC
                     FLCDFGHEQNAGPSSVLMPPMGLQQAESIPQKPYQQPSLPWLRHFNVRAPPFLF"
     gene            843100..843939
                     /locus_tag="SBAL_RS03785"
                     /old_locus_tag="Sbal_0747"
     CDS             843100..843939
                     /locus_tag="SBAL_RS03785"
                     /old_locus_tag="Sbal_0747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="structural protein MipA"
                     /protein_id="WP_014620604.1"
                     /db_xref="GI:504433502"
                     /translation="MRILWFFVLTLSILPGTAAASDIASSVNGGSNRLADGGDFELGM
                     SVYGINQIDVRQTGSGTAQLSLLVSGMYQYKGMFVEMIHQSQDGVNLGVNLWSSEDWS
                     FDLLLANLQGSWSRPDLDPSTLDEAGRNAYLLSEDSLYIGAGFRATRYWGDNYVFQYR
                     LVSDYYDDQGIQSSARLGKSWQVRNWNFHVLGSVGYSSATLNRYLFGVSKEEATELFP
                     EYHPSSSFSYGMELGVAYPLSESFVFRAMYRFNVLSKEVTDSPFNQAGYASFFNASIS
                     YVF"
     gene            843950..844333
                     /locus_tag="SBAL_RS03790"
                     /old_locus_tag="Sbal_0748"
     CDS             843950..844333
                     /locus_tag="SBAL_RS03790"
                     /old_locus_tag="Sbal_0748"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080305.1"
                     /db_xref="GI:492988409"
                     /translation="MKRFYLWLVLLNAPFFAWGQDDSVIFTATPERCIALHKGQTCYQ
                     DVLFRWQTPTSGEYCLILTDRQHQLICWSGKAMQEYQYSFEGDKTATFSLIRNDDVQP
                     LAQVKVVVTWVYKAPKQSQSGWRLF"
     gene            844335..845039
                     /locus_tag="SBAL_RS03795"
                     /old_locus_tag="Sbal_0749"
     CDS             844335..845039
                     /locus_tag="SBAL_RS03795"
                     /old_locus_tag="Sbal_0749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_006080306.1"
                     /db_xref="GI:492988412"
                     /translation="MSVEKHILVVEDDISLAEWISDYLLDHGYEVTVASQGDFALEMI
                     AEEIPDLVLLDVMLPVKNGFDVCKEARAFYAGPILFMTACVEDGDEIRGLDVGADDYL
                     TKPIRPQVLLARIKALLRRVGDEEQKQQLVFDSLVLNATAKSVTIDKQPLDLNANEFD
                     VLWLLALKAGTIVSRNELVAQLRGIEYDGLDRSVDIRISRLRKKLQEALSQPYKVKTI
                     RGKGYLFCRDEGEQAL"
     gene            845036..846328
                     /locus_tag="SBAL_RS03800"
                     /old_locus_tag="Sbal_0750"
     CDS             845036..846328
                     /locus_tag="SBAL_RS03800"
                     /old_locus_tag="Sbal_0750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014615366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011845861.1"
                     /db_xref="GI:500171436"
                     /translation="MKKLMTSLVLVVLVAIASLGWSISEFASLLDHDNDTQTPATHLA
                     ALKLLGGTLAQTLDNDSVNNQSIIANWNQLNSEQLSLASEADFVLPSALKTAFYAGES
                     LLLESDDGISLHYLLPKTGQVLNINTDIVTPTDVSFDLNKLYTMLFYGGVVLILLVWV
                     SPLIRQLVNLSKATQAFGMGELQQRIPVRKTSYIGTIESEFNRMADRIQQLIDDNKLL
                     SRAVSHDLKTPIARLRFGIEALEETQSEQLRVKYFQRLNRDLDTMEDLVMTLLSYARL
                     DEANIQPDWQSIELNAWLLEKYQGQVYPDFSVELVSYPTALKIKTDPKYLSMQVNNLL
                     NNALRFGKAKIRLTLAVEEGATWLHVDDDGPGIDELESMQVIKPFVRGQHSRGNSGHG
                     MGLAIVDRIGYWMNAPLRIGRAPELGGARMSLKFKAEI"
     gene            complement(846506..846964)
                     /locus_tag="SBAL_RS03805"
                     /old_locus_tag="Sbal_0751"
     CDS             complement(846506..846964)
                     /locus_tag="SBAL_RS03805"
                     /old_locus_tag="Sbal_0751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006080308.1"
                     /db_xref="GI:492988418"
                     /translation="MTSIKKTFLCAGLALMLSACATSYDTEKQFWSFGKGFETAQIAP
                     DSWQI