GenomeNet

Database: RefSeq
Entry: NC_009052
LinkDB: NC_009052
Original site: NC_009052 
LOCUS       NC_009052            5127376 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Shewanella baltica OS155 chromosome, complete genome.
ACCESSION   NC_009052
VERSION     NC_009052.1  GI:126172257
DBLINK      Project: 58259
            BioProject: PRJNA58259
KEYWORDS    RefSeq.
SOURCE      Shewanella baltica OS155
  ORGANISM  Shewanella baltica OS155
            Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
            Shewanellaceae; Shewanella.
REFERENCE   1  (bases 1 to 5127376)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Sims,D.R., Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Mikhailova,N., Brettar,I., Klappenbach,J., Konstantinidis,K.,
            Rodrigues,J., Tiedje,J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of chromosome of Shewanella baltica OS155
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5127376)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-FEB-2007) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5127376)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Sims,D.R., Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Mikhailova,N., Brettar,I., Klappenbach,J., Konstantinidis,K.,
            Rodrigues,J., Tiedje,J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000563.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 3634605
            Source DNA and bacteria available from James Tiedje
            (tiedjej@msu.edu)
            Contacts: James Tiedje (tiedjej@msu.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5127376
                     /organism="Shewanella baltica OS155"
                     /mol_type="genomic DNA"
                     /strain="OS155"
                     /db_xref="taxon:325240"
     gene            41..1429
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /db_xref="GeneID:4845102"
     CDS             41..1429
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein"
                     /protein_id="YP_001048407.1"
                     /db_xref="GI:126172258"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="GeneID:4845102"
                     /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPN
                     RFVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSRPSAKKPSVPAPIAPTRVANTQ
                     TKATVGTTFNVQAEPMANANHRSNINPSYQFDNFVEGKSNQLGKAAALQVAENPGGAY
                     NPLFLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFK
                     RYYRSVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDR
                     LKSRFGWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGA
                     LNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSK
                     RRSRSVARPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIK
                     EDYANLIRTLSS"
     misc_feature    41..1426
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    50..235
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    464..895
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    539..562
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(542..565,728..730,830..832)
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    716..733
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    866..868
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1151..1420
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1220..1222,1244..1249,1268..1270,1286..1294,
                     1319..1333,1340..1342,1349..1354)
                     /gene="dnaA"
                     /locus_tag="Sbal_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1449..2549
                     /locus_tag="Sbal_0002"
                     /db_xref="GeneID:4845737"
     CDS             1449..2549
                     /locus_tag="Sbal_0002"
                     /EC_number="2.7.7.7"
                     /note="KEGG: shm:Shewmr7_0002 DNA polymerase III, beta
                     subunit;
                     TIGRFAM: DNA polymerase III, beta subunit;
                     PFAM: DNA polymerase III, beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_001048408.1"
                     /db_xref="GI:126172259"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:4845737"
                     /translation="MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKL
                     TGTDLEVELVGQVVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSG
                     RSRFSLATLPAEEYPNVEAFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLF
                     ETEGNVLRAIATDGHRLALSHRTIEAQLPEKQVIVPRKGVMEMARLLESDDLDIAIAI
                     GDNAIRATTANTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRASILSNE
                     KFRGVRIQLENGLLKITANNPEQEEAEEIIDVEYNNQALEIGFNVSYLLDVLNNLKSD
                     DVRITLIDGNSSALIENHLEEDSMYVVMPMRL"
     misc_feature    1449..2546
                     /locus_tag="Sbal_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1449..2543
                     /locus_tag="Sbal_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1518..1520,1665..1667,1686..1688,2040..2042)
                     /locus_tag="Sbal_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1668..1670,1677..1679,1755..1757,1761..1763,
                     2262..2264,2355..2360)
                     /locus_tag="Sbal_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1962..1964,1968..1979,2406..2408,2532..2543)
                     /locus_tag="Sbal_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(1962..1964,1968..1973,2187..2189,2292..2294,
                     2331..2336,2415..2417,2532..2543)
                     /locus_tag="Sbal_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2751..3833
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /db_xref="GeneID:4843454"
     CDS             2751..3833
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein F"
                     /protein_id="YP_001048409.1"
                     /db_xref="GI:126172260"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="GeneID:4843454"
                     /translation="MSLTRLNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIY
                     FLGMGRSFRSHLSQRVINNDDDKLTLFATLNLARGDSKIGLRRFRSGETEVRIDGEKV
                     KRLSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHADPQFYGAWTNVRRVLKQ
                     RNQLLRNGSAYSNIQFWDQEFVRYAEQVTEIRNHYVDSLNELLKGIIGEFLPSVDVKV
                     SFTRGWDSKTDFAELLENQYSRDLATGHTVSGPHKADLRLRVGTLPAQDALSRGQLKL
                     LVCALRIAQGKLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLTDTGAQVFVTAIDP
                     AAIVDSLHTPPSRMFHVEQGRVTVIE"
     misc_feature    2751..3821
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    2757..3821
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    2838..2861
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(2847..2852,2856..2864,3105..3107,3654..3659,
                     3747..3749)
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    3096..3107
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    3555..3584
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    3642..3659
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    3666..3677
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    3735..3755
                     /gene="recF"
                     /locus_tag="Sbal_0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            3850..6267
                     /locus_tag="Sbal_0004"
                     /db_xref="GeneID:4844777"
     CDS             3850..6267
                     /locus_tag="Sbal_0004"
                     /EC_number="5.99.1.3"
                     /note="KEGG: son:SO0011 DNA gyrase subunit B;
                     TIGRFAM: DNA gyrase, B subunit;
                     PFAM: DNA gyrase, subunit B domain protein; ATP-binding
                     region, ATPase domain protein domain protein; TOPRIM
                     domain protein; DNA topoisomerase, type IIA, subunit B,
                     region 2 domain protein;
                     SMART: DNA topoisomerase II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_001048410.1"
                     /db_xref="GI:126172261"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="GeneID:4844777"
                     /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
                     VDNSIDEALAGHCSDITITIHVDGSVSVKDDGRGIPVSIHEEEGVSAAEVIMTVLHAG
                     GKFDDNSYKVSGGLHGVGVSVVNALSKKLQMTIRRAGKVYEQFYTHGVPDAPIKEIGD
                     ATKTGTEIRFWPSEDTFSDVEFHFEILAKRVRELSFLNSGVGIRLIDERDNKNEFFKY
                     EGGISAFVDYLNRNKTPVNKDVFHFMQEREDGITVEVAMQWNDGYQENIFCFTNNIPQ
                     RDGGTHLVGFRSALTRNLNSYMENEGYNKKGKTSATGDDAREGLTAVISVKVPDPKFS
                     SQTKDKLVSSEVKTAVEQTMGEKLNDYLLENPADAKLIVGKIVDAARAREAARKAREM
                     TRRKGALDLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGK
                     ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIR
                     TLLLTFFFRQMPELIERGYVYIAQPPLFKVKKGKQEQYLKDEPALTQYLTTQALDGTI
                     VYPTQGAIGMSGEPLERLVTQYREVEAIVARLEQRYPTHITNRMLYHPMITNDMLADE
                     GKMKEWIDAFIHELVEMESSGVLYSAEPILDPERKVYLPKITIRKHGIDTNYLFTYDF
                     FQSSDYQRIGKLGAALDGMIEEGGYVQRGERVKEVGSFLEALDWTISEAKRGLYIQRY
                     KGLGEMNPEQLWETTMDPESRRMLQVTIDDAVGADQLFTCLMGDQVEPRREFIEANAL
                     NVANLDV"
     misc_feature    3850..6264
                     /locus_tag="Sbal_0004"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    3958..4257
                     /locus_tag="Sbal_0004"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(3976..3978,3988..3990,3997..3999,4063..4065,
                     4069..4071,4075..4077,4081..4086,4201..4212)
                     /locus_tag="Sbal_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    3988..3990
                     /locus_tag="Sbal_0004"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4075..4077,4081..4083,4201..4203,4207..4209)
                     /locus_tag="Sbal_0004"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4507..4983
                     /locus_tag="Sbal_0004"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    4663..4665
                     /locus_tag="Sbal_0004"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(4837..4839,4846..4851,4855..4857)
                     /locus_tag="Sbal_0004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(4855..4857,4861..4863)
                     /locus_tag="Sbal_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5104..5448
                     /locus_tag="Sbal_0004"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5122..5127,5134..5136,5344..5346,5350..5352,
                     5356..5358)
                     /locus_tag="Sbal_0004"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5122..5124,5344..5346)
                     /locus_tag="Sbal_0004"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    6037..6231
                     /locus_tag="Sbal_0004"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(6353..7015)
                     /locus_tag="Sbal_0005"
                     /db_xref="GeneID:4845147"
     CDS             complement(6353..7015)
                     /locus_tag="Sbal_0005"
                     /note="PFAM: Glutathione S-transferase, N-terminal domain;
                     KEGG: son:SO0012 glutathione S-transferase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase domain-containing
                     protein"
                     /protein_id="YP_001048411.1"
                     /db_xref="GI:126172262"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="GeneID:4845147"
                     /translation="MDLYIGNKNYSSWSLRAWLMAAKSGVQFNEVLLQLDTDSFYQQL
                     KAISPTLKVPTLVDGNITVWDSLSICEYLNDTYLAGSAWPQDPKQKAKARSIASEMHS
                     GFNAVRNALPMNIRASRYVELTDAVRKDIERIDAIWSAQMAEFAPSHAEGTWLFGQWS
                     IADMMFAPVVMRFLTYGVEVSQASSAYMQHVISCPEMQAWMSAAKAETEIVAADEAGI
                     DR"
     misc_feature    complement(6794..7012)
                     /locus_tag="Sbal_0005"
                     /note="GST_N family, unknown subfamily 1; composed of
                     uncharacterized proteins, predominantly from bacteria,
                     with similarity to GSTs. GSTs are cytosolic dimeric
                     proteins involved in cellular detoxification by catalyzing
                     the conjugation of glutathione (GSH) with...; Region:
                     GST_N_1; cd03043"
                     /db_xref="CDD:239341"
     misc_feature    complement(6389..6991)
                     /locus_tag="Sbal_0005"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    complement(order(6803..6808,6815..6817,6947..6952,
                     6959..6964,6968..6973,6977..6979))
                     /locus_tag="Sbal_0005"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239341"
     misc_feature    complement(order(6818..6823,6854..6862,6977..6979))
                     /locus_tag="Sbal_0005"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239341"
     misc_feature    complement(order(6803..6805,6812..6817,6821..6826,
                     6860..6862))
                     /locus_tag="Sbal_0005"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239341"
     misc_feature    complement(6407..6757)
                     /locus_tag="Sbal_0005"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 3 of Glutathione S-transferases; Region:
                     GST_C_3; cd03194"
                     /db_xref="CDD:198303"
     misc_feature    complement(order(6500..6502,6512..6514,6521..6526,
                     6533..6535,6725..6727,6746..6748))
                     /locus_tag="Sbal_0005"
                     /note="putative N-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198303"
     misc_feature    complement(order(6617..6619,6722..6724,6731..6736,
                     6743..6748))
                     /locus_tag="Sbal_0005"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198303"
     misc_feature    complement(order(6500..6502,6509..6511,6698..6703,
                     6710..6715,6725..6727))
                     /locus_tag="Sbal_0005"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198303"
     gene            7256..7558
                     /locus_tag="Sbal_0006"
                     /db_xref="GeneID:4845106"
     CDS             7256..7558
                     /locus_tag="Sbal_0006"
                     /note="KEGG: son:SO0714 monoheme cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="monoheme cytochrome c"
                     /protein_id="YP_001048412.1"
                     /db_xref="GI:126172263"
                     /db_xref="InterPro:IPR008169"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4845106"
                     /translation="MWLRVIYPASVLIFMLPAVVNADEANKLLNMCKACHGESGMSRF
                     EHIPNIGWQNSDYLLKQLRAFKTGNRQDPTMTKVAQLLSEADMQQMADYFYLGKDK"
     misc_feature    7280..>7537
                     /locus_tag="Sbal_0006"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            7560..8786
                     /locus_tag="Sbal_0007"
                     /db_xref="GeneID:4842223"
     CDS             7560..8786
                     /locus_tag="Sbal_0007"
                     /note="PFAM: oxidoreductase, molybdopterin binding; Mo-co
                     oxidoreductase dimerisation domain;
                     KEGG: son:SO0715 oxidoreductase, molybdopterin-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, molybdopterin binding"
                     /protein_id="YP_001048413.1"
                     /db_xref="GI:126172264"
                     /db_xref="InterPro:IPR000572"
                     /db_xref="InterPro:IPR005066"
                     /db_xref="InterPro:IPR008335"
                     /db_xref="GeneID:4842223"
                     /translation="MDLNRRVFIKGAVATSVLSALPVKWVFADQLPAAVTPLDISALT
                     WTKAEDLPSYFKVLNTHPLNAFPPEHKLAPAVTPADASFIRWNGIVPDFKALDAKTWT
                     FKVDGESVATPKTYTIDELKRRFKHYTLQLLIECGGNSRSGFFPSTKGNQWNNAGVFC
                     SEWTGVLVSDVLKDCGIKADAIYTGHHGVDRHLSGKGEAISRGVPIKAALEELGLIAW
                     SMNGEDIPYLHGYPLRIVFGGRPGSVSQKAATGISVRNKVHDGHKMEAPAYQLPKYPI
                     APGESVDNKDYRIIEEMIVKSLITEPQSGTELAVGQKMVIAGHAWAGLREVVKVEVSY
                     DYGTSWFTAELEKPKNVAAWQQWKIELQLPSQGYYEIWAKATDNQGDSQPVVQPQWNP
                     KGYMFNGCHRIVVRVV"
     misc_feature    7713..8780
                     /locus_tag="Sbal_0007"
                     /note="sulfite oxidase; Provisional; Region: PLN00177"
                     /db_xref="CDD:177772"
     misc_feature    7806..8774
                     /locus_tag="Sbal_0007"
                     /note="Subgroup of sulfite oxidase (SO) family
                     molybdopterin binding domains that contains conserved
                     dimerization domain. This molybdopterin cofactor (Moco)
                     binding domain is found in a variety of oxidoreductases,
                     main members of this family are nitrate...; Region:
                     SO_family_Moco_dimer; cd02110"
                     /db_xref="CDD:239028"
     misc_feature    order(7806..7808,7812..7814,7818..7820,7965..7967,
                     8157..8159,8244..8246,8259..8261,8283..8285,8292..8294,
                     8298..8303)
                     /locus_tag="Sbal_0007"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:239028"
     misc_feature    7965..7967
                     /locus_tag="Sbal_0007"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:239028"
     misc_feature    order(8439..8441,8532..8534,8544..8546,8550..8552,
                     8577..8579,8583..8585,8679..8681,8694..8702,8712..8714,
                     8757..8759)
                     /locus_tag="Sbal_0007"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239028"
     gene            8786..9169
                     /locus_tag="Sbal_0008"
                     /db_xref="GeneID:4843301"
     CDS             8786..9169
                     /locus_tag="Sbal_0008"
                     /note="KEGG: son:SO0716 monoheme cytochrome c, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="monoheme cytochrome c"
                     /protein_id="YP_001048414.1"
                     /db_xref="GI:126172265"
                     /db_xref="GeneID:4843301"
                     /translation="MRVLNKLFIFLGLVASSISLAAEYPVDPKSGLIMAPGWELVNYQ
                     CNACHTSMIVVQNHGDKAFWKETLQWMVDTQGLWDLSDTWEPTLSYLSTYYGQAEMDM
                     TLFRRLPLEPSLPPALVNSVSKETK"
     gene            9166..9501
                     /locus_tag="Sbal_0009"
                     /db_xref="GeneID:4842230"
     CDS             9166..9501
                     /locus_tag="Sbal_0009"
                     /note="KEGG: son:SO0717 monoheme cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="monoheme cytochrome c"
                     /protein_id="YP_001048415.1"
                     /db_xref="GI:126172266"
                     /db_xref="InterPro:IPR008169"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4842230"
                     /translation="MKALIISLIALCGLSTEVFGEVYQADSERGQALATAQCESCHGN
                     AVIAMAKQFPNLKGQKFAYLNKQLVDFKAGLRLDPLMQAQVSALSSEQLQDVALFYSQ
                     QVTPNLSAN"
     misc_feature    9166..9474
                     /locus_tag="Sbal_0009"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     misc_feature    <9235..9486
                     /locus_tag="Sbal_0009"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     gene            complement(9592..10512)
                     /locus_tag="Sbal_0010"
                     /db_xref="GeneID:4842231"
     CDS             complement(9592..10512)
                     /locus_tag="Sbal_0010"
                     /note="TIGRFAM: urea amidolyase related protein;
                     PFAM: Allophanate hydrolase subunit 2;
                     KEGG: saz:Sama_0022 UreA carboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="urea amidolyase-like protein"
                     /protein_id="YP_001048416.1"
                     /db_xref="GI:126172267"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="GeneID:4842231"
                     /translation="MIEVIKAGALTTVQDLGRMGYRHLGVTQAGALDRPALCLANRLL
                     SNPDNTPVLELTFGQSIFLFKRDAWIALTGADFDARIDNKPIVCGWRYSIKAGQKLSL
                     RGGNKGMRAYIAVDGGVKVPLVMNSAATDLTSGIGGFHGRALEAGDRLTLGSAHPLRR
                     QVGAIQKSWDGHIRALATKHTQAFSLKSQQTFWQTQWQLSAESDRASAILKGDTLTLA
                     KPFPVQSHTVTPGVVQVSASGQPLVLLADAQTTSSHPQIAVIIEADLWKLAQTRPGQT
                     VKFELVDDEQAATAQAEWHDYFYRLQRSLG"
     misc_feature    complement(9598..10509)
                     /locus_tag="Sbal_0010"
                     /note="Allophanate hydrolase subunit 2 [Amino acid
                     transport and metabolism]; Region: DUR1; COG1984"
                     /db_xref="CDD:224895"
     gene            10846..11886
                     /locus_tag="Sbal_0011"
                     /db_xref="GeneID:4845286"
     CDS             10846..11886
                     /locus_tag="Sbal_0011"
                     /note="PFAM: HDOD;
                     KEGG: shn:Shewana3_0015 putative signal transduction
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein"
                     /protein_id="YP_001048417.1"
                     /db_xref="GI:126172268"
                     /db_xref="InterPro:IPR013976"
                     /db_xref="GeneID:4845286"
                     /translation="MIKSLFNKLFNIRDTATVERPKSFSTTDLGKSLEPARKPAKPLE
                     DISVVSVDLAALFYSLSFPTRVKDTGGVANNLERRVMAEIEQALASPQVIAEKVLKLP
                     SKVLELDRKLADPQFDIKDLLALIERDPLLSIEVLKLCNSPAFKRSDRDITSLQQALV
                     QLGREQLRKFVTTCLVREMLDIKPIYFRRFGAEIWRHSMQVAFLASELSDEDQDTAFL
                     LGLLHDVGKLAIFKMLLDAFVQAEPGEQPNSGLFRQVMTTKSLTLSSLLAKHWQLPNT
                     FETELDKLASVNSRPQAGLAAVIWRANVISEISMLHQAGQLSPEILANLLQQVNLDQT
                     QFDGLHQKLTQF"
     misc_feature    11062..>11667
                     /locus_tag="Sbal_0011"
                     /note="Predicted signal transduction protein [Signal
                     transduction mechanisms]; Region: COG1639"
                     /db_xref="CDD:224554"
     misc_feature    11428..>11535
                     /locus_tag="Sbal_0011"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(11434..11436,11512..11517)
                     /locus_tag="Sbal_0011"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    11515..11517
                     /locus_tag="Sbal_0011"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(11974..14043)
                     /gene="glyS"
                     /locus_tag="Sbal_0012"
                     /db_xref="GeneID:4842061"
     CDS             complement(11974..14043)
                     /gene="glyS"
                     /locus_tag="Sbal_0012"
                     /EC_number="6.1.1.14"
                     /note="glycine--tRNA ligase beta chain; glyS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking the carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="YP_001048418.1"
                     /db_xref="GI:126172269"
                     /db_xref="InterPro:IPR002311"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="GeneID:4842061"
                     /translation="MNFENLLIELGTEELPPKSLRKLAESFLANLTEELTKADLAFSS
                     AVWYAAPRRLAINVTELALAQADKVVEKRGPAVSSAFDAEGKPTKAAEGWARGNGITV
                     EQAERLVTDKGEWLVHNAKVEGVETKNLIAAMAQRALDKLPIPKPMRWGNNKTQFIRP
                     VHTATMLLGSELIEGELLGIKSARTVRGHRFMGLKQFELAHADHYLTDLKEKGKVIAD
                     YESRKALIKADAEKAAAKIGGTADIEDSLLEEVASLVEWPVVLTASFEEKFLSVPSEA
                     LVYTMKGDQKYFPVFDDAGKLLPNFIFVTNIESKDPAQIISGNEKVVRPRLADAEFFF
                     NTDKKHTLESRLPSLETVLFQQQLGTLKDKVNRISALAAFIAEQTGANAVDAARAGLL
                     SKTDLMTNMVMEFTDTQGTMGMHYARLDGETEAVAVAMEEQYKPRFSGDTVPSAGVSC
                     AVALADKLDTLVGIFGIGQAPKGAADPFALRRAAIGVLRIIVENKLPLDLVDLITKAQ
                     ALHGTNLSNANASDEVLEFLMARFRAWYQDKGIGVDVILAVLARRPTRPADFDSRINA
                     VSHFRSLEASSALAAANKRVSNILAKVEGALPTTINASLLTEAAEQALAAKLNELQPL
                     LAPLFANADYQQALTLLAGLRESVDQFFEDVMVMADDEALKNNRLALLNNLREQFLHV
                     ADISLLQ"
     misc_feature    complement(11977..14031)
                     /gene="glyS"
                     /locus_tag="Sbal_0012"
                     /note="glycyl-tRNA synthetase subunit beta; Validated;
                     Region: glyS; PRK01233"
                     /db_xref="CDD:234925"
     misc_feature    complement(12385..14028)
                     /gene="glyS"
                     /locus_tag="Sbal_0012"
                     /note="Glycyl-tRNA synthetase beta subunit; Region:
                     tRNA_synt_2f; pfam02092"
                     /db_xref="CDD:251082"
     misc_feature    complement(<12058..12291)
                     /gene="glyS"
                     /locus_tag="Sbal_0012"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     gene            complement(14054..14959)
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /db_xref="GeneID:4843423"
     CDS             complement(14054..14959)
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /EC_number="6.1.1.14"
                     /note="glycine--tRNA ligase alpha chain; GlyRS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_001048419.1"
                     /db_xref="GI:126172270"
                     /db_xref="InterPro:IPR002310"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="GeneID:4843423"
                     /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQ
                     TFLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGS
                     LQALGIDTQIHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPV
                     TGEITYGLERLAMYIQGVDSVYDLVWTDGPLGRITYGDVFHQNEVEQSTYNFEHADVD
                     FMFTLFDQCEKMCQHLLSLEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILR
                     VRTMAKAVAESYYQAREALGFPMCK"
     misc_feature    complement(14081..14935)
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /note="Class II Glycyl-tRNA synthetase (GlyRS) alpha
                     subunit core catalytic domain. GlyRS functions as a
                     homodimer in eukaryotes, archaea and some bacteria and as
                     a heterotetramer in the remainder of prokaryotes and in
                     arabidopsis. It is responsible for the...; Region:
                     GlyRS_alpha_core; cd00733"
                     /db_xref="CDD:238375"
     misc_feature    complement(order(14207..14209,14219..14221,14228..14239,
                     14249..14251,14261..14263,14270..14272,14279..14284,
                     14291..14296,14303..14305,14312..14314,14318..14320,
                     14339..14344,14351..14353,14402..14404,14720..14722,
                     14768..14770,14780..14782,14807..14809,14855..14866,
                     14870..14872,14876..14881,14903..14905,14915..14917,
                     14927..14929))
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(14861..14884)
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /note="motif 1; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(order(14450..14455,14459..14464,14468..14473,
                     14519..14521,14531..14536,14699..14707,14711..14713,
                     14717..14719,14765..14767,14840..14842,14846..14848))
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /note="active site"
                     /db_xref="CDD:238375"
     misc_feature    complement(14759..14770)
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /note="motif 2; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(14450..14461)
                     /gene="glyQ"
                     /locus_tag="Sbal_0013"
                     /note="motif 3; other site"
                     /db_xref="CDD:238375"
     gene            15077..15691
                     /locus_tag="Sbal_0014"
                     /db_xref="GeneID:4842746"
     CDS             15077..15691
                     /locus_tag="Sbal_0014"
                     /EC_number="3.2.2.20"
                     /note="KEGG: shn:Shewana3_0018 DNA-3-methyladenine
                     glycosylase I;
                     TIGRFAM: DNA-3-methyladenine glycosylase I;
                     PFAM: methyladenine glycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="YP_001048420.1"
                     /db_xref="GI:126172271"
                     /db_xref="InterPro:IPR004597"
                     /db_xref="InterPro:IPR005019"
                     /db_xref="GeneID:4842746"
                     /translation="MEEIRCGWVSDDPLYREYHDKVWGRPVYDPKELFAKLCLDGQQA
                     GLSWITILKKQQNYEQAFANFEPEVIAGFDEAKVEELMLNPGIVRNRLKVNSIIKNAK
                     GYLVYTADGKDFSAFLWSFVGGKPIVNQFTAMSQVPAQTPESEAMSKALKKLGFNFVG
                     STICYAFMQAVGMVNDHLVECISYQACVDSCAGQHHREHQYSSC"
     misc_feature    15098..15631
                     /locus_tag="Sbal_0014"
                     /note="Methyladenine glycosylase; Region: Adenine_glyco;
                     pfam03352"
                     /db_xref="CDD:251892"
     gene            complement(15877..17673)
                     /locus_tag="Sbal_0015"
                     /db_xref="GeneID:4844474"
     CDS             complement(15877..17673)
                     /locus_tag="Sbal_0015"
                     /note="PFAM: amidohydrolase;
                     KEGG: shn:Shewana3_0019 amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_001048421.1"
                     /db_xref="GI:126172272"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011550"
                     /db_xref="GeneID:4844474"
                     /translation="MVYRKTQGGNLTPRTWSQEPGLYKVDIKGKQNKKISADGYQAQF
                     GANADRVFFMNSSEDETPQLSSINLDGFDKRVHYSSKHATEFRVSPDGEQLAFAERFK
                     VWVTPFAKHGETVEIGPNANNLPVSQLSVRAGESISWNSKSNQLYWTLGPELYQAKVD
                     TQYLNKDEKAQPSIINLGFTEKADVPRGTIAFVGGKVITMENDQVIDNGVVIVKDNHI
                     VAVGDANIAIPKDAQIIDIKGKSIMPGLFDAHAHGQQADDEIVPQQNWALYSGLSLGV
                     TTIHDPSNDTTEIFAASEQQKAGHIVGPRIFSTGTILYGANAPGYTSHIDSLDDAKFH
                     LERLKKVGAFSVKSYNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMVADGHTT
                     VEHSLPVAAIYNDIKQFWSQTKVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYV
                     PADILQARSMRRPHAPDGHYNHFNVAKVANELNKLGVHPNIGAHGQREGLAAHWEMWM
                     FAQGGMSNMEVLKTATINPATTFGMEQQLGSIKAGKLADLIVIDGDPLADIRVTDKVT
                     YTMVNGKLFNAETMNELNGDKEKRKPFFFEKI"
     misc_feature    complement(15949..17121)
                     /locus_tag="Sbal_0015"
                     /note="Imidazolonepropionase and related amidohydrolases
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: HutI; COG1228"
                     /db_xref="CDD:224149"
     misc_feature    complement(<16909..17064)
                     /locus_tag="Sbal_0015"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(15988..16980)
                     /locus_tag="Sbal_0015"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(order(16204..16206,16489..16491,16510..16512,
                     16918..16920,16924..16926))
                     /locus_tag="Sbal_0015"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(17727..19064)
                     /locus_tag="Sbal_0016"
                     /db_xref="GeneID:4842453"
     CDS             complement(17727..19064)
                     /locus_tag="Sbal_0016"
                     /note="PFAM: WD40 domain protein beta Propeller;
                     KEGG: she:Shewmr4_0011 amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="WD40 domain-containing protein"
                     /protein_id="YP_001048422.1"
                     /db_xref="GI:126172273"
                     /db_xref="InterPro:IPR011659"
                     /db_xref="GeneID:4842453"
                     /translation="MLKSKLTPLYIALALGMNTLAVNAAETKETEWNVNAPANAPLEQ
                     VKIDVNEGTWMNLSVSPDGKHIVFDLLGDIYQIPVSGGEAKPLAQGIAWQMQPVYSPD
                     GKHIAFTSDGDGGDNIWIMDADGSNPRTVTQETFRLLNSPAWSPDSQYLVARKHFTAS
                     RSLGAGEVWLYHVAGGEGVKLTERPNDQKDLGEPAYSPDGRYIYFSQDDTPGKTFHYS
                     KDSVNGIYKIKRYDTQTGDIEILIEGTGGAIRPTPSPDGTKLAYIKRDDFNSSLYLLD
                     LKSGETTKLFGELDRDMQETWAIHGVYPTMAWTQDNKDIFFWAKGKINRLNVASKTLT
                     DIPFSVKTELAVQPSVRFKQDIDKDVFDVKMLRMAQVSPDGSKVAFEALGKIWLKSLP
                     DGKMSRLTELNNGVEELYPQWSRDGKNIVFTTWNDQEQGTVQVLVPKVANLSS"
     misc_feature    complement(18705..>18791)
                     /locus_tag="Sbal_0016"
                     /note="WD40-like Beta Propeller Repeat; Region: PD40;
                     pfam07676"
                     /db_xref="CDD:203719"
     misc_feature    complement(17775..>18755)
                     /locus_tag="Sbal_0016"
                     /note="tol-pal system beta propeller repeat protein TolB;
                     Region: propeller_TolB; TIGR02800"
                     /db_xref="CDD:234019"
     gene            complement(19327..19773)
                     /locus_tag="Sbal_0017"
                     /db_xref="GeneID:4844092"
     CDS             complement(19327..19773)
                     /locus_tag="Sbal_0017"
                     /note="KEGG: she:Shewmr4_0012 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048423.1"
                     /db_xref="GI:126172274"
                     /db_xref="GeneID:4844092"
                     /translation="MPKLLAIAYKTVKRGPMNEVLCANVTQLSGVEKDVFGRPGKRQV
                     TVLSKIQWQQACHSIEADLPWTTRRANLLVDDLVFSSADVGKHLQIGELRLEITGETD
                     PCKKMEIAHVGLETALTPDWRGGVTCRVLNDAMIHLGDEITLVNPS"
     misc_feature    complement(19342..19689)
                     /locus_tag="Sbal_0017"
                     /note="MOSC domain; Region: MOSC; pfam03473"
                     /db_xref="CDD:251984"
     gene            complement(19822..20067)
                     /locus_tag="Sbal_0018"
                     /db_xref="GeneID:4842222"
     CDS             complement(19822..20067)
                     /locus_tag="Sbal_0018"
                     /note="TusA; transfers sulfur to TusBCD complex; involved
                     in thiouridation of U34 position of some tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur transfer protein SirA"
                     /protein_id="YP_001048424.1"
                     /db_xref="GI:126172275"
                     /db_xref="InterPro:IPR001455"
                     /db_xref="GeneID:4842222"
                     /translation="MNDAFSTAQHRLDALGLRCPEPVMMVRKTVRQMAAGETLLIIAD
                     DPATTRDIPSFCEFMDHTLIASETTQTPYQYLIKKGL"
     misc_feature    complement(19831..20034)
                     /locus_tag="Sbal_0018"
                     /note="SirA (also known as UvrY,  and YhhP) belongs to a
                     family of two-component response regulators that controls
                     secondary metabolism and virulence. The other member of
                     this two-component system is a sensor kinase called BarA
                     which phosphorylates SirA.  A...; Region: SirA; cd03423"
                     /db_xref="CDD:239515"
     misc_feature    complement(order(19996..19998,20002..20013,20020..20022,
                     20029..20034))
                     /locus_tag="Sbal_0018"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:239515"
     gene            complement(20238..21400)
                     /locus_tag="Sbal_0019"
                     /pseudo
                     /db_xref="GeneID:4843305"
     gene            complement(21644..22807)
                     /gene="fadA"
                     /locus_tag="Sbal_0020"
                     /db_xref="GeneID:4842348"
     CDS             complement(21644..22807)
                     /gene="fadA"
                     /locus_tag="Sbal_0020"
                     /EC_number="2.3.1.16"
                     /note="FadA; fatty acid oxidation complex component beta;
                     functions in a heterotetramer with FadB; similar to
                     FadI2J2 complex; functions in beta-oxidation of fatty
                     acids"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="YP_001048425.1"
                     /db_xref="GI:126172276"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR012805"
                     /db_xref="GeneID:4842348"
                     /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKGLLLRNPQ
                     LDPNLIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDAIHQAA
                     RAIMTGMGDTFIIGGVEHMGHVPMSHGVDFHPGLANKVAKASGMMGLTAEMLGKLHGI
                     TREQQDAFAVRSHQRAYAATVEGRFAKEIYGIEGHDANGALIKVLQDEVIRPETTMES
                     LAALRPVFDPVNGTVTAGTSSALSDGASAMLIMEESKARALGLPIRARIRSMAVAGCD
                     AAIMGYGPVPATQKALARAGITVADLDVIELNEAFAAQSLPCVKDLGLADVVDDKINL
                     NGGAIALGHPLGCSGARISTTLINLMEDKDATLGLATMCIGLGQGIATVFERV"
     misc_feature    complement(21647..22807)
                     /gene="fadA"
                     /locus_tag="Sbal_0020"
                     /note="3-ketoacyl-CoA thiolase; Reviewed; Region: fadA;
                     PRK08947"
                     /db_xref="CDD:181592"
     misc_feature    complement(21650..22795)
                     /gene="fadA"
                     /locus_tag="Sbal_0020"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(21677..21682,21926..21928,21986..21988,
                     21992..21994,21998..22000,22442..22444,22487..22489,
                     22496..22501,22520..22522,22544..22555,22586..22588,
                     22598..22600,22607..22609,22652..22654,22736..22738))
                     /gene="fadA"
                     /locus_tag="Sbal_0020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(21689..21691,21779..21781,22535..22537))
                     /gene="fadA"
                     /locus_tag="Sbal_0020"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(22830..24980)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /db_xref="GeneID:4844296"
     CDS             complement(22830..24980)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /EC_number="1.1.1.35"
                     /EC_number="4.2.1.17"
                     /EC_number="5.1.2.3"
                     /EC_number="5.3.3.8"
                     /note="includes enoyl-CoA hydratase,
                     delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase,
                     3-hydroxyacyl-CoA dehydrogenase, and 3-hydroxybutyryl-CoA
                     epimerase; catalyzes the formation of an hydroxyacyl-CoA
                     by addition of water on enoyl-CoA; also exhibits
                     3-hydroxyacyl-CoA epimerase and 3-hydroxyacyl-CoA
                     dehydrogenase activities; forms a heterotetramer with
                     FadA; similar to FadI2J2 complex; functions in
                     beta-oxidation of fatty acids"
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional fatty acid oxidation complex
                     subunit alpha"
                     /protein_id="YP_001048426.1"
                     /db_xref="GI:126172277"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="InterPro:IPR006180"
                     /db_xref="InterPro:IPR012799"
                     /db_xref="GeneID:4844296"
                     /translation="MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLTSLDAALD
                     SIKQDSNIKALVLTSSKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLP
                     FPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGA
                     DNALEWITTGKDQRAEDALKVGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRK
                     LSALTLPKLEAMMSFTTAKGMVFAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQA
                     FIKLAKTDVAKALIGIFLNDQFVKGKAKKAGKLAKEVNNAAVLGAGIMGGGIAYQSAS
                     KGTPIVMKDIAQPALDLGLNEAAKLLSAQVARGRSTPEKMAKVLNNITPSLDYAAIKH
                     SDVVVEAVVEHPKIKAQVLAEVEGYVSEDAIIASNTSTISINLLAKSMKKPERFCGMH
                     FFNPVHKMPLVEIIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFA
                     GFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGK
                     SGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKPKKDVDPTSYGLLKDAFGELKAFEA
                     DDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVYGLGFPPFRGGVFRYLDTMGVAN
                     FVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA"
     misc_feature    complement(22836..24980)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="multifunctional fatty acid oxidation complex
                     subunit alpha; Reviewed; Region: fadB; PRK11730"
                     /db_xref="CDD:183293"
     misc_feature    complement(24372..24959)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(24555..24557,24564..24569,24633..24641,
                     24645..24647,24771..24785,24795..24797,24891..24893,
                     24897..24899))
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(24633..24635,24777..24779))
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(24372..24374,24381..24383,24426..24428,
                     24435..24437,24468..24470,24477..24482,24486..24491,
                     24495..24500,24513..24518,24522..24530,24534..24536,
                     24552..24563,24597..24608,24669..24671,24693..24695))
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(23499..23993)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    complement(23205..23495)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     misc_feature    complement(<22869..23102)
                     /gene="fadB"
                     /locus_tag="Sbal_0021"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            25471..26793
                     /locus_tag="Sbal_0022"
                     /db_xref="GeneID:4843687"
     CDS             25471..26793
                     /locus_tag="Sbal_0022"
                     /EC_number="3.4.13.9"
                     /note="catalyzes the hydrolysis of dipeptides with a
                     proline at the C-terminal; also catalyzes the low
                     efficiency hydrolysis of organophosphate di- and
                     tri-esters"
                     /codon_start=1
                     /transl_table=11
                     /product="proline dipeptidase"
                     /protein_id="YP_001048427.1"
                     /db_xref="GI:126172278"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="GeneID:4843687"
                     /translation="MDQLAHHYRAHIAELNRRVAEILSREALSGLVIHSGQPHRMFLD
                     DINYPFKANPHFKAWLPVLDNPNCWLVVNGRDKPQLIFYRPVDFWHKVSDVPDMFWTE
                     YFDIKLLTKADKVAEFLPTDIANWAYLGEHLDVAEVLGFTSRNPDAVMSYLHYHRTTK
                     TEYELECMRRANQIAVQGHLAAKNAFYNGASEFEIQQHYLSAVGQSENEVPYGNIIAL
                     NQNAAILHYTALEHQSPAKRLSFLIDAGASYFGYASDITRTYAFEKNRFDELITAMNK
                     AQLELIDMMRPGVRYPDLHLATHAKVAQMLLDFDLATGDVQGLVDQGITSAFFPHGLG
                     HMLGLQVHDVGGFSHDERGTHIAAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNE
                     LKQDNRGQQINWQTVDELRPFGGIRIEDNVIVHQDRNENMTRKLGLTD"
     misc_feature    25471..26784
                     /locus_tag="Sbal_0022"
                     /note="proline dipeptidase; Provisional; Region: PRK13607"
                     /db_xref="CDD:237444"
     misc_feature    25519..>25731
                     /locus_tag="Sbal_0022"
                     /note="Aminopeptidase P, N-terminal domain; Region: AMP_N;
                     cl08433"
                     /db_xref="CDD:263653"
     misc_feature    25963..26772
                     /locus_tag="Sbal_0022"
                     /note="Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro
                     dipeptidase, X-Pro dipeptidase, proline dipeptidase.,
                     imidodipeptidase, peptidase D, gamma-peptidase. Catalyses
                     hydrolysis of Xaa-Pro dipeptides; also acts on
                     aminoacyl-hydroxyproline analogs. No action on...; Region:
                     Prolidase; cd01087"
                     /db_xref="CDD:238520"
     misc_feature    order(26146..26148,26200..26202,26233..26235,26473..26475,
                     26608..26610,26725..26727)
                     /locus_tag="Sbal_0022"
                     /note="active site"
                     /db_xref="CDD:238520"
     gene            26821..27351
                     /locus_tag="Sbal_0023"
                     /db_xref="GeneID:4843455"
     CDS             26821..27351
                     /locus_tag="Sbal_0023"
                     /note="PFAM: protein of unknown function UPF0029;
                     KEGG: she:Shewmr4_0020 protein of unknown function
                     UPF0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048428.1"
                     /db_xref="GI:126172279"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="GeneID:4843455"
                     /translation="MLESYSVPCEAIVIEEEIKHSRFISFLFHCDSFDKFKLVLTDIK
                     RDYPGASHYCSAFVAGAPNDSVLIGSSDDGEPAGSAGRPMLAVLQGANIGEVGAVVVR
                     YYGGTKLGVGGLVRAYTSGLRQGLVQLPTRLKQLRYPAKLHCDYAQLRDVEHLLQQVD
                     AVIIDKQFAEAVDIVF"
     misc_feature    26872..27198
                     /locus_tag="Sbal_0023"
                     /note="Uncharacterized protein family UPF0029; Region:
                     UPF0029; pfam01205"
                     /db_xref="CDD:250442"
     misc_feature    27244..>27348
                     /locus_tag="Sbal_0023"
                     /note="Domain of unknown function (DUF1949); Region:
                     DUF1949; pfam09186"
                     /db_xref="CDD:255222"
     gene            27513..28970
                     /locus_tag="Sbal_0024"
                     /db_xref="GeneID:4845724"
     CDS             27513..28970
                     /locus_tag="Sbal_0024"
                     /note="TIGRFAM: potassium uptake protein, TrkH family;
                     PFAM: cation transporter;
                     KEGG: shn:Shewana3_0027 potassium uptake protein, TrkH
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkH family potassium uptake protein"
                     /protein_id="YP_001048429.1"
                     /db_xref="GI:126172280"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004772"
                     /db_xref="GeneID:4845724"
                     /translation="MQYKTIIRIIGLLIGLFSITMLPPALIAVWYNDGGGTAFMQAFF
                     VSLFIGFWLWYPNRHCKEELRTREGFLIVVLFWTVLGSIGALPFIFSSQPDLSWTDSF
                     FESFSALTTTGATVIVGLDFLPKAILFYRHMLQWLGGMGIIVLAVAILPVLGVGGMQL
                     YRAEIPGPVKDSKMTPRIAETAKALWYIYLLLTISCATAYWLAGMSVFDAVCHSFSTI
                     AIGGFSTHDASMGYFDSSVINLICVFFLIVSAVNFSVHFAAFSRRGINVRVYFKDAEF
                     KMLVAIQLILTAICFLTLYHSGIYDSPEETLDHALFQAVSVATTAGFGTESFHMWPLF
                     LPILLIFSSFIGGCGGSTAGGIKVIRVILLLLQGSRELKRLVHPKAMFSIRIGSKALP
                     DRVVDAVWGFFSAYALVFVICMLALMAMGLDDITAFSATAACLNNLGPGLGAVASNYA
                     SIGDGAKWVLVAAMLFGRLEVFTLLILFTPTFWKN"
     misc_feature    27513..28967
                     /locus_tag="Sbal_0024"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     misc_feature    27561..28964
                     /locus_tag="Sbal_0024"
                     /note="Trk-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: TrkG;
                     COG0168"
                     /db_xref="CDD:223246"
     gene            28973..29497
                     /locus_tag="Sbal_0025"
                     /db_xref="GeneID:4842520"
     CDS             28973..29497
                     /locus_tag="Sbal_0025"
                     /EC_number="1.3.3.4"
                     /note="KEGG: shn:Shewana3_0028 protoporphyrinogen oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_001048430.1"
                     /db_xref="GI:126172281"
                     /db_xref="GeneID:4842520"
                     /translation="MQTLIIYSTIDGQTLAICQKMKTIAEQAGEQVALVTLEQADALS
                     LADFDKVLIGASIRYGKHRPELYQFVNRHHAVLDTKINGFFTVNVVARKPLKNTPETN
                     PYMQKFLQLSLWQPQLLEVFAGKIDYPKYGFFDRTMIRFIMWMTKGPTDITGTFEFTD
                     WEKVDAFGNRFSQH"
     misc_feature    28973..29491
                     /locus_tag="Sbal_0025"
                     /note="Flavodoxin domain; Region: Flavodoxin_5; cl17428"
                     /db_xref="CDD:266676"
     gene            complement(29560..29868)
                     /locus_tag="Sbal_0026"
                     /db_xref="GeneID:4845341"
     CDS             complement(29560..29868)
                     /locus_tag="Sbal_0026"
                     /note="PFAM: regulatory protein, ArsR;
                     KEGG: shn:Shewana3_0029 transcriptional regulator, ArsR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein ArsR"
                     /protein_id="YP_001048431.1"
                     /db_xref="GI:126172282"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="GeneID:4845341"
                     /translation="MQNDIDVAAMVTNAESAAKWLKAIANPYRLMILCLLLDKELSVT
                     ELNATVPLSQSALSQHLAVLRAEDLVDTRKSSQIVYYKLKNEQVTQVISILHSRYCAV
                     "
     misc_feature    complement(29617..29808)
                     /locus_tag="Sbal_0026"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(29665..29667,29755..29757,29764..29769,
                     29776..29781,29788..29790,29797..29799,29803..29808))
                     /locus_tag="Sbal_0026"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(29626..29634,29647..29655,29671..29676,
                     29680..29685,29692..29697,29701..29712,29737..29745,
                     29782..29790,29800..29805))
                     /locus_tag="Sbal_0026"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(29734..29736,29743..29745))
                     /locus_tag="Sbal_0026"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            30069..30620
                     /locus_tag="Sbal_0027"
                     /db_xref="GeneID:4842722"
     CDS             30069..30620
                     /locus_tag="Sbal_0027"
                     /EC_number="1.3.3.4"
                     /note="KEGG: shn:Shewana3_0030 protoporphyrinogen oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_001048432.1"
                     /db_xref="GI:126172283"
                     /db_xref="InterPro:IPR001226"
                     /db_xref="GeneID:4842722"
                     /translation="MTRVLVLYFTRGGHTAKIANAIADQLTFRGAKVDLVDINSAAAT
                     CINWPDYEVVALGACVLYGTYDKSVFKFIEQHAEALGALPNSFFCVNVVARNPEKRIP
                     ENNKYLQKFIALSPWTPADLKIIAGKVDYPSWPWYDRLMIQLIMKMTKGPTDPKSVID
                     YTDWADVKVYADHLLELVDVTAI"
     misc_feature    30075..30605
                     /locus_tag="Sbal_0027"
                     /note="Flavodoxin domain; Region: Flavodoxin_5; cl17428"
                     /db_xref="CDD:266676"
     gene            complement(30655..32097)
                     /locus_tag="Sbal_0028"
                     /db_xref="GeneID:4841387"
     CDS             complement(30655..32097)
                     /locus_tag="Sbal_0028"
                     /note="TIGRFAM: potassium uptake protein, TrkH family;
                     PFAM: cation transporter;
                     KEGG: shm:Shewmr7_0023 potassium uptake protein, TrkH
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkH family potassium uptake protein"
                     /protein_id="YP_001048433.1"
                     /db_xref="GI:126172284"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004772"
                     /db_xref="GeneID:4841387"
                     /translation="MLNFRPLLFILGLFLSMLTAFMLIPLLLAVFNAEETVGSFMLSA
                     LVTGISASLCLHNGQSKTINLNIRDMFLLTSLTWLIVSLFAAMPFTLYHGIGYTDAFF
                     ETMSGITTTGSTVLSGLDTMDHSILIWRSLLQWLGGIGFIVMAVAILPFLNVGGMRLF
                     RTESSDWSDKAVPRTQSMAKYLFFIYILLTVACCVAYHLAGMTWFQAINHAMTTLSTG
                     GYSTSDSSMAAFSHSAHWVGVFFMAAGGLPLLMFVHTIQQRDLRIWNDAQVKGFLFFL
                     TFVSCSIGFWLWQTRDIELLDALRLSSFNVVSVVTTTGYGLTDYGAWGAFANIAFMFL
                     MFVGSCSGSTSGGIKIFRFQIAGAIMREQLKQQCHPNGIFRERYNNRIISEDIVRSLI
                     TFVLLFVMVIVGLSVILVLTGLDPMTSFTGAITAVTNVGPGLGPIIGPAGNFSTLPDV
                     AKWALSLGMLLGRLEILTVAVLFHPSFWKY"
     misc_feature    complement(30661..32094)
                     /locus_tag="Sbal_0028"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     misc_feature    complement(30661..32091)
                     /locus_tag="Sbal_0028"
                     /note="Trk-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: TrkG;
                     COG0168"
                     /db_xref="CDD:223246"
     gene            complement(32118..33527)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /db_xref="GeneID:4843037"
     CDS             complement(32118..33527)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="YP_001048434.1"
                     /db_xref="GI:126172285"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006036"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="GeneID:4843037"
                     /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDHDKSRLRALQDKYD
                     LRVVAGHAAHPDVLREAGAEDADMLIAVTNSDECNMAACQIAYTLFGTPTKIARIRSE
                     PYLAMRDKLFIDSETKNSDGRPRGGFVIDELIAPEQLVTAYIQRLVEYPGALQVLEFA
                     EGRLSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADD
                     EVFFVADSRHIRAVMSEMQKLDNSYRNIMIAGGGNIGLGLAKRLERTHSVKLIEHKYE
                     RAEALSEQLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMSALLAKRMGA
                     KKVMVLIQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAI
                     EAIAHGDASTSKVVGKAIGDIKLPPGTTIGAIVRNDEVLMAHDKTVIEQGDHVILFLV
                     NKKFVGEVEKLFQPSAFFF"
     misc_feature    complement(32127..33527)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /note="potassium transporter peripheral membrane
                     component; Reviewed; Region: trkA; PRK09496"
                     /db_xref="CDD:236541"
     misc_feature    complement(33186..33521)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(32832..33032)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(32445..32792)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(32184..32327)
                     /gene="trkA"
                     /locus_tag="Sbal_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(33543..34829)
                     /locus_tag="Sbal_0030"
                     /db_xref="GeneID:4842806"
     CDS             complement(33543..34829)
                     /locus_tag="Sbal_0030"
                     /note="TIGRFAM: sun protein;
                     PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44;
                     KEGG: shn:Shewana3_0033 sun protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sun protein"
                     /protein_id="YP_001048435.1"
                     /db_xref="GI:126172286"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR004573"
                     /db_xref="InterPro:IPR006027"
                     /db_xref="InterPro:IPR006174"
                     /db_xref="GeneID:4842806"
                     /translation="MNLRALAAKAIFEVLEKGVSLSVALPDQQKHLASGKDKALLAEL
                     CYGVMRTLPQIEKRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAEA
                     CRQLKFEGMVKVVNGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDII
                     QQSHERPPMWLRNNRLSQSRAEYLAALAELEIEASEGSSADAILLAHPKDVATLPRFH
                     EGAASVQDGAAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKR
                     LERVQQNLDRLSLKAELIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWL
                     RKNHDIEELAELQQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLERTADAKL
                     DTLSQQNSPQDIGWQITPGQDNMDGFYYARLLKATD"
     misc_feature    complement(33552..34829)
                     /locus_tag="Sbal_0030"
                     /note="16S rRNA methyltransferase B; Provisional; Region:
                     PRK10901"
                     /db_xref="CDD:236790"
     misc_feature    complement(34455..34829)
                     /locus_tag="Sbal_0030"
                     /note="RNA binding domain of NusB (N protein-Utilization
                     Substance B) and Sun (also known as RrmB or Fmu) proteins.
                     This family includes two orthologous groups exemplified by
                     the transcription termination factor NusB and the
                     N-terminal domain of the...; Region: NusB_Sun; cl00223"
                     /db_xref="CDD:260276"
     misc_feature    complement(34818..34826)
                     /locus_tag="Sbal_0030"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238253"
     misc_feature    complement(33732..34100)
                     /locus_tag="Sbal_0030"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(33882..33884,33936..33944,34014..34019,
                     34071..34091))
                     /locus_tag="Sbal_0030"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(34831..35787)
                     /locus_tag="Sbal_0031"
                     /db_xref="GeneID:4842408"
     CDS             complement(34831..35787)
                     /locus_tag="Sbal_0031"
                     /note="TIGRFAM: methionyl-tRNA formyltransferase;
                     PFAM: formyl transferase domain protein;
                     KEGG: shm:Shewmr7_0026 methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_001048436.1"
                     /db_xref="GI:126172287"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="GeneID:4842408"
                     /translation="MKPLNIIFAGTPDFAARHLQALLNSHHNVIGVYTQPDRPAGRGK
                     KLTASPVKELAVANNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTP
                     RLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTTLPIED
                     SDTSASLYEKLAEQGPVALLQALEGLANGTLAAEKQDEALANYAEKLSKEEARLDWNK
                     SAQQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSETTSTAAPGTIISASKKGIEVAT
                     ADGVLTLLNMQLPGKKPLNVADILNARGEWFSPNTRLANEAQ"
     misc_feature    complement(34846..35778)
                     /locus_tag="Sbal_0031"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    complement(35167..35778)
                     /locus_tag="Sbal_0031"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(35350..35355,35362..35367,35371..35373,
                     35431..35433,35455..35466,35491..35493,35506..35529,
                     35743..35748,35758..35760))
                     /locus_tag="Sbal_0031"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(35170..35172,35425..35433,35455..35460,
                     35464..35466,35515..35526,35656..35667,35671..35673,
                     35683..35685,35746..35748,35752..35757))
                     /locus_tag="Sbal_0031"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(35350..35355,35362..35367,35464..35466,
                     35491..35493,35506..35514,35518..35520,35527..35529))
                     /locus_tag="Sbal_0031"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(35350..35352,35458..35460,35464..35466))
                     /locus_tag="Sbal_0031"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(34900..35160)
                     /locus_tag="Sbal_0031"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    complement(order(34906..34908,34912..34917,34921..34923,
                     34927..34929,35050..35052,35056..35058,35089..35091))
                     /locus_tag="Sbal_0031"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            complement(35796..36308)
                     /gene="def"
                     /locus_tag="Sbal_0032"
                     /db_xref="GeneID:4842588"
     CDS             complement(35796..36308)
                     /gene="def"
                     /locus_tag="Sbal_0032"
                     /EC_number="3.5.1.88"
                     /note="cleaves off formyl group from N-terminal methionine
                     residues of newly synthesized proteins; binds iron(2+)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_001048437.1"
                     /db_xref="GI:126172288"
                     /db_xref="InterPro:IPR000181"
                     /db_xref="GeneID:4842588"
                     /translation="MAQLKVLQFPDERLRTQATPITEFNAELQTQIDDMFETMYQEKG
                     IGLAATQVDYHKQLIVMDLQDEVERPKVFINPEIIASSGDFCNEEGCLSVPGIYAKVD
                     RAEFVTVKALDRHGNEFIVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLE
                     KAARLDAKEA"
     misc_feature    complement(35880..36293)
                     /gene="def"
                     /locus_tag="Sbal_0032"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(35898..35900,35907..35912,36033..36041,
                     36156..36158,36171..36179))
                     /gene="def"
                     /locus_tag="Sbal_0032"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(35907..35909,36033..36035,36156..36158,
                     36171..36173))
                     /gene="def"
                     /locus_tag="Sbal_0032"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(35898..35900,35910..35912,36036..36038))
                     /gene="def"
                     /locus_tag="Sbal_0032"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            36434..37564
                     /locus_tag="Sbal_0033"
                     /db_xref="GeneID:4841916"
     CDS             36434..37564
                     /locus_tag="Sbal_0033"
                     /note="PFAM: Peptidoglycan-binding LysM;
                     KEGG: shm:Shewmr7_0028 peptidoglycan-binding LysM"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding LysM"
                     /protein_id="YP_001048438.1"
                     /db_xref="GI:126172289"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="GeneID:4841916"
                     /translation="MEIPMKRLILLALMTFNCTFVAADTLTLKAGHPESYVVKKGDTL
                     WDISAAFLNDPWKWPRLWDVNPQIANPHLIYPGDQLTLVFVDGQPRLVRNGDMVDSAK
                     PHVKKSPEGRIIAKSNAIPAVDLALIEHYLVQNRVVATDWLAEQPMVLAGESPSRHHI
                     VGDVIYIDAELPMNQKYGVYERGREFFNKASGEAIGQEAILASTGQVVESGKVSKIKL
                     LTSFRETKAGFRVMPMESDSLMSAYFTPKPAELKTPAVVLAIESKMREAGKLDVVYLD
                     KGTQDGVEPGVVFSIYRDGEVIVINNDGMPVPATERTAYDNLMASVSSDRAIQMPDIY
                     HGKLLVFKVFDKASLGLIVSTERPVRVDDKLIAPESLALRGQ"
     misc_feature    <36521..36679
                     /locus_tag="Sbal_0033"
                     /note="Uncharacterized protein containing LysM domain
                     [Function unknown]; Region: XkdP; COG1652"
                     /db_xref="CDD:224566"
     misc_feature    36536..36679
                     /locus_tag="Sbal_0033"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            37648..38664
                     /locus_tag="Sbal_0034"
                     /db_xref="GeneID:4841920"
     CDS             37648..38664
                     /locus_tag="Sbal_0034"
                     /note="TIGRFAM: DNA protecting protein DprA;
                     PFAM: SMF family protein;
                     KEGG: son:SO0034 DNA processing protein DprA, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA protecting protein DprA"
                     /protein_id="YP_001048439.1"
                     /db_xref="GI:126172290"
                     /db_xref="InterPro:IPR003488"
                     /db_xref="GeneID:4841920"
                     /translation="MEVDDLRQRLEHEREALPLSDHLLHSLAIDYQKVDVALEWQQQA
                     ADHHLVCFSDPLYPPLLKQLSDPPAVLFVKGCLEALALPYLAIVGSRNASPGGLQVAY
                     QLAVEMCSMGFGICSGMAMGIDGAAHKACVEHQGRTVAVLGTGIETVYPRKHRQLYHD
                     IQQQGCILSEFWPDVGPFAGNFPKRNRIISGLSLGTLVVEACRKSGSLITARLAMEQG
                     REVFAVPGSILGGYHQGCHDLLRDGAKLVETAADIVEELASLTAYHLEELKLCHHIQQ
                     GEICNLPFSSLLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVR
                     VKRS"
     misc_feature    37663..38652
                     /locus_tag="Sbal_0034"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     misc_feature    37774..38394
                     /locus_tag="Sbal_0034"
                     /note="DNA recombination-mediator protein A; Region:
                     DNA_processg_A; pfam02481"
                     /db_xref="CDD:251323"
     gene            38667..39140
                     /locus_tag="Sbal_0035"
                     /db_xref="GeneID:4842395"
     CDS             38667..39140
                     /locus_tag="Sbal_0035"
                     /note="PFAM: protein of unknown function DUF494;
                     KEGG: son:SO0035 Smg protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048440.1"
                     /db_xref="GI:126172291"
                     /db_xref="InterPro:IPR007456"
                     /db_xref="GeneID:4842395"
                     /translation="MFDILMYLFENYVHSEVELLVDEDELTKELTRAGFHQSEILKAL
                     TWLERLAELQEGDKPYLCNHDQHSFRIYTKDEMDKLDVESRGFLLFLEQVKVLNVETR
                     EMVIDRVMELDEPTLILEDLKWVILMVLFNAPGHESAYEQMEDLIFEQPEGRLHS"
     misc_feature    38667..39134
                     /locus_tag="Sbal_0035"
                     /note="Protein of unknown function (DUF494); Region:
                     DUF494; pfam04361"
                     /db_xref="CDD:146808"
     gene            39254..39823
                     /locus_tag="Sbal_0036"
                     /db_xref="GeneID:4843392"
     CDS             39254..39823
                     /locus_tag="Sbal_0036"
                     /note="PFAM: DNA topoisomerase, type IA, zn finger domain
                     protein;
                     KEGG: shm:Shewmr7_0031 DNA topoisomerase, type IA, zn
                     finger domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase type IA Zn finger
                     domain-containing protein"
                     /protein_id="YP_001048441.1"
                     /db_xref="GI:126172292"
                     /db_xref="InterPro:IPR013498"
                     /db_xref="GeneID:4843392"
                     /translation="MIMSKIDEQLFSAHEHALEKEYELCPECGSELSVKHSKHGGFIG
                     CNNYPSCNYTRPLVQHESIETQVIEGSVCPECGHELAVKSGRFGIFIGCTQYPSCTHI
                     EKQDQASDKPDIPCPECKTGKLEHRTSRFGKSFYACSAYPKCKFIVNYPPVAEACPSC
                     GFGILVERKGAAGMRLECPQKTCKYKRPL"
     misc_feature    39320..39424
                     /locus_tag="Sbal_0036"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    39470..39565
                     /locus_tag="Sbal_0036"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    39599..39709
                     /locus_tag="Sbal_0036"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     gene            39950..40516
                     /locus_tag="Sbal_0037"
                     /db_xref="GeneID:4844446"
     CDS             39950..40516
                     /locus_tag="Sbal_0037"
                     /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein;
                     PFAM: SUA5/yciO/yrdC, N-terminal domain;
                     KEGG: son:SO0037 Sua5/YciO/YrdC/YwlC family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Sua5/YciO/YrdC/YwlC family protein"
                     /protein_id="YP_001048442.1"
                     /db_xref="GI:126172293"
                     /db_xref="InterPro:IPR004388"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="GeneID:4844446"
                     /translation="MLQLHPSDIKDIILQGGVIAYPTEAVYGLGCDPDNDTAIQKLLA
                     VKQRPWQKGLILVASDFQQLLAYVDESQLTAEQLEFAFSKWPGPFTFVMPIKAHVSKY
                     LCGEFDSIAVRVSAHAGVQALCRALNKPLVSTSANLAGEDPALTAAEILADFTGKIDA
                     LVLGELGEQRQPSTIIDARSGKILRNGQ"
     misc_feature    39968..40510
                     /locus_tag="Sbal_0037"
                     /note="Telomere recombination; Region: Sua5_yciO_yrdC;
                     cl00305"
                     /db_xref="CDD:260340"
     gene            40542..41450
                     /locus_tag="Sbal_0038"
                     /db_xref="GeneID:4842128"
     CDS             40542..41450
                     /locus_tag="Sbal_0038"
                     /EC_number="1.3.3.3"
                     /note="catalyzes the conversion of the propionic acid
                     groups of rings I and III to vinyl groups during heme
                     synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_001048443.1"
                     /db_xref="GI:126172294"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="GeneID:4842128"
                     /translation="MSVPDAAVVKAFLLDLQNRICAGLQALDGQARFAADSWTRAEGG
                     GGTSRVLTQGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNP
                     YIPTTHANVRFFIAQKEGADPVWWFGGGFDLTPYYPFEEDVREWHQTSKDICAPFGDE
                     VYPKYKKWCDEYFFLPHRNETRGVGGLFFDDLNQAGFEQSFSFMQAVGNGFLTAYAPI
                     VERRKDTEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRW
                     QYAYTPEAGSPEADLYDNYLKPRDWV"
     misc_feature    40542..41447
                     /locus_tag="Sbal_0038"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK05330"
                     /db_xref="CDD:235413"
     gene            complement(41485..41922)
                     /locus_tag="Sbal_0039"
                     /db_xref="GeneID:4842521"
     CDS             complement(41485..41922)
                     /locus_tag="Sbal_0039"
                     /note="PFAM: globin;
                     KEGG: son:SO0039 hypothetical globin"
                     /codon_start=1
                     /transl_table=11
                     /product="globin"
                     /protein_id="YP_001048444.1"
                     /db_xref="GI:126172295"
                     /db_xref="InterPro:IPR001486"
                     /db_xref="GeneID:4842521"
                     /translation="MNWLKKIFSKHTPPQDDRDPSQSNAYDLIGGEKVIRAITKCFYQ
                     KMASSAETTTLLAIHRAPIAESEQKLFEFLSGWLGGPQLYQQKYGHPALRARHMHVDI
                     DEAMRDQWLFCMKFAIEENIKKPEHRAAIFEAISTLADHMRNQ"
     misc_feature    complement(41488..41853)
                     /locus_tag="Sbal_0039"
                     /note="Truncated hemoglobins (trHbs) are a family of
                     oxygen-binding heme proteins found in cyanobacteria,
                     eubacteria, unicellular eukaryotes, and plants. The
                     truncated hemoglobins have a characteristic two-over-two
                     alpha helical folding pattern that is distinct...; Region:
                     Trunc_globin; cd00454"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(41518..41520,41527..41529,41560..41562,
                     41569..41571,41581..41583,41590..41592,41689..41691,
                     41698..41703,41797..41799,41806..41811,41818..41823,
                     41836..41838))
                     /locus_tag="Sbal_0039"
                     /note="apolar tunnel; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(41497..41499,41509..41511,41593..41595,
                     41602..41604,41623..41625,41632..41637,41647..41649,
                     41653..41655,41671..41673,41701..41706,41713..41715,
                     41725..41727,41746..41751,41794..41796))
                     /locus_tag="Sbal_0039"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(41557..41565,41575..41577,41584..41586,
                     41776..41781,41788..41790))
                     /locus_tag="Sbal_0039"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238256"
     gene            42076..42924
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /db_xref="GeneID:4842795"
     CDS             42076..42924
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /EC_number="1.1.1.25"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_001048445.1"
                     /db_xref="GI:126172296"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR011342"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="GeneID:4842795"
                     /translation="MTDRYAVFGNPISHSKSPFIHGQFAAPTQESLTYEAILAPVDGF
                     EASLTAFFNAGGKGANVTVPFKEQAFALCDSISPEAKLAGAVNTLSLLADGTIRGDNT
                     DGLGLVADLIANLGSLQDKRVLLIGAGGAARGCILPLLNAGIAQLIISNRTHTKAQLL
                     VDIFTSVDNGAFANRVTAVEMNELAGEFDIIINSTSASLVGELPPLPTHIITTQTVCY
                     DMMYGASVTAFNQWALSQGAAKVIDGLGMLVGQAAKSFTLWRGIEPDTQVVLTLLRDK
                     LMAEPK"
     misc_feature    42076..42912
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
                     PRK00258"
                     /db_xref="CDD:234703"
     misc_feature    42094..42342
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    42379..42858
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(42382..42384,42739..42741,42817..42819,42826..42828)
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(42457..42459,42466..42468,42526..42531,42655..42663,
                     42733..42735,42805..42807,42814..42819)
                     /gene="aroE"
                     /locus_tag="Sbal_0040"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            42930..43205
                     /locus_tag="Sbal_0041"
                     /db_xref="GeneID:4843982"
     CDS             42930..43205
                     /locus_tag="Sbal_0041"
                     /note="PFAM: protein of unknown function DUF1488;
                     KEGG: son:SO0041 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048446.1"
                     /db_xref="GI:126172297"
                     /db_xref="InterPro:IPR009962"
                     /db_xref="GeneID:4843982"
                     /translation="MNQSILFPDLQYWDDAQGQICFMAQSQGMNIKCYISAAKLRELN
                     DFSEQPSTDEAAAMLALFDAVRFDAEEMAEELIEAEEFDEFGAVRLG"
     misc_feature    42939..43172
                     /locus_tag="Sbal_0041"
                     /note="Protein of unknown function (DUF1488); Region:
                     DUF1488; pfam07369"
                     /db_xref="CDD:191733"
     gene            complement(43325..43873)
                     /locus_tag="Sbal_0042"
                     /db_xref="GeneID:4844305"
     CDS             complement(43325..43873)
                     /locus_tag="Sbal_0042"
                     /note="KEGG: shn:Shewana3_0045 carbonic anhydrase, family
                     3"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="YP_001048447.1"
                     /db_xref="GI:126172298"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="GeneID:4844305"
                     /translation="MSGPLRTYQGIHPQLGNNVYVDEASVLVGDIALDTDASIWPMVA
                     ARGDVNHIRIGKRSNVQDGSILHVTRKSAARPDGHPLIIGDDVTIGHKAMLHGCKVGN
                     RVLVGMGAIILDGAILEDDVILGAGSLVPPGKVLQSGYLYVGSPAKQARPLTPAEMAF
                     LPESADNYVRLKNEYLVELQNI"
     misc_feature    complement(43334..43864)
                     /locus_tag="Sbal_0042"
                     /note="Carbonic anhydrases/acetyltransferases, isoleucine
                     patch superfamily [General function prediction only];
                     Region: PaaY; COG0663"
                     /db_xref="CDD:223735"
     misc_feature    complement(43355..43834)
                     /locus_tag="Sbal_0042"
                     /note="Gamma carbonic anhydrase-like: This family is
                     composed of gamma carbonic anhydrase (CA), Ferripyochelin
                     Binding Protein (FBP), E. coli paaY protein, and similar
                     proteins. CAs are zinc-containing enzymes that catalyze
                     the reversible hydration of carbon...; Region:
                     LbH_gamma_CA_like; cd04645"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(43550..43552,43586..43588,43592..43603,
                     43673..43675,43685..43690,43730..43732,43736..43738,
                     43742..43747,43754..43756,43790..43792,43799..43804,
                     43808..43810,43814..43816))
                     /locus_tag="Sbal_0042"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(43586..43588,43601..43603,43673..43675))
                     /locus_tag="Sbal_0042"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:100051"
     gene            44440..45976
                     /locus_tag="Sbal_R0001"
                     /db_xref="GeneID:4844939"
     rRNA            44440..45976
                     /locus_tag="Sbal_R0001"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4844939"
     gene            46345..49247
                     /locus_tag="Sbal_R0002"
                     /db_xref="GeneID:4842349"
     rRNA            46345..49247
                     /locus_tag="Sbal_R0002"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4842349"
     gene            49388..49502
                     /locus_tag="Sbal_R0003"
                     /db_xref="GeneID:4842350"
     rRNA            49388..49502
                     /locus_tag="Sbal_R0003"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:4842350"
     gene            49791..52241
                     /locus_tag="Sbal_0043"
                     /db_xref="GeneID:4842351"
     CDS             49791..52241
                     /locus_tag="Sbal_0043"
                     /note="KEGG: shn:Shewana3_4120 diguanylate
                     phosphodiesterase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: GGDEF domain containing protein; EAL domain protein;
                     histidine kinase, HAMP region domain protein; PAS fold-3
                     domain protein; PAS fold domain protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC and GAF sensor-containing diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="YP_001048448.1"
                     /db_xref="GI:126172299"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4842351"
                     /translation="MLRKLSLAVLLPLCMLTLYLVLVIGEYLFESDQVRAELAQRQST
                     LIKQQLFRMQNVVQSAQALQDVERIEQEVSLAALDMGTMVYILVDADSRIRFANHTVW
                     RDSNAMQVIDGYDATRDRAVVQAFLPQILVNLERLTIQAYYPVLPQYGGAVDLIYLEA
                     DLAPLVAEASAKLQQRFMRVWGLGGLLLIGFTFILYFLLIRPFQILSEAAKQVGTSSF
                     STSIPWSSSEVLSLQASLQQVHERLSRAVKQLNDSELRWLFAVEGSRNGIWDWDISTG
                     EVFLSDRWKEMIGYAPDELAGVFQTWEARLHPDDRDIVLDALQEYVSGKSKEFESVHR
                     LRHREGHYVWVLDRGMLVDWDPQGRPTRMIGIHMDVSESAKNHAAINELVDQSVTGRK
                     MLPDVFMARLSQFLTQGNSSGQWGSLLLVEVDRLGLVATLNSHELERLLTQVAARLSS
                     YFTENITVGRLESGDFVLLAKDLAIDASVAARRALALASELRQVIARPFHYGHHHFEL
                     SANVGICLLDSIETLDPALVMRRAELATLSAKRPGQAGCAFYHAEMDLRQSRDEQLQQ
                     ELQTALQQDSMTLMFQPVMNAHSELVSAEVLTRWYRTDGEFIPPAEFVALAEQGGMIA
                     ELDFWVANRVCQFIQTSHAQGWSLPTLTLNISAFSFGQADFVDALIALVKEHGIAPHQ
                     LGIELNEAALLMQPQFVAERVSKLVDAGIGIVLDHFGSGSSALSCLANQPLVAVKLDM
                     SCIDSLAAMPQRVKALIVSAQQFNLHVVAKGVESPQHYQAFVEFGCDGYQGYLFSRAL
                     NQADFIQLVCPRPLLRSV"
     misc_feature    50580..50900
                     /locus_tag="Sbal_0043"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    50622..50891
                     /locus_tag="Sbal_0043"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(50628..50630,50640..50642,50658..50660,50703..50714,
                     50793..50795,50808..50810)
                     /locus_tag="Sbal_0043"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(50694..50696,50706..50708,50730..50732,50739..50744,
                     50832..50834,50838..50840)
                     /locus_tag="Sbal_0043"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    50982..51440
                     /locus_tag="Sbal_0043"
                     /note="c-di-GMP synthetase (diguanylate cyclase, GGDEF
                     domain) [Signal    transduction mechanisms]; Region:
                     COG2199"
                     /db_xref="CDD:225109"
     misc_feature    order(51054..51071,51180..51182,51387..51389)
                     /locus_tag="Sbal_0043"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143637"
     misc_feature    order(51054..51056,51180..51182)
                     /locus_tag="Sbal_0043"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     misc_feature    51486..52196
                     /locus_tag="Sbal_0043"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(52198..53181)
                     /locus_tag="Sbal_0044"
                     /db_xref="GeneID:4841915"
     CDS             complement(52198..53181)
                     /locus_tag="Sbal_0044"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: shn:Shewana3_4119 alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold domain-containing
                     protein"
                     /protein_id="YP_001048449.1"
                     /db_xref="GI:126172300"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="InterPro:IPR008262"
                     /db_xref="GeneID:4841915"
                     /translation="MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMV
                     KHPQAHTAIVLSSGRVESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGH
                     VRRFNDYIDDFALFMQKKVLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAP
                     MYGIKLPMPKAFVRWLASKLDTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAY
                     RDLYDAAPKLQLGSPTNRWLTESLDAADTCVLATAQIRTPILILQASEDKIVDNAAQN
                     LAVSTHCQLKVIAGAAHEIFMEKDAYRNQALNYALDFFKRFAIKDEDKQAG"
     misc_feature    complement(52231..53118)
                     /locus_tag="Sbal_0044"
                     /note="lysophospholipase L2; Provisional; Region:
                     PRK10749"
                     /db_xref="CDD:182697"
     misc_feature    complement(52828..53076)
                     /locus_tag="Sbal_0044"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     pfam12146"
                     /db_xref="CDD:256874"
     gene            complement(53277..55088)
                     /locus_tag="Sbal_0045"
                     /db_xref="GeneID:4842382"
     CDS             complement(53277..55088)
                     /locus_tag="Sbal_0045"
                     /note="PFAM: protein of unknown function DUF885;
                     KEGG: shn:Shewana3_4118 protein of unknown function
                     DUF885"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048450.1"
                     /db_xref="GI:126172301"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR010281"
                     /db_xref="GeneID:4842382"
                     /translation="MHKLLTPSLLICALSACSATQITKNSQTAAPQAISTAQSQVEPI
                     APALQAIIDQSWQLQLSASPEMAYSMGDASAAGKLSDLSPAALAKLNQGQIAVLAQLK
                     ALDRSSLSKEDKINAQILEDQIQNDVDLYRFKDYYLPITAESGFHAYITSIAQGRFNT
                     LEDYRNYIAKLNALPTYFAQQTHWLKQGLAEGITPPKVTLNGFEDSISAYIVPVEKSG
                     YFKPFTQYPSYFTEAQKTQLTQEGRALVEQKVLPLYQNFYDFMTKEYIPNARENIAAS
                     SLPNGAEFYENRVRYYTTLNMTSAEVHELGLKEVKRIRQEMEQIIKSVGFKGSFADFL
                     HFLRTDPQFYTTSADQLLKEAAFIAKKADAMLPKYFGKLPRKPYGIAPVPAEIAPKYT
                     TGRYSGSNSDDEPGYYWVNTYALDKRPLYELEALTLHEAVPGHHLQISLNSELTSLPD
                     FRRYGYISAFGEGWGLYCEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAQG
                     WSRQQAIDFMASNTALSLHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEQELGD
                     KFDIRAFHDAVLENGSVPMSILEQQINDFIEAKKATR"
     misc_feature    complement(53301..54902)
                     /locus_tag="Sbal_0045"
                     /note="Bacterial protein of unknown function (DUF885);
                     Region: DUF885; pfam05960"
                     /db_xref="CDD:253477"
     gene            55299..56294
                     /locus_tag="Sbal_0046"
                     /db_xref="GeneID:4842688"
     CDS             55299..56294
                     /locus_tag="Sbal_0046"
                     /EC_number="3.5.4.4"
                     /note="catalyzes the formation of inosine from adenosine"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="YP_001048451.1"
                     /db_xref="GI:126172302"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="GeneID:4842688"
                     /translation="MIDTSIPLVDLHRHLDGNVRVNTIWELGHQHGIALPADSLETLA
                     PFVQIQGKETSLVAFLKKLDWMVGVLADLDAVKRVAYENVADAALSGLDYAELRFSPY
                     YMAMNHKLPIEGVVEAVVDGVKAGLKDYNVKINLIGILSRSFGQAACTQELEGLLAHK
                     QHLVAMDLAGDEMGFPGELFNEHFKRVRDADLAITAHAGEAAGSQSMWQAIQELGATR
                     IGHGVNAIHDPKLMEYLAKHRIGIESCPTSNLHTSTVASYADHPFRTFMDAGVLINLN
                     TDDPGVSAIDINHEYRIAKSELKLTDAELAQVQRNGVEMAFLSDSERKALYAAKV"
     misc_feature    55299..56282
                     /locus_tag="Sbal_0046"
                     /note="adenosine deaminase; Provisional; Region: PRK09358"
                     /db_xref="CDD:236480"
     misc_feature    order(55332..55334,55338..55340,55887..55889,55959..55961,
                     56130..56132)
                     /locus_tag="Sbal_0046"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(56389..57729)
                     /locus_tag="Sbal_0047"
                     /db_xref="GeneID:4842399"
     CDS             complement(56389..57729)
                     /locus_tag="Sbal_0047"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_001048452.1"
                     /db_xref="GI:126172303"
                     /db_xref="InterPro:IPR004558"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /db_xref="GeneID:4842399"
                     /translation="MIEKYNYSGPRYTSYPTALEFDDTFTEQNLLTAIENSKSDKLSL
                     YIHIPFCAKLCYYCGCNKVITRHQHKADQYIEYLSQEIIKRAPLFKHYSVTQMHWGGG
                     TPTFLNPEQILKLTSLIKANFNFAEEGEYSIEVDPREIELSMLDTLKEAGFNRISIGV
                     QDFNKEVQIAVNREQDEQFIFDLMAKAKAMGFVSTNIDLIYGLPHQTPETFAVTMQRV
                     LDLSPDRLSVFNYAHLPARFAAQRKIKDEHLPSPKQKLEMLHQTIETLTGAGYQYIGM
                     DHFAKPDDELAKLQREGRLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRP
                     YYEAIDKEGHALWKGCSLNRDDEIRRVVIKQLICHFELDMAKIDEKLGINFETYFAED
                     LKLMQTFIDDKLVEIVDRQITISPTGRLLIRNICMCFDLYYRQKARQQQFSRVI"
     misc_feature    complement(56392..57729)
                     /locus_tag="Sbal_0047"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09249"
                     /db_xref="CDD:236430"
     misc_feature    complement(57025..57579)
                     /locus_tag="Sbal_0047"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(57037..57042,57130..57132,57253..57255,
                     57322..57330,57421..57426,57430..57432,57553..57561,
                     57565..57567,57571..57573,57577..57579))
                     /locus_tag="Sbal_0047"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(56470..56676)
                     /locus_tag="Sbal_0047"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            complement(58027..58494)
                     /locus_tag="Sbal_0048"
                     /db_xref="GeneID:4844295"
     CDS             complement(58027..58494)
                     /locus_tag="Sbal_0048"
                     /note="KEGG: shn:Shewana3_4115 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048453.1"
                     /db_xref="GI:126172304"
                     /db_xref="GeneID:4844295"
                     /translation="MSTAIIILGFIIIVALSSYATFLILKLKQQKKRQQAEQAEREVT
                     ANAKRAQVLDDIRYIATAMIEDRCEISEGVVRIGRLFEMLSLSERVAPDYPSLFKHFE
                     LIKDHPIMDARQALPKQERMKLDLIRMKSEAALEQGISDDAKKLADYQAKAMH"
     misc_feature    complement(58057..58455)
                     /locus_tag="Sbal_0048"
                     /note="Protein of unknown function (DUF2489); Region:
                     DUF2489; pfam10675"
                     /db_xref="CDD:256117"
     gene            complement(58569..59129)
                     /locus_tag="Sbal_0049"
                     /db_xref="GeneID:4841726"
     CDS             complement(58569..59129)
                     /locus_tag="Sbal_0049"
                     /note="PFAM: protein of unknown function DUF414;
                     KEGG: shn:Shewana3_4114 protein of unknown function
                     DUF414"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048454.1"
                     /db_xref="GI:126172305"
                     /db_xref="InterPro:IPR007336"
                     /db_xref="GeneID:4841726"
                     /translation="MSRSKKTRKGGENSPKLQPRVKKQDRAVATGKRKDSGNKSGSRH
                     NESLILAQAPQQQAAKKKDPRHGSKKPIALAIPAAVVTDKAAQPKVKQAKLTDEQKLL
                     KLEEDPRLNQLLDMLEEGRDLNDVDQKWLDQQLSKIEALMIKLGISDDMDNDAPSSPA
                     KSLSDDELFDKFESGADLLKDYQDKF"
     misc_feature    complement(58611..59108)
                     /locus_tag="Sbal_0049"
                     /note="Der GTPase activator (YihI); Region: YihI;
                     pfam04220"
                     /db_xref="CDD:252458"
     gene            complement(59220..59858)
                     /locus_tag="Sbal_0050"
                     /db_xref="GeneID:4842419"
     CDS             complement(59220..59858)
                     /locus_tag="Sbal_0050"
                     /note="KEGG: son:SO4727 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048455.1"
                     /db_xref="GI:126172306"
                     /db_xref="GeneID:4842419"
                     /translation="MPRCPLCHNSQTQLLHQDKKRSFYVCKTCELTFADANSHLPPAA
                     EKQRYGRSRIALKQKQLSQFILPLLAQLEQQQAGSLLGLNFGRILNDESLATIENAGH
                     KLNQYDPFFAPNHDVLKQEYDFICCYRVFEHFQYPIKEWALLSRLLHSGGWLAISTPL
                     LTELDGFAKWHYKNNLTHVSFYQRQTFEYLANNSDFELLFAVKDLVLMQKTS"
     misc_feature    complement(59262..59687)
                     /locus_tag="Sbal_0050"
                     /note="Methyltransferase domain; Region: Methyltransf_23;
                     pfam13489"
                     /db_xref="CDD:257813"
     gene            complement(60679..61302)
                     /locus_tag="Sbal_0051"
                     /db_xref="GeneID:4841924"
     CDS             complement(60679..61302)
                     /locus_tag="Sbal_0051"
                     /note="PFAM: cytochrome c, class I;
                     KEGG: shn:Shewana3_4111 cytochrome c, class I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_001048456.1"
                     /db_xref="GI:126172307"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR008168"
                     /db_xref="InterPro:IPR008169"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4841924"
                     /translation="MKKLALALSVVIAAISSPAIAEGNAEAGKTKIIVCSACHGMDGN
                     SMIDMYPKLAGQHATYLQKQLHDFRSAAQTGGKDGRMDPIMSGMAMPLSDQDILDITA
                     YFSSQAIQVAEAKDVPELGAKLYKGGDVSRGITACMACHGPDGKGAELAGFPTLAGQH
                     ANYIKIQLTKFREAGRHNDLNGMMQDVAKKLSDSDIDALSKYLSSLK"
     misc_feature    complement(60922..61302)
                     /locus_tag="Sbal_0051"
                     /note="Cytochrome c553 [Energy production and conversion];
                     Region: COG2863"
                     /db_xref="CDD:225418"
     misc_feature    complement(60682..60972)
                     /locus_tag="Sbal_0051"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            61471..62130
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /db_xref="GeneID:4843993"
     CDS             61471..62130
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="binds guanine nucleotides; in Escherichia coli
                     depletion results in defective cell division and
                     filamentation; in Bacillus subtilis this gene is
                     essential"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTP-binding protein YsxC"
                     /protein_id="YP_001048457.1"
                     /db_xref="GI:126172308"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="GeneID:4843993"
                     /translation="MTESRIDFRRAKFLISAPDIAHLDQYLPGDVGVEIAFAGRSNAG
                     KSSALNALTEQKSLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLALKNKWQ
                     QALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQSA
                     KMKTVNEVRLALSEFGDWVQVEPFSSLKGTGKPKVLAILNEWCHPQWLTDELDAANNA
                     E"
     misc_feature    61486..62088
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="Predicted GTPase [General function prediction
                     only]; Region: COG0218"
                     /db_xref="CDD:223296"
     misc_feature    61570..62079
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="YihA (EngB) GTPase family; Region: YihA_EngB;
                     cd01876"
                     /db_xref="CDD:206665"
     misc_feature    61585..61608
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="G1 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    order(61591..61611,61651..61659,61666..61674,61720..61722,
                     61924..61926,61930..61932,62023..62028)
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206665"
     misc_feature    61663..61683
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206665"
     misc_feature    61672..61674
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="G2 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    61720..61731
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="G3 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    order(61729..61740,61759..61803,61810..61815)
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206665"
     misc_feature    61921..61932
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="G4 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    62023..62031
                     /gene="engB"
                     /locus_tag="Sbal_0052"
                     /gene_synonym="yihA; ysxC"
                     /note="G5 box; other site"
                     /db_xref="CDD:206665"
     gene            complement(63394..66159)
                     /locus_tag="Sbal_0053"
                     /db_xref="GeneID:4843985"
     CDS             complement(63394..66159)
                     /locus_tag="Sbal_0053"
                     /EC_number="2.7.7.7"
                     /note="KEGG: shn:Shewana3_4109 DNA polymerase I;
                     TIGRFAM: DNA polymerase I;
                     PFAM: DNA-directed DNA polymerase; 5'-3' exonuclease;
                     3'-5' exonuclease;
                     SMART: Helix-hairpin-helix domain protein, class 2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_001048458.1"
                     /db_xref="GI:126172309"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR002421"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="GeneID:4843985"
                     /translation="MPTVAKNPLVLVDGSSYLYRAYYAPPHLTNSKGEATGAVYGVVN
                     MLRSLLTRYQPSHIAVVFDAKGKTFRNDMYSEYKAQRPPMPDDLRSQIEPLHRIIRAL
                     GLPLISISGVEADDVIGTIARQASLENRAVLISTGDKDMAQLVDENVTLINTMTDTIM
                     GPEEVAIKFGVGPDRIIDLLALMGDKADNIPGLPGVGEKTALAMLTGAGSVSNLLAEP
                     EKVAELGFRGSKTMAAKIIENADMLKLSYELATIKTDVELEQDWHELTIKPADKDELI
                     KCYGEMEFKRWLAEVLDNKITANTPIDAASETQEDSTPVEAIATQYDCILTEAELDAW
                     IAKLKEADLMAVDTETTSLDYMVAELVGISFAVEAGKAAYLPLTHDYVGAPTQINKTV
                     ALEKLRPLLEDPKLKKVGQNLKYDISILANAGIKLQGVAFDTMLESYVFNSVASRHDM
                     DGLALKYLGHKNISFEEIAGKGAKQLTFNQIPLETAAPYAAEDADITLRLHQHLWPRL
                     EKEAELAAMFTEVELPLIQVLSDIERQGVLIDSMLLGQQSDELARKIDTLEEKAYDIA
                     GEKFNLGSPKQLQVLFFEKLGYPITKKTPKGAPSTAEEVLVELALDFPLPKVILEHRS
                     LSKLKSTYTDKLPLMVNAKTGRVHTSYHQANAATGRLSSSEPNLQNIPIRTEEGRRIR
                     QAFIAPDGRKILAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDE
                     VTTEQRRRAKAVNFGLIYGMSAFGLARQLDIPRHEAQTYIDTYFARYPGVLRYMEETR
                     AGAADLGYVSTLFGRRLYLPEIRDRNAMRRQGAERAAINAPMQGTAADIIKKAMINIA
                     QWIKTETQGEITMIMQVHDELVFEVDADKAEALKKTICTLMAQAADLDVELLAEAGIG
                     NNWDEAH"
     misc_feature    complement(63397..66144)
                     /locus_tag="Sbal_0053"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    complement(65665..66135)
                     /locus_tag="Sbal_0053"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(65740..65742,65746..65748,65812..65817,
                     65821..65823,65971..65973,66121..66123))
                     /locus_tag="Sbal_0053"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(65746..65748,65815..65817,66121..66123))
                     /locus_tag="Sbal_0053"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    complement(65917..65955)
                     /locus_tag="Sbal_0053"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(65812..65814,65821..65823))
                     /locus_tag="Sbal_0053"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(65740..65742,65746..65748))
                     /locus_tag="Sbal_0053"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    complement(65404..65643)
                     /locus_tag="Sbal_0053"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    complement(order(65542..65553,65557..65586,65590..65613))
                     /locus_tag="Sbal_0053"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    complement(order(65596..65598,65605..65607))
                     /locus_tag="Sbal_0053"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    complement(64567..65151)
                     /locus_tag="Sbal_0053"
                     /note="DEDDy 3'-5' exonuclease domain of Escherichia coli
                     DNA polymerase I and similar bacterial family-A DNA
                     polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139"
                     /db_xref="CDD:176651"
     misc_feature    complement(order(64681..64683,64693..64695,64762..64767,
                     64810..64815,64912..64920,64924..64929,65101..65103,
                     65110..65121))
                     /locus_tag="Sbal_0053"
                     /note="active site"
                     /db_xref="CDD:176651"
     misc_feature    complement(order(64681..64683,64693..64695,64912..64914,
                     65113..65115,65119..65121))
                     /locus_tag="Sbal_0053"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176651"
     misc_feature    complement(order(64681..64683,64693..64695,64762..64767,
                     64810..64815,64915..64920,64924..64929,65101..65103,
                     65110..65118))
                     /locus_tag="Sbal_0053"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176651"
     misc_feature    complement(63406..64542)
                     /locus_tag="Sbal_0053"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    complement(order(63535..63543,63637..63639,63658..63660,
                     63910..63912,63922..63924,63982..63984,64066..64071,
                     64165..64176,64180..64182,64186..64194,64267..64272,
                     64279..64281,64291..64293))
                     /locus_tag="Sbal_0053"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    complement(order(63535..63543,63637..63639,63649..63651,
                     63658..63663,63886..63888,64165..64176,64180..64182,
                     64186..64194,64267..64272,64279..64281,64291..64293))
                     /locus_tag="Sbal_0053"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    complement(order(63535..63537,63910..63912,63922..63924,
                     63982..63984,64060..64062,64066..64071))
                     /locus_tag="Sbal_0053"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            66547..67209
                     /locus_tag="Sbal_0054"
                     /db_xref="GeneID:4845599"
     CDS             66547..67209
                     /locus_tag="Sbal_0054"
                     /note="PFAM: ThiJ/PfpI domain protein;
                     KEGG: shn:Shewana3_4108 ThiJ/PfpI domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis protein with
                     amidotransferase-like domain"
                     /protein_id="YP_001048459.1"
                     /db_xref="GI:126172310"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="GeneID:4845599"
                     /translation="MKKVAVLLSGCGVFDGTEIHESVLTLLCLSKAGAHYQCFAPDIK
                     QMHVVDHLTGEVDATASRNVLVESARIARGEVKATTELAIAEFDALIIPGGFGAAKNL
                     CNFATNGSECEVDPLVTDFINEFILAKKPVGFICIAPMMIPRLYPHGVKGTIGNDSDT
                     VAAFNLMGGEHQVATVHEIVVDEANRIVSTPAYMLAGSIAEAHSGIEKLVAKVLEMTV
                     AR"
     misc_feature    66547..67197
                     /locus_tag="Sbal_0054"
                     /note="isoprenoid biosynthesis protein with
                     amidotransferase-like domain; Provisional; Region:
                     PRK11780"
                     /db_xref="CDD:236980"
     misc_feature    66556..67197
                     /locus_tag="Sbal_0054"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in zebrafish ES1; Region: GATase1_ES1;
                     cd03133"
                     /db_xref="CDD:153227"
     misc_feature    66952..66954
                     /locus_tag="Sbal_0054"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153227"
     gene            complement(67291..68136)
                     /locus_tag="Sbal_0055"
                     /db_xref="GeneID:4843892"
     CDS             complement(67291..68136)
                     /locus_tag="Sbal_0055"
                     /note="PFAM: Rhomboid family protein;
                     KEGG: shn:Shewana3_4107 rhomboid family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="YP_001048460.1"
                     /db_xref="GI:126172311"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="GeneID:4843892"
                     /translation="MIEIGRLPNSRAAQAFVDYLKGEHIDCQIEPLEQGVAILVIHDK
                     DLEQARTEFAHFMAHPYDSKYLQASWEHGDTQTKIDYGAPSLQLFTQFITGAGPVTLI
                     VFAVCVLIFAAMNLGFANQTYAALSYFGAVPSSEFSQFWRVFTPSLLHFSAMHVIFNL
                     LWWWYLGGKIETRIGTAPLLILLFVAGTLPNVIQYYVGGPNFGGLSGVVYAVVGYTWV
                     MGIRKPAAGIDFPPSYMAFMMIWLALGFTDILGVAVANGAHIGGLLIGLAQGLFDSRK
                     SSSSV"
     misc_feature    complement(67831..68136)
                     /locus_tag="Sbal_0055"
                     /note="Protein of unknown function (DUF3582); Region:
                     DUF3582; pfam12122"
                     /db_xref="CDD:256859"
     misc_feature    complement(67309..68130)
                     /locus_tag="Sbal_0055"
                     /note="rhomboid family protease GlpG; Region: rhombo_GlpG;
                     TIGR04239"
                     /db_xref="CDD:234518"
     misc_feature    complement(67309..67851)
                     /locus_tag="Sbal_0055"
                     /note="Membrane associated serine protease [Amino acid
                     transport and metabolism]; Region: COG0705"
                     /db_xref="CDD:223777"
     gene            complement(68133..68438)
                     /locus_tag="Sbal_0056"
                     /db_xref="GeneID:4842523"
     CDS             complement(68133..68438)
                     /locus_tag="Sbal_0056"
                     /note="PFAM: Rhodanese domain protein;
                     KEGG: shn:Shewana3_4106 rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_001048461.1"
                     /db_xref="GI:126172312"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:4842523"
                     /translation="MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLN
                     NENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCEQGFDDVYSLDGGYSAWHEANA"
     misc_feature    complement(68145..68423)
                     /locus_tag="Sbal_0056"
                     /note="GlpE sulfurtransferase (ST) and homologs are
                     members of the Rhodanese Homology Domain superfamily.
                     Unlike other rhodanese sulfurtransferases, GlpE is a
                     single domain protein but indications are that it
                     functions as a dimer. The active site contains a...;
                     Region: GlpE_ST; cd01444"
                     /db_xref="CDD:238721"
     misc_feature    complement(68244..68246)
                     /locus_tag="Sbal_0056"
                     /note="active site residue [active]"
                     /db_xref="CDD:238721"
     gene            complement(68540..69565)
                     /gene="tdh"
                     /locus_tag="Sbal_0057"
                     /db_xref="GeneID:4845107"
     CDS             complement(68540..69565)
                     /gene="tdh"
                     /locus_tag="Sbal_0057"
                     /EC_number="1.1.1.103"
                     /note="converts threonine and NAD to
                     1,2-amino-3-oxobutanoate and NADH; functions in threonine
                     catabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="YP_001048462.1"
                     /db_xref="GI:126172313"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR004627"
                     /db_xref="InterPro:IPR011597"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:4845107"
                     /translation="MKALSKLKAEKGIWLVDAPKPVMGHNDLLIKIKKTAICGTDMHI
                     YNWDEWSQKTIPVPMVVGHEYVGEVVDIGQEVRGFKIGDRVSGEGHITCGHCRNCRAG
                     RTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSF
                     DLVGEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKE
                     SLKDVMKELGMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKVAMLGIPGGEMAIDWSKV
                     IFKGLVIKGIYGREMFETWYKMASLIQSGLDISPIITHHFKIDDFQQGFDAMGSGQSG
                     KVILSWD"
     misc_feature    complement(68543..69565)
                     /gene="tdh"
                     /locus_tag="Sbal_0057"
                     /note="L-threonine 3-dehydrogenase; Validated; Region:
                     tdh; PRK05396"
                     /db_xref="CDD:180054"
     misc_feature    complement(68552..69565)
                     /gene="tdh"
                     /locus_tag="Sbal_0057"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     misc_feature    complement(order(68702..68710,68777..68782,68846..68851,
                     68921..68923,68966..68968,68978..68983,69038..69055,
                     69110..69112,69122..69124,69437..69439,69446..69454))
                     /gene="tdh"
                     /locus_tag="Sbal_0057"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176178"
     gene            complement(69577..70770)
                     /locus_tag="Sbal_0058"
                     /db_xref="GeneID:4842733"
     CDS             complement(69577..70770)
                     /locus_tag="Sbal_0058"
                     /EC_number="2.3.1.29"
                     /note="catalyzes the formation of 2-amino-3-oxobutanoate
                     from acetyl-CoA and glycine"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate coenzyme A ligase"
                     /protein_id="YP_001048463.1"
                     /db_xref="GI:126172314"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR011282"
                     /db_xref="GeneID:4842733"
                     /translation="MASTSFYAQINQQLADIKAEGLYKSERVIASPQQTAIQVNQQEV
                     INFCANNYLGLANHPELIKAAQQGLDSHGFGMASVRFICGTQDIHKKLEASLSEFLGT
                     EDTILYSSCFDANAGLFETLLDAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMAD
                     LETQLIAAKEAGARNILIATDGVFSMDGVIANLKGVCDLADKYGALVMVDDSHAVGFI
                     GANGRGTHEYCNVMDRVDIITGTLGKALGGASGGFTSGKKEVIDWLRQRSRPYLFSNS
                     LAPSIVTASIHVLEMLKSGQALREAVWENSRYFREQMSAAGFTLGGADHAIIPVMIGD
                     AKLAGDFANRLLAEHIYVIGFSFPVVPKGQARIRTQMSAAHTREQLDKAITAFTRIAK
                     EMGII"
     misc_feature    complement(69607..70692)
                     /locus_tag="Sbal_0058"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    complement(69601..70647)
                     /locus_tag="Sbal_0058"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(69667..69669,70039..70041,70048..70050,
                     70132..70137,70141..70143,70213..70218,70228..70230,
                     70363..70365,70435..70443,70621..70623))
                     /locus_tag="Sbal_0058"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(70039..70041,70048..70050,70132..70137,
                     70141..70143,70216..70218,70228..70230,70363..70365,
                     70435..70443))
                     /locus_tag="Sbal_0058"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(70039..70041)
                     /locus_tag="Sbal_0058"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            complement(71058..71705)
                     /locus_tag="Sbal_0059"
                     /db_xref="GeneID:4844981"
     CDS             complement(71058..71705)
                     /locus_tag="Sbal_0059"
                     /note="PFAM: regulatory protein, TetR;
                     KEGG: son:SO4675 transcriptional regulator, TetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001048464.1"
                     /db_xref="GI:126172315"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:4844981"
                     /translation="MKTRDKIIYASLELFNEHGERNITTNHIAAHLNMSPGNLYYHFR
                     NKEDIIRCIFSLYENHLESGFQPYEDKQVDVELLIGYFDAMFYTLWQFRFMYANLADI
                     LARDEELKKRYLHAQQQVLTRSSHVLHKLKQDGFLHLESDKITPLADTIKMIVSFWIG
                     YQLTQSSTSTITKATLYEGVLRVLMIFKAYATPTSVATFTRLEQHYHALANQESL"
     misc_feature    complement(<71382..71702)
                     /locus_tag="Sbal_0059"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(71553..71687)
                     /locus_tag="Sbal_0059"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    complement(71109..71543)
                     /locus_tag="Sbal_0059"
                     /note="Bacterial transcriptional repressor; Region: TetR;
                     pfam13972"
                     /db_xref="CDD:258224"
     gene            71848..73113
                     /locus_tag="Sbal_0060"
                     /db_xref="GeneID:4842137"
     CDS             71848..73113
                     /locus_tag="Sbal_0060"
                     /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
                     transferase domain protein;
                     KEGG: shn:Shewana3_4102 coproporphyrinogen oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="YP_001048465.1"
                     /db_xref="GI:126172316"
                     /db_xref="InterPro:IPR007507"
                     /db_xref="GeneID:4842137"
                     /translation="MNRFLYSTILYLLSPLLIVYLAFRAIKSPDYRGRWGERFGLTRL
                     KSTDLLIHSVSMGETLAAIPLIRLIMQSHPELSITVTTTSPTGSAEVRKAFGDSVQHC
                     YLPFDLPWCVRRFLRQVSPKWCVIMETELWPNLVAVAAKRGVRLMLANARLSAKSAAQ
                     YAKHPTLNRPMLQRLDVIAVQTQVEAQRFIELGVSPDRVTVCGSLKFDLSITPERLAN
                     AKQLRQAWGRETSPIWVAGSVHPGEFDAMLTAHRQLLAQWPDALMIIAPRHPEQFSAV
                     AEVVASQGFESVRRSGNFPVTATTQVLVGDTMGELLTFYGAADQAFVGGTLIANGGHN
                     PLEPVAMGVPVMVGPNHWDFAQITQMLADAGGLRIVASADELAANLIAYFAKPELRQQ
                     AANAGLAVVEANRGALQRQFALVQSLIKS"
     misc_feature    71848..73104
                     /locus_tag="Sbal_0060"
                     /note="3-deoxy-D-manno-octulosonic-acid transferase;
                     Reviewed; Region: PRK05749"
                     /db_xref="CDD:235589"
     misc_feature    71938..72480
                     /locus_tag="Sbal_0060"
                     /note="3-Deoxy-D-manno-octulosonic-acid transferase
                     (kdotransferase); Region: Glycos_transf_N; pfam04413"
                     /db_xref="CDD:252580"
     gene            complement(73139..73894)
                     /locus_tag="Sbal_0061"
                     /db_xref="GeneID:4845830"
     CDS             complement(73139..73894)
                     /locus_tag="Sbal_0061"
                     /note="catalyzes the phosphorylation of
                     3-deoxy-D-manno-octulosonic acid at the 4-OH position"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid kinase"
                     /protein_id="YP_001048466.1"
                     /db_xref="GI:126172317"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="GeneID:4845830"
                     /translation="MNAQIQIIKTAQGHMALCQDTPKDIAPAWFAVDFWRAKDAVVGS
                     SKGRYTTWFVAFEHSHWVLRHYWRGGLMEKFSKDAYVYTGLENTRAMAELRLLNILYH
                     EDFAVPKPIAANIVRDGLFYRADIIIERVEGAEDLVAKLSKGLMNTEQWQALGATIAQ
                     FHQRGVYHADLNAKNILFQPAQTAPITPERFYLIDFDRGELKTPSPQWQQSNLDRLLR
                     SFNKEQGKLPSLAFTADNWSSLMMGYQAAMQSA"
     misc_feature    complement(73145..73885)
                     /locus_tag="Sbal_0061"
                     /note="3-deoxy-D-manno-octulosonic-acid kinase; Reviewed;
                     Region: PRK01723"
                     /db_xref="CDD:234975"
     gene            73994..75058
                     /locus_tag="Sbal_0062"
                     /db_xref="GeneID:4842219"
     CDS             73994..75058
                     /locus_tag="Sbal_0062"
                     /note="PFAM: glycosyl transferase, family 9;
                     KEGG: son:SO4678 heptosyl transferase, glycosyltransferase
                     family 9 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001048467.1"
                     /db_xref="GI:126172318"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="GeneID:4842219"
                     /translation="MSLNPNTMNSLCLLRLSAIGDVCHAVAMVQAIQRQYPELKITWV
                     IGKLEYQLLKHLPGIEFVIFDKSQGWRSYFNLRKALKGRRFDVLLHMQVALRATLASL
                     AISAKVRIGFDRVRAKEGQWLVTNRRVEPLAKPHVLEGFMGFAKAIGVNDLTPQWHIP
                     VPIADTEFAQTQIKDNEKVFIICAAASKAERNWLPERYAAVASHAIAKGFRVMLCGGP
                     TQLEKDLAEQILQACPSKIDNLVGKTSLTQLLALLKRASLVLAPDTGPAHMAVTQGTP
                     VIGLYAHSNPGRTGPYLSQQYVASTYDEAIASQHSGEVKWGIRAKGEHLMALISVEAV
                     IEKFELVVNDGHVSDDICGY"
     misc_feature    74021..75001
                     /locus_tag="Sbal_0062"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    order(74537..74542,74636..74638,74738..74743,74777..74779,
                     74786..74791,74798..74800)
                     /locus_tag="Sbal_0062"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            75068..76138
                     /locus_tag="Sbal_0063"
                     /db_xref="GeneID:4842126"
     CDS             75068..76138
                     /locus_tag="Sbal_0063"
                     /note="KEGG: saz:Sama_0103 conserved hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048468.1"
                     /db_xref="GI:126172319"
                     /db_xref="GeneID:4842126"
                     /translation="MTVQTSTKFLFIPVSSAEGIGEYMRSMIIADEVKRLWPSAEIKF
                     ILSQQAPYAAQCPYPAVLLEDTPTKQVKAVNQVMSDYLPDIVLFDASGRKSQLAHAHK
                     LGAKVIFLSQHKRKRSRGMKIGRALVTDCHWVVQPEFVIGPISWLDRLKLKLINKPAP
                     LNIGPVFTQPDASTQSALLAQYQLTQNEFVLFNAGSGGHKLNGELAADIFAQAAHESY
                     KASGITSVMVFGPNYPNPLPELEGVVVIPQLNNQQFINMLAAAKAAVLSGGDTLLQAI
                     ALRKPTLAVPVSKDQPPRIAKCVSANVALGSVTELDVLNGNIKQLLSSEGIMRLATSL
                     EKDYKLNGLDLVMKQLERWIRL"
     misc_feature    <75764..75997
                     /locus_tag="Sbal_0063"
                     /note="conserved hypothetical protein; Region: MJ1255;
                     TIGR00661"
                     /db_xref="CDD:233077"
     gene            76123..77178
                     /locus_tag="Sbal_0064"
                     /db_xref="GeneID:4842734"
     CDS             76123..77178
                     /locus_tag="Sbal_0064"
                     /note="KEGG: rba:RB9243 hypothetical protein-putative
                     glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048469.1"
                     /db_xref="GI:126172320"
                     /db_xref="GeneID:4842734"
                     /translation="MDQIVRENLKFILFKKFRGSQVMSVDERVYDYCEFIVDLTKLDE
                     PRLPGISAILRIKNGAEFLRSSIESHLPYYDEIVACYNDCSDNTAEILKELSEIYPEK
                     IKVFEYLPKVHPIFSDAHNSSSTDNVHSLANFYNFTLSKVRYNVATKLDDDHIAIDRN
                     LAPVIDTIRRDILLKVRKIYTFSGVNLALDANGKLGVFQQEPLVGTGDHMYFPVSSKI
                     YFSQEKDVESFHFVDKNEKKYMGIMYFHLKYLKVGCGFVNLEPKKRAEILTRHLHFAG
                     VAELDDFISESSIKRLRKHHNPIEYWLRTQHLVNKTIYSVLGRNPPLRIARLSQLYDD
                     LNGLKLDECVVKRIKRF"
     misc_feature    <76276..>76668
                     /locus_tag="Sbal_0064"
                     /note="Beta-1,4-N-acetylgalactosaminyltransferase (CgtA);
                     Region: CgtA; pfam06306"
                     /db_xref="CDD:114995"
     gene            77211..77960
                     /locus_tag="Sbal_0065"
                     /db_xref="GeneID:4842284"
     CDS             77211..77960
                     /locus_tag="Sbal_0065"
                     /note="PFAM: glycosyl transferase, family 2;
                     KEGG: sdn:Sden_0205 glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001048470.1"
                     /db_xref="GI:126172321"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:4842284"
                     /translation="MNKSTVSLVITSCNRFDLLEKTIESFLKYNTYPISQYIVIEDSH
                     NREKLENTLAKFKGIEFVMVHNEPQLGQMKSIDRAYSLVTSDYIFHCEDDWEFYREGF
                     IEKSLEVLLSDDKVVTVWLRETNDTNSHTVLPELYFCKNDASLTYRGMHQNDLLHGVY
                     WHGFTLNPGLRRLADYQLIAPIAQYTSEGGVGNKYYELGFKAAIFPEGSVRHIGYHRG
                     IRYNADIAKWRKDFNVAFRRFKSKIHKILKV"
     misc_feature    77235..>77561
                     /locus_tag="Sbal_0065"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    order(77241..77243,77247..77249,77328..77330,77481..77483,
                     77487..77489)
                     /locus_tag="Sbal_0065"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(78044..79156)
                     /locus_tag="Sbal_0066"
                     /db_xref="GeneID:4841731"
     CDS             complement(78044..79156)
                     /locus_tag="Sbal_0066"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: pha:PSHAa2452 glycosyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001048471.1"
                     /db_xref="GI:126172322"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4841731"
                     /translation="MSNIYIIYRAMFNLDGTLTTIGGIENYILNLTEVLSLQGWKCHL
                     VQPAKEPFMFETSHVNVHGVSTGFFRGNLKKFALAKWVQINADKKKDIIIYATDSYAV
                     NLSGYKQIAIQHGISWDKPRKANNSFIQFTSSLLNHCKYLSYIKNNSTLVCVDHNFIN
                     WYRTWFNVGNKKVKIIYNFYNEKISNSDFEKKWNNNSEIKIIIARRFVDYRGIDLIAP
                     IIKRLLPQHKIQVSFAGDGPLKPYLESLFANDSNVDIMQYGPDDSFKVHKEHHIAIIP
                     TLGSEGTSLSMIEAMAAGCMVLSSNIGGLSNLIIDGYNGSLVMPTSQDMEQALSSALN
                     NVDLCKKLAKNGLNSITLPCAKDTWSKGWIDVINNQ"
     misc_feature    complement(78119..79132)
                     /locus_tag="Sbal_0066"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(78119..79096)
                     /locus_tag="Sbal_0066"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(79156..80277)
                     /locus_tag="Sbal_0067"
                     /db_xref="GeneID:4843997"
     CDS             complement(79156..80277)
                     /locus_tag="Sbal_0067"
                     /EC_number="5.1.3.14"
                     /note="PFAM: UDP-N-acetylglucosamine 2-epimerase;
                     KEGG: saz:Sama_2261 UDP-N-acetylglucosamine 2-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="YP_001048472.1"
                     /db_xref="GI:126172323"
                     /db_xref="InterPro:IPR003331"
                     /db_xref="GeneID:4843997"
                     /translation="MKILLVFGTRPEAIKMCPLAKMLATDTQLDVKICVTAQHRHMLD
                     QVLSIFELKPDYDLDLMKPNQTLEWLTGAIVEGVGKVIKEFQPQIVLVHGDTTTSFSA
                     ALAAFYQKVDVGHIEAGLRTGDIHSPWPEEANRKLTAVLSKLHFAPTQTAAQNLKNEG
                     YLPEHIYVTGNTVIDALFETLAFTRKDNYSHPSELSPLFDQLQGKKVILITGHRRENF
                     GVGFENICTALKTIALSNPNVQLIYPVHLNPQVQKPVYEYLGELDNFHLIEPLDYQSF
                     VSLMDRADIILTDSGGIQEEAPSLKKPVLVLRDKTERPEAVAAGTVRLVGTDIDKIVS
                     EITQLIDNPSAFGETINPYGDGQACQRIHKIIKLHYQVD"
     misc_feature    complement(79177..80277)
                     /locus_tag="Sbal_0067"
                     /note="UDP-N-acetylglucosamine 2-epimerase [Cell envelope
                     biogenesis, outer membrane]; Region: WecB; COG0381"
                     /db_xref="CDD:223458"
     misc_feature    complement(79177..80274)
                     /locus_tag="Sbal_0067"
                     /note="Bacterial members of the UDP-N-Acetylglucosamine
                     (GlcNAc) 2-Epimerase  family are known to catalyze the
                     reversible interconversion of UDP-GlcNAc and
                     UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
                     produce an activated form of ManNAc residues; Region:
                     GT1_UDP-GlcNAc_2-Epimerase; cd03786"
                     /db_xref="CDD:99962"
     misc_feature    complement(order(79390..79392,79402..79404,79450..79452,
                     79459..79461,79465..79467,80248..80250))
                     /locus_tag="Sbal_0067"
                     /note="active site"
                     /db_xref="CDD:99962"
     misc_feature    complement(order(79804..79806,79873..79875,79891..79893,
                     79942..79944,79948..79950,79954..79959,80041..80043,
                     80062..80067,80071..80073))
                     /locus_tag="Sbal_0067"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99962"
     gene            80574..81065
                     /gene="coaD"
                     /locus_tag="Sbal_0068"
                     /db_xref="GeneID:4842114"
     CDS             80574..81065
                     /gene="coaD"
                     /locus_tag="Sbal_0068"
                     /EC_number="2.7.7.3"
                     /note="Catalyzes the conversion of ATP and pantetheine
                     4'-phosphate to diphosphate and 3'-dephospho-coA"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="YP_001048473.1"
                     /db_xref="GI:126172324"
                     /db_xref="InterPro:IPR001980"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="GeneID:4842114"
                     /translation="MHTRAIYPGTFDPITNGHADLIERAAKLFKHVVIGIAANPSKQP
                     RFTLEERVELVNRVTAHLDNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQL
                     ANMNRRLSPDLESVFLTPAEENSFISSTLVKEVALHGGDVNQFVHSEVATALAAKLKL
                     AKP"
     misc_feature    80583..81026
                     /gene="coaD"
                     /locus_tag="Sbal_0068"
                     /note="Phosphopantetheine adenylyltransferase; Region:
                     PPAT; cd02163"
                     /db_xref="CDD:173914"
     misc_feature    order(80592..80606,80622..80627,80634..80636,80682..80684,
                     80697..80699,80787..80795,80835..80840,80844..80846,
                     80865..80870,80877..80879,80889..80891,80931..80933,
                     80943..80945,80952..80954)
                     /gene="coaD"
                     /locus_tag="Sbal_0068"
                     /note="active site"
                     /db_xref="CDD:173914"
     misc_feature    80616..80627
                     /gene="coaD"
                     /locus_tag="Sbal_0068"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:173914"
     gene            81156..82631
                     /locus_tag="Sbal_0069"
                     /db_xref="GeneID:4841800"
     CDS             81156..82631
                     /locus_tag="Sbal_0069"
                     /note="KEGG: shn:Shewana3_4090 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048474.1"
                     /db_xref="GI:126172325"
                     /db_xref="GeneID:4841800"
                     /translation="MKAFLTPTILATSIASGLFFSSILAAAPWVDASDIYLRADIQAL
                     ADAGVITVPVNTYPLMWSGIGGDLAKVEPELLSPSLVQAYARVNFYYQSAVDNRGNAR
                     IKVSAASDPARFQHYGSDYREKGEVLGSYEYLGSRVAYKATVAETYDPQDNKNFRLDE
                     SYFAIILGNWIATLGSVEQWWGPGFDSALHRSNNARPMQSLTLSRNNAAAFETPWLSW
                     IGPWTFKTGFSLTEVDRAVPKTAEWDMRLSARPIKQLEVGLSWSTLFCGEGQDCNFNF
                     WWDSVASNSVCLDGTSDCAPEERRDAGHRTQSIDMRYTSSWQDIPVGLYLEHSCENGS
                     DCGSLWGIDTHFGTSGKQFKLFMEYSDTYVKCDGDSANCFYEDPVYLSGSRYYGRALG
                     STYDSDAQTFVVGLVGQFSNSRGFTSLLRYAKLNKDGTNVASTWAPQPPKEDLLMLEL
                     SYRMPVWKGMWSLGGTVSRSEFDVQENDTNATLFSSFEYRF"
     misc_feature    81276..82616
                     /locus_tag="Sbal_0069"
                     /note="Capsule assembly protein Wzi; Region:
                     Caps_assemb_Wzi; pfam14052"
                     /db_xref="CDD:258282"
     gene            complement(82697..83704)
                     /locus_tag="Sbal_0070"
                     /db_xref="GeneID:4844104"
     CDS             complement(82697..83704)
                     /locus_tag="Sbal_0070"
                     /EC_number="5.1.3.12"
                     /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
                     hydroxysteroid dehydrogenase/isomerase;
                     dTDP-4-dehydrorhamnose reductase; Male sterility
                     C-terminal domain;
                     KEGG: shm:Shewmr7_3979 UDP-glucuronate 5'-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_001048475.1"
                     /db_xref="GI:126172326"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR008089"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="GeneID:4844104"
                     /translation="MKYLVTGAAGFIGAKVSERLCLLGHEVIGIDNLNDYYDVNLKLA
                     RLDLLQTLDNFHFIKLDLADREGIAALFARHAFQRVIHLAAQAGVRYSLDNPLAYADS
                     NLIGHLTILEGCRHHKIEHLVYASSSSVYGLNQKMPFSTEDSIDHPISLYAATKKANE
                     LMSHTYSHLYQLPTTGLRFFTVYGPWGRPDMALFKFTKAILAGEVIDVYNHGDLSRDF
                     TYIDDIVEGIIRVQAKPPSPNTDWTVDAGTPATSSAPYRVFNIGNGSPVQLLDFITAL
                     EDALGIKANKNFLPMQPGDVHSTWADTSDLFDAVGYKPLVDINTGVAQFVNWYRQFYN
                     K"
     misc_feature    complement(82700..83704)
                     /locus_tag="Sbal_0070"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(82709..83704)
                     /locus_tag="Sbal_0070"
                     /note="UDP glucuronic acid epimerase, extended (e) SDRs;
                     Region: UDP_GE_SDE_e; cd05253"
                     /db_xref="CDD:187563"
     misc_feature    complement(order(83159..83170,83237..83239,83249..83251,
                     83324..83332,83399..83401,83450..83458,83606..83614,
                     83669..83680,83684..83686))
                     /locus_tag="Sbal_0070"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187563"
     misc_feature    complement(order(83237..83239,83249..83251,83324..83326,
                     83396..83398))
                     /locus_tag="Sbal_0070"
                     /note="active site"
                     /db_xref="CDD:187563"
     misc_feature    complement(order(83057..83059,83081..83083,83117..83119,
                     83162..83164,83249..83251,83324..83326))
                     /locus_tag="Sbal_0070"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187563"
     gene            complement(83728..84891)
                     /locus_tag="Sbal_0071"
                     /db_xref="GeneID:4843822"
     CDS             complement(83728..84891)
                     /locus_tag="Sbal_0071"
                     /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
                     KEGG: son:SO4687 UDP-glucose 6-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose/GDP-mannose dehydrogenase"
                     /protein_id="YP_001048476.1"
                     /db_xref="GI:126172327"
                     /db_xref="InterPro:IPR001732"
                     /db_xref="GeneID:4843822"
                     /translation="MKIVVVGMGYVGLSNAVLLAQQNQVTAIDLVPERVKQVNERKST
                     VVDELIEDYLQNKPLNLTATTENVAFQSADFVIIATPTDYDPQTNYFNTHSVESVIHD
                     VLAVNPDTTIIIKSTVPVGYTAALRHKFKSDNILFSPEFLREGKALYDNLYPSRIVVG
                     ERSARAQVFADLLAKAAIKQDIPILLTDSTEAEAIKLFANTFLAMRVAYFNELDTYAE
                     SRGLNTRQIIEGVSLDPRIGDYYNNPSFGYGGYCLPKDTKQLLANYNDVPNNLISAIV
                     DSNTTRKDFIADAIISKQPKCVGIYRLIMKADSDNFRASAVQGVMKRIKAKGIEVVVF
                     EPVLKEDYFFKSRVMRDLTEFKSMCDVIVSNRMVDELNDVADKVYTRDLFNHD"
     misc_feature    complement(83731..84891)
                     /locus_tag="Sbal_0071"
                     /note="UDP-glucose 6-dehydrogenase; Provisional; Region:
                     PRK15057"
                     /db_xref="CDD:185017"
     misc_feature    complement(84373..84891)
                     /locus_tag="Sbal_0071"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; cl19126"
                     /db_xref="CDD:267479"
     misc_feature    complement(84046..84324)
                     /locus_tag="Sbal_0071"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    complement(83737..83997)
                     /locus_tag="Sbal_0071"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            85100..85810
                     /locus_tag="Sbal_0072"
                     /db_xref="GeneID:4842232"
     CDS             85100..85810
                     /locus_tag="Sbal_0072"
                     /note="PFAM: glycosyl transferase, family 2;
                     KEGG: she:Shewmr4_3884 glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001048477.1"
                     /db_xref="GI:126172328"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:4842232"
                     /translation="MVIKLWSVELISIVLPAKDEVGNIGHLMEEICQALQGLTEFEIF
                     VVDDGSQDDTFGEVMRTAAEQQCDAKAIRHERSTAISTGVLHARGKYIVTLDADGQND
                     PADIPAMFAQLPQIQAEHFCIAGYRKNRKDTAWKRFQSRFANKVRDALLHDGVPDTGC
                     GLKLIPRETFLRLPYFDHMHRYIPALVRRMGGEIFISVVNHRDRQVGISKYTAWNRRY
                     YGCDQAWAQSQSRQGCTQ"
     misc_feature    85127..>85729
                     /locus_tag="Sbal_0072"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    85136..85657
                     /locus_tag="Sbal_0072"
                     /note="DPM_DPG-synthase_like is a member of the
                     Glycosyltransferase 2 superfamily; Region:
                     DPM_DPG-synthase_like; cd04179"
                     /db_xref="CDD:133022"
     misc_feature    order(85145..85147,85151..85153,85391..85393)
                     /locus_tag="Sbal_0072"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133022"
     misc_feature    order(85241..85243,85388..85393)
                     /locus_tag="Sbal_0072"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133022"
     misc_feature    85385..85393
                     /locus_tag="Sbal_0072"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133022"
     gene            85831..86151
                     /locus_tag="Sbal_0073"
                     /db_xref="GeneID:4844192"
     CDS             85831..86151
                     /locus_tag="Sbal_0073"
                     /note="KEGG: shn:Shewana3_4086 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048478.1"
                     /db_xref="GI:126172329"
                     /db_xref="GeneID:4844192"
                     /translation="MKRLYKAIFIICILLVLILAAQQGLFEHVTDSNWVAHFIADKGR
                     FTLLVLLAIGALFTAVGGPRQVIAFVFGFALGGIYGGLFSTLAALLGCVLAFYVARLT
                     IRRC"
     gene            86215..86571
                     /locus_tag="Sbal_0074"
                     /pseudo
                     /db_xref="GeneID:4842895"
     gene            complement(86634..87449)
                     /locus_tag="Sbal_0075"
                     /db_xref="GeneID:4842352"
     CDS             complement(86634..87449)
                     /locus_tag="Sbal_0075"
                     /EC_number="3.2.2.23"
                     /note="Involved in base excision repair of DNA damaged by
                     oxidation or by mutagenic agents. Acts as DNA glycosylase
                     that recognizes and removes damaged bases"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="YP_001048479.1"
                     /db_xref="GI:126172330"
                     /db_xref="InterPro:IPR000191"
                     /db_xref="InterPro:IPR000214"
                     /db_xref="InterPro:IPR012319"
                     /db_xref="GeneID:4842352"
                     /translation="MPELPEVEVTRQGIAPFLVEQTVVDLVIRNGSLRWPVPDIAKQI
                     IGQVIRQVRRRAKYLLIDTDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRI
                     LRFNDPRRFGAWLWCELPEEAHPLLAKLGPEPLTQAFNVAQLAAALAGKKKAIKLCLM
                     DNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTL
                     KDFTNADGKPGYFAQKLHVYGRGGETCTSCGNLLSEIRLGQRTTVFCGICQTR"
     misc_feature    complement(86637..87449)
                     /locus_tag="Sbal_0075"
                     /note="formamidopyrimidine/5-formyluracil/
                     5-hydroxymethyluracil DNA glycosylase; Validated; Region:
                     PRK01103"
                     /db_xref="CDD:234899"
     misc_feature    complement(87096..87446)
                     /locus_tag="Sbal_0075"
                     /note="N-terminal domain of Escherichia coli Fpg1/MutM and
                     related bacterial DNA glycosylases; Region: EcFpg-like_N;
                     cd08966"
                     /db_xref="CDD:176800"
     misc_feature    complement(order(87117..87128,87180..87185,87225..87233,
                     87237..87239,87279..87281,87441..87446))
                     /locus_tag="Sbal_0075"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176800"
     misc_feature    complement(87444..87446)
                     /locus_tag="Sbal_0075"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:176800"
     misc_feature    complement(order(87225..87227,87279..87290,87414..87416,
                     87423..87428,87432..87443))
                     /locus_tag="Sbal_0075"
                     /note="H2TH interface [polypeptide binding]; other site"
                     /db_xref="CDD:176800"
     misc_feature    complement(order(87279..87281,87441..87443))
                     /locus_tag="Sbal_0075"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:176800"
     misc_feature    complement(87237..87239)
                     /locus_tag="Sbal_0075"
                     /note="turnover-facilitating residue; other site"
                     /db_xref="CDD:176800"
     misc_feature    complement(order(87117..87119,87123..87125,87228..87230))
                     /locus_tag="Sbal_0075"
                     /note="intercalation triad [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    complement(87225..87227)
                     /locus_tag="Sbal_0075"
                     /note="8OG recognition residue [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    complement(order(87120..87122,87180..87182))
                     /locus_tag="Sbal_0075"
                     /note="putative reading head residues; other site"
                     /db_xref="CDD:176800"
     misc_feature    complement(86784..87062)
                     /locus_tag="Sbal_0075"
                     /note="Formamidopyrimidine-DNA glycosylase H2TH domain;
                     Region: H2TH; pfam06831"
                     /db_xref="CDD:115485"
     misc_feature    complement(86637..86726)
                     /locus_tag="Sbal_0075"
                     /note="Zinc finger found in FPG and IleRS; Region:
                     zf-FPG_IleRS; pfam06827"
                     /db_xref="CDD:253933"
     gene            complement(87485..87940)
                     /locus_tag="Sbal_0076"
                     /db_xref="GeneID:4844027"
     CDS             complement(87485..87940)
                     /locus_tag="Sbal_0076"
                     /note="KEGG: shn:Shewana3_4083 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048480.1"
                     /db_xref="GI:126172331"
                     /db_xref="GeneID:4844027"
                     /translation="MALTRKQWNNVIIVACVFMVAVLTFMDNKTNNVPSDAQLLFDDN
                     APLSQLQLNGIWLHKQASQWECDTTVLNCDEWAKAWQTIRVSPLTAAPETTDNPQELV
                     IQIADIRDAQLWIYFPNEGALKSPAGNWYLVPPSLRAKLQPILDAKPAA"
     gene            complement(88030..89013)
                     /locus_tag="Sbal_0077"
                     /db_xref="GeneID:4845154"
     CDS             complement(88030..89013)
                     /locus_tag="Sbal_0077"
                     /note="together with moaC, is involved in the conversion
                     of a guanosine derivative (GXP) into molybdopterin
                     precursor Z"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="YP_001048481.1"
                     /db_xref="GI:126172332"
                     /db_xref="InterPro:IPR000385"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010505"
                     /db_xref="InterPro:IPR013483"
                     /db_xref="GeneID:4845154"
                     /translation="MSLMVDSFGRKVEYLRLSVTDRCDFRCVYCMTEDPCFLPKDHVL
                     HLEELAWIAQAFTELGVTKIRLTGGEPLVRTDCDQLVSLLGKLPGLTDLSMTTNGSRL
                     TKFAKPMFAEGLKRLNISLDTLNPTLFTQLTRNGKLDRVIDGIDSAIAAGFERIKINA
                     VILKQQNDNEVIDLVDFCRGRRLDIAFIEEMPLGEIDERKRARHCSSDEVKAIIESRY
                     PLQLSNKRTGGPARYYTMADSPIHIGFISPHSHNFCHECNRVRVTVEGQLLLCLGNEH
                     AVDLKSIVREFPADIERLKAAILTGINLKPKQHDFGNNQVQILRFMNATGG"
     misc_feature    complement(88033..89013)
                     /locus_tag="Sbal_0077"
                     /note="molybdenum cofactor biosynthesis protein A;
                     Provisional; Region: PRK13361"
                     /db_xref="CDD:237364"
     misc_feature    complement(<88498..88965)
                     /locus_tag="Sbal_0077"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(88531..88533,88654..88656,88720..88728,
                     88804..88809,88813..88815,88924..88929,88933..88935,
                     88939..88941,88945..88947))
                     /locus_tag="Sbal_0077"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(88084..88467)
                     /locus_tag="Sbal_0077"
                     /note="Molybdenum Cofactor Synthesis C; Region:
                     Mob_synth_C; pfam06463"
                     /db_xref="CDD:115139"
     gene            complement(89030..90841)
                     /locus_tag="Sbal_0078"
                     /db_xref="GeneID:4844099"
     CDS             complement(89030..90841)
                     /locus_tag="Sbal_0078"
                     /note="TIGRFAM: molybdenum cofactor synthesis domain;
                     molybdopterin-guanine dinucleotide biosynthesis protein B;
                     PFAM: molybdopterin binding domain; molybdopterin-guanine
                     dinucleotide biosynthesis MobB region; MoeA domain
                     protein, domain I and II; MoeA domain protein, domain IV;
                     KEGG: shn:Shewana3_4081 molybdopterin-guanine dinucleotide
                     biosynthesis protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="putative bifunctional molybdopterin-guanine
                     dinucleotide biosynthesis protein MobB/MoeA"
                     /protein_id="YP_001048482.1"
                     /db_xref="GI:126172333"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="InterPro:IPR004435"
                     /db_xref="InterPro:IPR005110"
                     /db_xref="InterPro:IPR005111"
                     /db_xref="InterPro:IPR008284"
                     /db_xref="GeneID:4844099"
                     /translation="MSNPFVNPLAIPVLGFCAYSGTGKTTLLKQLIPELNQRGLRLAV
                     IKHAHHNFDVDIPGKDSYEMRKAGARQMLVASHVRWALMTEDARDGDPELVHLLKQIE
                     ADKVDIVLVEGFKKLALPKIELHRAAHGKPFIYTQDENILAIACCDDTQLPSDALPNE
                     LRRLDLNNVSQIADFVIEYAQNWEAPLQYPISAVDACTIGDNKNLTVSQGLAQILSHV
                     SPVAEVEEIDLDALDNRVLASDSISPVDVPQQTNSAMDGYAFVYQDPMPATLKRVGEV
                     LAGHQYSGTLNAGETVRIMTGATVPVGADTVQPRELAKEVDGNVSFDGRILAGQHVRL
                     AGEDIARGQVALAKATRLSAAEQGLLGSLGLNRLNVYRRPTVAVFSTGDEVSQPGEAL
                     KANCIYDSNRFTIKAMAKRLGCDVIDLGIIEDSETALEATLAKAATLADVVISSGGVS
                     VGDADYIKTVLARLGKIDFWRISMRPGRPLAFGKIGDSLFFGLPGNPVAVMVTFLQFV
                     QPALRKLAGEVNWQAQLFPAISDETLRSRQGRTEFIRGIYQLGKDGRLHVSSTGNQGS
                     GMLSSMVKGNCLIIIGDDAEAVNAGETVFIQPFADLL"
     misc_feature    complement(89033..90838)
                     /locus_tag="Sbal_0078"
                     /note="putative bifunctional molybdopterin-guanine
                     dinucleotide biosynthesis protein MobB/MoeA; Provisional;
                     Region: PRK14491"
                     /db_xref="CDD:237729"
     misc_feature    complement(90311..90811)
                     /locus_tag="Sbal_0078"
                     /note="Molybdenum is an essential trace element in the
                     form of molybdenum cofactor (Moco) which is associated
                     with the metabolism of nitrogen, carbon and sulfur by
                     redox active enzymes. In E. coli, the synthesis of Moco
                     involves genes from several loci: moa; Region: MobB;
                     cd03116"
                     /db_xref="CDD:239390"
     misc_feature    complement(order(90767..90775,90788..90790))
                     /locus_tag="Sbal_0078"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:239390"
     misc_feature    complement(89045..90211)
                     /locus_tag="Sbal_0078"
                     /note="MoeA family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (MoCF), an
                     essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoeA;
                     cd00887"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(89057..89059,89141..89143,89264..89266,
                     89633..89635,89642..89644,89648..89650,89750..89752,
                     89756..89761,89768..89770,89774..89785,89828..89830,
                     90152..90154))
                     /locus_tag="Sbal_0078"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(89498..89500,89570..89572,89690..89692,
                     89696..89701))
                     /locus_tag="Sbal_0078"
                     /note="putative functional site; other site"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(89336..89338,89345..89347,89357..89362,
                     89492..89500))
                     /locus_tag="Sbal_0078"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:238452"
     gene            complement(90875..91465)
                     /locus_tag="Sbal_0079"
                     /db_xref="GeneID:4841732"
     CDS             complement(90875..91465)
                     /locus_tag="Sbal_0079"
                     /note="TIGRFAM: molybdopterin-guanine dinucleotide
                     biosynthesis protein A;
                     KEGG: son:SO4722 molybdopterin-guanine dinucleotide
                     biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA"
                     /protein_id="YP_001048483.1"
                     /db_xref="GI:126172334"
                     /db_xref="InterPro:IPR013482"
                     /db_xref="GeneID:4841732"
                     /translation="MSSQIDAVILAGGMARRMGGDDKGLVELNGEAMIKHTIDRIKPQ
                     VKEILINANRNQTRYAEFGFKVISDEHTGFLGPLAGMITAMGQTDADYLLVVPCDCPL
                     LPTDLVPRMLAAIKAEDAEIAVASDGEYEQPVVLLLKPSLRDSMKAFLEAGERKVDFW
                     YAKHHFVVESFSDQPNAFVNVNTPEQKQRLAMEITK"
     misc_feature    complement(90908..91453)
                     /locus_tag="Sbal_0079"
                     /note="MobA catalyzes the formation of molybdopterin
                     guanine dinucleotide; Region: MobA; cd02503"
                     /db_xref="CDD:133000"
     misc_feature    complement(order(91169..91171,91175..91177,91226..91228,
                     91235..91240,91259..91261,91313..91315,91397..91399,
                     91424..91426,91430..91438))
                     /locus_tag="Sbal_0079"
                     /note="GTP binding site; other site"
                     /db_xref="CDD:133000"
     gene            complement(91449..92159)
                     /locus_tag="Sbal_0080"
                     /db_xref="GeneID:4841808"
     CDS             complement(91449..92159)
                     /locus_tag="Sbal_0080"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: shn:Shewana3_4079 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001048484.1"
                     /db_xref="GI:126172335"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4841808"
                     /translation="MTKVKLIARDLEMSFGARLLFKADALSLCQGDVIYLQGDNGTGK
                     STLMKILAGLMAPTKGKIETEGFAKNSWWRRNPLLGKAVYLHQHPYLFDGTVEYNLTY
                     GLNFSSETKAKAKQRITQAIEMAQLGSLLHARASNLSGGERQRLAIARAWILQPKLLM
                     LDEPTSNMDKDSQELVLKMIQQLKHEGTGMLLSSHQNCALTSICEQQWHIEGERVTTA
                     YQHPESLPAQESLYVIAN"
     misc_feature    complement(91515..92144)
                     /locus_tag="Sbal_0080"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    complement(91527..92084)
                     /locus_tag="Sbal_0080"
                     /note="First domain of the ATP-binding cassette component
                     of cobalt transport system; Region:
                     ABC_cobalt_CbiO_domain1; cd03225"
                     /db_xref="CDD:213192"
     misc_feature    complement(92025..92048)
                     /locus_tag="Sbal_0080"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    complement(order(91575..91577,91671..91676,91899..91901,
                     92022..92030,92034..92039))
                     /locus_tag="Sbal_0080"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213192"
     misc_feature    complement(91899..91910)
                     /locus_tag="Sbal_0080"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213192"
     misc_feature    complement(91719..91748)
                     /locus_tag="Sbal_0080"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213192"
     misc_feature    complement(91671..91688)
                     /locus_tag="Sbal_0080"
                     /note="Walker B; other site"
                     /db_xref="CDD:213192"
     misc_feature    complement(91653..91664)
                     /locus_tag="Sbal_0080"
                     /note="D-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    complement(91569..91589)
                     /locus_tag="Sbal_0080"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213192"
     gene            complement(92163..92870)
                     /locus_tag="Sbal_0081"
                     /db_xref="GeneID:4842739"
     CDS             complement(92163..92870)
                     /locus_tag="Sbal_0081"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: she:Shewmr4_3875 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_001048485.1"
                     /db_xref="GI:126172336"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:4842739"
                     /translation="MSDGWLALLQQALSLLFSLDPDVWSIISISFSVSFAALLITLVP
                     SMVLGFVLAFAPFRGKWIVTNLVQTLQSIPTVVIGLLVYLLLTRNGPLGDLKWLFTQE
                     GMILGQMLICAPVLIAMSQAAFTSVDRRAWETSRTLGASWCRAVWTVCRELRMPLLLA
                     IVAAFSRILTEVGCSMMVGGNILNVTRNIPTAIALETSKGDFAQAIALGLVLLILALI
                     LNFALGGLRGKAMPRSH"
     misc_feature    complement(92262..92765)
                     /locus_tag="Sbal_0081"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92265..92270,92298..92303,92340..92345,
                     92352..92363,92382..92384,92391..92396,92433..92435,
                     92484..92486,92493..92498,92508..92510,92514..92519,
                     92526..92528,92532..92534,92538..92543,92622..92624,
                     92628..92633,92640..92669,92673..92684,92712..92714,
                     92727..92732,92739..92744))
                     /locus_tag="Sbal_0081"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92346..92363,92622..92666))
                     /locus_tag="Sbal_0081"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92268..92270,92298..92300,92307..92309,
                     92343..92345,92556..92558,92622..92624))
                     /locus_tag="Sbal_0081"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92415..92417,92424..92429,92445..92483))
                     /locus_tag="Sbal_0081"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(92867..93691)
                     /locus_tag="Sbal_0082"
                     /db_xref="GeneID:4845529"
     CDS             complement(92867..93691)
                     /locus_tag="Sbal_0082"
                     /note="KEGG: shn:Shewana3_4077 extracellular
                     solute-binding protein, family 1"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_001048486.1"
                     /db_xref="GI:126172337"
                     /db_xref="GeneID:4845529"
                     /translation="MLNMKSHIKSLLGLIVAASMFTVLPAHSTEVIKLATTTSTENSG
                     LLKELLPKFESESGYKVQVIATGTGKALKLGEQGDVDLVMTHAPSAEAKFVADGFGVE
                     PRGIMENDFVVLGPKNDPAKIRDSKNAEEAFAKIAKSGVPFISRGDNSGNHIKELEVW
                     KAASVTPDFKGYTSVGQGMGKTLLMANEMQGYTLSDRGTFVAYKTKLDLGVDFDGGKT
                     LANPYQVILINSAKYPDLNHKGAKAFSDWLISKEGQSMINNFKVDGEQLFKATYSE"
     misc_feature    complement(92876..93610)
                     /locus_tag="Sbal_0082"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            93928..95358
                     /locus_tag="Sbal_0083"
                     /db_xref="GeneID:4844953"
     CDS             93928..95358
                     /locus_tag="Sbal_0083"
                     /note="PFAM: response regulator receiver; sigma-54 factor,
                     interaction domain-containing protein; helix-turn-helix,
                     Fis-type; ATPase associated with various cellular
                     activities, AAA_5;
                     SMART: AAA ATPase;
                     KEGG: shm:Shewmr7_3966 two component, sigma54 specific,
                     transcriptional regulator, fis family"
                     /codon_start=1
                     /transl_table=11
                     /product="two component, sigma54 specific, Fis family
                     transcriptional regulator"
                     /protein_id="YP_001048487.1"
                     /db_xref="GI:126172338"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:4844953"
                     /translation="MLELVANESKCPEADNMSQIDNNLKPLPSAVSVLIVDDEPGMRS
                     FLNKALSKKFALVETAGSIEDAEQLRSRCHFDLLIVDIRLPGRSGIEWHEALDEQGRR
                     SDIIFMTGYADMEVAITALRAGASDFIMKPFHLEQMMTAVDRCIERRLLKRENLMLRR
                     EVSIGYSSTIIGSSEAMKSVKHIIERVAPTNAVVLIQGESGTGKELVARQLHLLSGRQ
                     GPFVPVNCGSIAPELLESELFGHTAGAFTGAKGNREGLFSFASGGTIFLDEIGEMPLK
                     MQTALLRVLEQKAIRPVGSEKEVNIDVRVIAATNRTLIDEVDAGNFRRDLYYRLNVLD
                     ILIPPLRDRPEDVVELTHHFTRQLAAELGVREVVWSHEDMVKLQQHEWPGNIRELRNM
                     IERCILLGKPPAEYWKQQLKSESLSTSGYPLDWPLKEVEKHHVTSVVDLHSGNKSAAA
                     RDLGVSRKTLDRKYKEWFDFSGDQES"
     misc_feature    94021..95328
                     /locus_tag="Sbal_0083"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    94027..94365
                     /locus_tag="Sbal_0083"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(94036..94041,94168..94170,94192..94194,94252..94254,
                     94309..94311,94318..94323)
                     /locus_tag="Sbal_0083"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    94168..94170
                     /locus_tag="Sbal_0083"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(94177..94182,94186..94194)
                     /locus_tag="Sbal_0083"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    94318..94326
                     /locus_tag="Sbal_0083"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    94450..94944
                     /locus_tag="Sbal_0083"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    94519..94542
                     /locus_tag="Sbal_0083"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(94522..94545,94729..94731,94855..94857)
                     /locus_tag="Sbal_0083"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    94717..94734
                     /locus_tag="Sbal_0083"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    94912..94914
                     /locus_tag="Sbal_0083"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    95206..95328
                     /locus_tag="Sbal_0083"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            95360..97513
                     /locus_tag="Sbal_0084"
                     /db_xref="GeneID:4843421"
     CDS             95360..97513
                     /locus_tag="Sbal_0084"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase, HAMP region domain
                     protein; histidine kinase A domain protein domain protein;
                     KEGG: shn:Shewana3_4075 ATP-binding region, ATPase domain
                     protein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_001048488.1"
                     /db_xref="GI:126172339"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4843421"
                     /translation="MSFFTHFFGVSWQQMQAKVRYRILILTLLPILLTLVSLVFITIY
                     WNISYTGKQLFMKVKADLSVAENTLQQVQVRQEKQLERVVTSWTFQNDFRPLFSGKEL
                     TGEVIHRASLDAFLLEQKKQLNLDYLRLVTVAEAAADPDLRQILPKINGLLPYSGLMV
                     LPPERLSRIDPELAVTASIPIVATLRAQSPTKTVEERGLLSRSLLPVPDMQGKVAWYL
                     DGGILFNRDIRIVDHIRDLVYDKGTLPERSIGTVTIFLDNIRISTNVPLHFYPTGNET
                     QGRALGSLVSEEVKEKVLTQGEQWVDRAFVFNDWFISAYAPLEDIRGQRVGMIYTGFS
                     ESPFIHNYLLNIIELGTILMLVLLVSGLLVYRGAYSLLQPIERIHHVVQAVQSGRNIR
                     IGALGLDRDNELSNLAEQFDSMLDLLQRRNAQIQAAAEQLEMKVEERTRSLQDKTLEL
                     QRNVALLNETRQQLVTNEKLTALGELTAGIAHEINNPTAVILGNMELLRYELGDNAEV
                     VKEEIDLVIQQVGRISTIIRSLLQYSRPGEFNAPLEMHPITPIIEEMLVLVRHSIQKQ
                     EVVLITELNASCPVQVNRPQLLQVLINLVVNAAHAMDGKGRIWVRTYDWVQQDMPIGV
                     KIEVEDEGSGIAPEQLGRIFDPFYTTRKDGTGLGLSLSYGIIKRIGGTIEVSSTLGKG
                     TLFTIGLYHEAKEDQQNNPYEGLHIAGNDSDMSAD"
     misc_feature    96482..97420
                     /locus_tag="Sbal_0084"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    96767..96964
                     /locus_tag="Sbal_0084"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(96785..96787,96797..96799,96809..96811,96818..96820,
                     96830..96832,96839..96841,96893..96895,96905..96907,
                     96914..96916,96926..96928,96935..96937,96947..96949)
                     /locus_tag="Sbal_0084"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    96803..96805
                     /locus_tag="Sbal_0084"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    97118..97420
                     /locus_tag="Sbal_0084"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(97136..97138,97148..97150,97241..97243,97247..97249,
                     97253..97255,97259..97264,97325..97336,97382..97384,
                     97388..97390,97403..97408,97412..97414)
                     /locus_tag="Sbal_0084"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    97148..97150
                     /locus_tag="Sbal_0084"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(97253..97255,97259..97261,97325..97327,97331..97333)
                     /locus_tag="Sbal_0084"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(97864..98322)
                     /locus_tag="Sbal_0085"
                     /db_xref="GeneID:4844715"
     CDS             complement(97864..98322)
                     /locus_tag="Sbal_0085"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: she:Shewmr4_3871 acetyltransferase, GNAT family"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_001048489.1"
                     /db_xref="GI:126172340"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:4844715"
                     /translation="MYSIEIKAESGLTPELATQLIQLSQQIPELDRPLTSEVLNQRLQ
                     GKKCLILVAYVEGELAGFKMGYEQEEAIFYSWLGGVASDFRRLGLAQSLLKYQETWAR
                     RQGYNHIQVKTMNRFPAMLNLLISNQYLITELNADPKSLVDHKLHLRKSI"
     misc_feature    complement(97990..98175)
                     /locus_tag="Sbal_0085"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(98050..98055,98083..98088))
                     /locus_tag="Sbal_0085"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(98423..99082)
                     /locus_tag="Sbal_0086"
                     /db_xref="GeneID:4842729"
     CDS             complement(98423..99082)
                     /locus_tag="Sbal_0086"
                     /note="TIGRFAM: conserved hypothetical integral membrane
                     protein;
                     PFAM: protein of unknown function DUF165;
                     KEGG: son:SO4715 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048490.1"
                     /db_xref="GI:126172341"
                     /db_xref="InterPro:IPR003744"
                     /db_xref="GeneID:4842729"
                     /translation="MLMLTTAQLRRALFLLVGFHILIICVSNYLVQLPFQLFGYHTTW
                     GAFSFPFVYLATDLTVRIFGQQAARSIILKAMVPALMISYVMGVVFHQGSFQGADSLA
                     EWNTFVFRIAFASFAAYLIGQLMDIKVFARLRMSRSWWVAPAASTLVGNLVDTLVFFS
                     IAFYASSDSFMAANWPEIATVDYGFKLIVSLGLFLPAYGVLLKVLQDKILRTNPQESI
                     S"
     misc_feature    complement(98453..99082)
                     /locus_tag="Sbal_0086"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11212"
                     /db_xref="CDD:183041"
     gene            99315..100055
                     /locus_tag="Sbal_0087"
                     /db_xref="GeneID:4843419"
     CDS             99315..100055
                     /locus_tag="Sbal_0087"
                     /note="KEGG: she:Shewmr4_3869 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048491.1"
                     /db_xref="GI:126172342"
                     /db_xref="GeneID:4843419"
                     /translation="MRRFFAIFCLLLAVLPVSICAAQPIVVNVATASWDDFANRDETG
                     YYFELLQRVFPEPEWQLKVQFMPFARSLYLVEHNRTDITLSVYKGDTKKALLTENTVE
                     VDSIYVAVTAELAATWTGLESLSHKRVQAMLAYRYNMLTPVPMYYEESSDMLTMLNSL
                     NAGRIDAVLDYKSNLLMYVPKLKAPQNFVIIQGVLKAETYFAFANTEKGQMLKHHFDL
                     AHKRLIDSGEQDRLYLETLEKRRVDGEK"
     misc_feature    99315..100013
                     /locus_tag="Sbal_0087"
                     /note="ABC-type amino acid transport/signal transduction
                     systems, periplasmic component/domain [Amino acid
                     transport and metabolism / Signal transduction
                     mechanisms]; Region: HisJ; COG0834"
                     /db_xref="CDD:223904"
     gene            complement(100068..101426)
                     /locus_tag="Sbal_0088"
                     /db_xref="GeneID:4842915"
     CDS             complement(100068..101426)
                     /locus_tag="Sbal_0088"
                     /note="TIGRFAM: isochorismate synthases;
                     PFAM: Anthranilate synthase component I and chorismate
                     binding protein;
                     KEGG: she:Shewmr4_3868 isochorismate synthases"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="YP_001048492.1"
                     /db_xref="GI:126172343"
                     /db_xref="InterPro:IPR004561"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="GeneID:4842915"
                     /translation="MPVHALSEDLKSLIDKLIQLKQVPPTEPIVQLSLNTVAMPLISW
                     LASQTQFPRIYWHGRDRIEEVAAIGACKDFRFETGINDQQLAMAYQEQRALSTNQNIR
                     YYGGVAFDRTIESWPEFGNSRFILPRIEFRRSGSKFSLLVNLNFAENDHHSEIDKAIA
                     AIEAVMPAKPLSPPKKIVPLGRSDKPDFERWKTLVEQVVEPKFNQDTPKVVLSRLTQL
                     EVNEPIDPWMVMACWQGRNPNSFQFGFQFSPERTFISCSPERLFRRRQQELFTEALAG
                     TTVRGLSQEEDIALANALLEDNKNSVENQLVRSHIVNMLTPLSNYVGADELATIFKLN
                     HIQHLHRAIRAELKPGVNDFQLLQALHPTPAVGGLPRHSALNFIRQREGYTRGWYAGA
                     CGYFNKYESEFSVAIRSALFEPGRINLFAGAGIIAGSEPEAEWQELENKLATIMSILF
                     EM"
     misc_feature    complement(100080..101330)
                     /locus_tag="Sbal_0088"
                     /note="Isochorismate synthase [Coenzyme metabolism /
                     Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: MenF; COG1169"
                     /db_xref="CDD:224091"
     misc_feature    complement(100080..101126)
                     /locus_tag="Sbal_0088"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     cl10555"
                     /db_xref="CDD:263998"
     gene            101851..103974
                     /locus_tag="Sbal_0089"
                     /db_xref="GeneID:4842728"
     CDS             101851..103974
                     /locus_tag="Sbal_0089"
                     /note="PFAM: TonB-dependent receptor; TonB-dependent
                     receptor, plug;
                     KEGG: she:Shewmr4_3867 TonB-dependent receptor, plug"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor, plug"
                     /protein_id="YP_001048493.1"
                     /db_xref="GI:126172344"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:4842728"
                     /translation="MITTNTLFRVSSLALAIGLSFTVQADEIARDPRLNINEVIVVHG
                     DGGEASEMATTHWSISEEEIRATGAQSLDQVLKNVPGVYIRVGGDGTPRVDIRGFKTR
                     HVTLLVNGVPMSSADDGQFDPSIIPTSQIASVEVSVGPTSVLYGPSGAGGVINIITKQ
                     GSTAPALAGRLEAGKDNTFNGDISAAGSGDDWQGLVSVSRQQTDGFPMSNDFEPTQYQ
                     DGELRVNSDKEVTNVYAQGSYWLSDKTQLIANMALRSGEWGKPARDGTGSGKLKFERT
                     DDYDAHTFQLGLAHQFDDTFTLRGFGYHNQSDTLEASYADETYQAVRLSQDGRSVVQG
                     VNLQLITDLHTAGLFTTSVIAEKQSWKSVVDTYTPNTGSNNGGTTGSGGGTGTGGGTG
                     TGGGTGTGGGTGTGGGTGTGGGTGTGGGTGTGGAENLNDSAWLYTAAAEYQYQSELQY
                     GFTLGGAYHSLDTTDSTDGNYSAMASSYWQAAQDSRLSLSVARKVRFPSMVNLYSQLS
                     GNRDLEAEESKHVELGLEQNLPASNDFSLYGYYTDAKNYIAKDVDGFYQNMGRYKFKG
                     VDFQINNHAIEHLDLSFSYSLLDSEEIDGDDTLDALQYRPRHQLRWQMSYEFPFETQV
                     HLNVERILDQVYATQVKVGGQTQYQQQSLDNYTLVDVNLVQPLIRDKLDVYLRATNLL
                     DENYYQSEALPQAGRQIFIGVNWQI"
     misc_feature    102019..103968
                     /locus_tag="Sbal_0089"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     misc_feature    102025..103968
                     /locus_tag="Sbal_0089"
                     /note="Outer membrane cobalamin receptor protein [Coenzyme
                     metabolism]; Region: BtuB; COG4206"
                     /db_xref="CDD:226664"
     gene            103976..105346
                     /locus_tag="Sbal_0090"
                     /db_xref="GeneID:4845430"
     CDS             103976..105346
                     /locus_tag="Sbal_0090"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: shm:Shewmr7_3959 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001048494.1"
                     /db_xref="GI:126172345"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4845430"
                     /translation="MKLLALEGVSFNYGSQLPTVLQEVNLAIGTGQCHCVSGPTGSGK
                     SSLLNLLAGVLNRPHEGHIWRYPQLVTGLVMQDPQTQLLRQTVGAEVAFALENLGIPA
                     EQMLPKVQLALRRVGLYLRLDTQVSTLSLGQKYRLMIAAQLVCEPHLLLLDEPWAQLD
                     DHGVSELLVVLRNLIQDGMALVLVEHNASAFAEIIQHYWQLEAGKLSEGIYTVTDAPQ
                     TEAPAWRNQPKFEHLGKVLVSAEAFEFGFDACPTLFACPQGFQLQAGEIVTLVGDNGS
                     GKTSLLKTIAGVLSSRQRLPLKVLGRRPKLGIYGAELGLLMQRPSRQLFETSVLAEMQ
                     FSLRRFELPKERAAQMLDELDLFSLAQLSPHKLSYGQQHLIALASLACLRPKVLLLDD
                     PLAGMDKHYYGKVWYLLKRLSSQGCAILLSSHRSIEHSAVSRQLSLRNGLLVEELIET
                     GERYVG"
     misc_feature    103976..104593
                     /locus_tag="Sbal_0090"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    103991..104590
                     /locus_tag="Sbal_0090"
                     /note="First domain of the ATP-binding cassette component
                     of cobalt transport system; Region:
                     ABC_cobalt_CbiO_domain1; cd03225"
                     /db_xref="CDD:213192"
     misc_feature    104087..104110
                     /locus_tag="Sbal_0090"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    order(104096..104101,104105..104113,104201..104203,
                     104432..104437,104531..104533)
                     /locus_tag="Sbal_0090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213192"
     misc_feature    104192..104203
                     /locus_tag="Sbal_0090"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213192"
     misc_feature    104360..104389
                     /locus_tag="Sbal_0090"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213192"
     misc_feature    104420..104437
                     /locus_tag="Sbal_0090"
                     /note="Walker B; other site"
                     /db_xref="CDD:213192"
     misc_feature    104444..104455
                     /locus_tag="Sbal_0090"
                     /note="D-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    104519..104539
                     /locus_tag="Sbal_0090"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213192"
     misc_feature    104753..105298
                     /locus_tag="Sbal_0090"
                     /note="First domain of the ATP-binding cassette component
                     of cobalt transport system; Region:
                     ABC_cobalt_CbiO_domain1; cd03225"
                     /db_xref="CDD:213192"
     misc_feature    104753..105247
                     /locus_tag="Sbal_0090"
                     /note="cobalt transport protein ATP-binding subunit;
                     Region: cbiO; TIGR01166"
                     /db_xref="CDD:130234"
     misc_feature    104789..104812
                     /locus_tag="Sbal_0090"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    order(104798..104803,104807..104815,104927..104929,
                     105146..105151,105245..105247)
                     /locus_tag="Sbal_0090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213192"
     misc_feature    104918..104929
                     /locus_tag="Sbal_0090"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213192"
     misc_feature    105074..105103
                     /locus_tag="Sbal_0090"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213192"
     misc_feature    105134..105151
                     /locus_tag="Sbal_0090"
                     /note="Walker B; other site"
                     /db_xref="CDD:213192"
     misc_feature    105158..105169
                     /locus_tag="Sbal_0090"
                     /note="D-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    order(105233..105250,105254..105256)
                     /locus_tag="Sbal_0090"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213192"
     gene            105336..106016
                     /locus_tag="Sbal_0091"
                     /db_xref="GeneID:4843304"
     CDS             105336..106016
                     /locus_tag="Sbal_0091"
                     /note="PFAM: cobalt transport protein;
                     KEGG: she:Shewmr4_3865 cobalt transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transport protein"
                     /protein_id="YP_001048495.1"
                     /db_xref="GI:126172346"
                     /db_xref="InterPro:IPR003339"
                     /db_xref="GeneID:4843304"
                     /translation="MWASCRRLRALRHWSYERRETALCALSLLLVCVLSACAFVLPAA
                     LLLPLAGLNGLLVIHGLLRRGSIWGVLKLGLVQLSITLSLYLILYGVEHLAQGAVVVT
                     RIILATIPGWWLCITTAPERIGEVLSAFLPTKWAFVVAASLSLLPYMADEIREIYQIQ
                     CLRGARITPKALRNPKNWSELVYCVLFPVLIQLLKLSRQMAVAAQCRHFGLAQRPTHW
                     HSPRDKND"
     misc_feature    <105519..105992
                     /locus_tag="Sbal_0091"
                     /note="Cobalt transport protein; Region: CbiQ; cl00463"
                     /db_xref="CDD:260439"
     gene            106009..106551
                     /locus_tag="Sbal_0092"
                     /db_xref="GeneID:4843213"
     CDS             106009..106551
                     /locus_tag="Sbal_0092"
                     /note="KEGG: shm:Shewmr7_3957 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048496.1"
                     /db_xref="GI:126172347"
                     /db_xref="GeneID:4843213"
                     /translation="MTKKIPLSLQDSLFVGFCATLLVALTGMLRLKLGLSGHSMFLMS
                     FFYLICYGVLGRFGSMTACGVIAGIVAMALGVGKGGPMILLKFALPAIAMDLVALLLP
                     LSMNLHWRCVILGIAGCIAWAGKVALTNMLAGMALDVVMIQWGLSVLKGGFFATLGAL
                     LVPPVLTRLKAHDLLHRDKF"
     gene            106581..107033
                     /locus_tag="Sbal_0093"
                     /db_xref="GeneID:4845057"
     CDS             106581..107033
                     /locus_tag="Sbal_0093"
                     /note="KEGG: she:Shewmr4_3863 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048497.1"
                     /db_xref="GI:126172348"
                     /db_xref="GeneID:4845057"
                     /translation="MKNWLICIDDTDDIGTKGTGEIAEEIAHLLANMSGGHASFVTRH
                     QLFVHPDIPYTSHNSAMCFALRSPLTQAEIHQHAVAHLVAESAPAADPGIAILDVDSY
                     YDAAALMDFGRRAKVEVITKAAAYDLAEQLNIQLTEHGGTGQGVLLVR"
     misc_feature    <106581..107021
                     /locus_tag="Sbal_0093"
                     /note="methanogenesis imperfect marker protein 11; Region:
                     methan_mark_11; TIGR03280"
                     /db_xref="CDD:213789"
     gene            107054..107320
                     /locus_tag="Sbal_0094"
                     /db_xref="GeneID:4845195"
     CDS             107054..107320
                     /locus_tag="Sbal_0094"
                     /note="KEGG: shm:Shewmr7_3956 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048498.1"
                     /db_xref="GI:126172349"
                     /db_xref="GeneID:4845195"
                     /translation="MGSDGRVKGQIKLGQFEDVSLELSVADILEQTGLDAVMSTDKYR
                     LALDERVQLKGKVKAVYLDHQFVLLVHQETEQWRNAGKQALQAY"
     misc_feature    <107057..>107230
                     /locus_tag="Sbal_0094"
                     /note="N-acetylmuramoyl-L-alanine amidase [Cell envelope
                     biogenesis, outer membrane]; Region: AmiC; COG0860"
                     /db_xref="CDD:223929"
     gene            107359..107598
                     /locus_tag="Sbal_0095"
                     /db_xref="GeneID:4841407"
     CDS             107359..107598
                     /locus_tag="Sbal_0095"
                     /note="KEGG: shm:Shewmr7_3955 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048499.1"
                     /db_xref="GI:126172350"
                     /db_xref="GeneID:4841407"
                     /translation="MDLNLVEHAFELKDDRWIFKAGLAQYPQARQVAKLCTRFIPDDE
                     DEQIDDEPRSCYNCQYRRWMVAGFECLALRHLLKK"
     gene            107832..109022
                     /locus_tag="Sbal_0096"
                     /db_xref="GeneID:4842890"
     CDS             107832..109022
                     /locus_tag="Sbal_0096"
                     /note="PFAM: metal-dependent phosphohydrolase, HD sub
                     domain;
                     SMART: metal-dependent phosphohydrolase, HD region;
                     KEGG: son:SO4711 HD domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_001048500.1"
                     /db_xref="GI:126172351"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:4842890"
                     /translation="MSESAESVELIKLPVSQLTLGMFVSAIDKNDKGQLAIANAGQIK
                     HKDAILKLAKSGIKFVWVDAERSAEHCGLKKKTTNDSQTDNRKAPVSRDKQQAQAKVM
                     LTEAKDLIRKVLSETFEGKAIEVAPFEALADTMIESVMLDADALKCMSALRSKDAYLL
                     EHSVNVAFLLVTFGKYLQLDRDMLRQMAVGGILHDIGKIKVDNKVLHKPGKLTPEEFE
                     HMKLHQVYELEIMNETTGLSQISKDICLMHHEKLDGRGYPRGLKDDEIPRHGRMSCIV
                     DIFDALTATRCYKEAMSPAAAFKILLSLTPFHLDQQLVYEFIRCIGIYPVGSLVELSD
                     GRIGIVWASKDRDALHPIVKCFYSLKVKRYTDVAMVDLLKSELYIERGVSPSSLDIDP
                     TPFY"
     misc_feature    107856..108221
                     /locus_tag="Sbal_0096"
                     /note="Domain of unknown function (DUF3391); Region:
                     DUF3391; pfam11871"
                     /db_xref="CDD:256688"
     misc_feature    107976..108893
                     /locus_tag="Sbal_0096"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    108303..108698
                     /locus_tag="Sbal_0096"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(108315..108317,108411..108416,108660..108662)
                     /locus_tag="Sbal_0096"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    108414..108416
                     /locus_tag="Sbal_0096"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            109135..109770
                     /locus_tag="Sbal_0097"
                     /db_xref="GeneID:4841935"
     CDS             109135..109770
                     /locus_tag="Sbal_0097"
                     /note="PFAM: Paraquat-inducible protein A;
                     KEGG: shm:Shewmr7_3953 paraquat-inducible protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="paraquat-inducible protein A"
                     /protein_id="YP_001048501.1"
                     /db_xref="GI:126172352"
                     /db_xref="InterPro:IPR007498"
                     /db_xref="GeneID:4841935"
                     /translation="MNSAMKSLFPIFIILLSLALLIPGVTQPILSISGTIDKAKLTEQ
                     GIEQVAQRFDEDSGRDSARGMLSMVSGLLGLNSLKGEVEVLQKTRSIWGTVTELYHSG
                     NGLVAGLVMLFSVVVPALKLSLMLAQQCVSSIGLKLRINAVVNALAKWSMADVFVVAL
                     IITFMAGNASGGMGEMLKTQAQFENGFYFFTAYCILSILSGFLVRRPTPIL"
     misc_feature    109366..109734
                     /locus_tag="Sbal_0097"
                     /note="Paraquat-inducible protein A; Region: PqiA;
                     pfam04403"
                     /db_xref="CDD:252573"
     STS             109433..110437
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     gene            complement(109845..110150)
                     /locus_tag="Sbal_0098"
                     /db_xref="GeneID:4843827"
     CDS             complement(109845..110150)
                     /locus_tag="Sbal_0098"
                     /note="KEGG: shn:Shewana3_4067 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048502.1"
                     /db_xref="GI:126172353"
                     /db_xref="GeneID:4843827"
                     /translation="MSTEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREH
                     SHFNIKEQVEGYREFCKFEIMHPAAQQAALLTALALVCKHNPCRYWIMPIYQNGTLS"
     misc_feature    complement(109848..110147)
                     /locus_tag="Sbal_0098"
                     /note="Protein of unknown function (DUF3240); Region:
                     DUF3240; pfam11582"
                     /db_xref="CDD:192778"
     gene            complement(110147..113200)
                     /locus_tag="Sbal_0099"
                     /db_xref="GeneID:4842961"
     CDS             complement(110147..113200)
                     /locus_tag="Sbal_0099"
                     /note="TIGRFAM: heavy metal efflux pump, CzcA family;
                     PFAM: acriflavin resistance protein;
                     KEGG: shn:Shewana3_4066 heavy metal efflux pump, CzcA
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="CzcA family heavy metal efflux protein"
                     /protein_id="YP_001048503.1"
                     /db_xref="GI:126172354"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /db_xref="GeneID:4842961"
                     /translation="MLTSVIRFSLTQRLFVLIVALIIMLAGARAWFSIPLDAFPDISP
                     TQVKIILKAPGMTPEEIEAQITVPIETELLGIPHQSILRSTTKYAISDITLDFDEGTD
                     IYWARQQVSERIAAVWDSFPEGVTGGVAPMSTPLSEIFMFSLENPNLSLMERRQLLEW
                     EIRPLLRTVAGVADVNILGGYAKSFSVTPKPAAMAAAGVSFAALQQAIVENNHNEGAG
                     KLTIGTDTIIVRAEGRIDDIDELKQLVIKADDARVYRLQDLADIQIGHLARYGAVTKD
                     GNETAEALIIALKDANTAQVVKNIKEKLDQISLTLPEGSQINTFYDRANLINTAIDTI
                     SNALFEAVVLVIILLALFLGNVRAALVVSLSLPLSALMTFLMMDYFNLSANLMSLGGL
                     VIAIGMLVDSSVVVVENMVNLIATKQRLPRLHLIFRATKDVAIPVVSGTVIVMIVFSP
                     LLTLSGLEGKLFTPVAVTIVFAMLSALVLSLTVIPVIASYLVNEKAAKEPKAIEKLKQ
                     LYLGSLKGTFSHQKRFIVIAFSLLIVSLGLFGLVGKTFMPTLDEGDIILQLEKSPSIS
                     LEASIAIDKQIQQTLLAKVTEIKQMVARTGADEIGLDPMGLNETDVFLELLPRSEWRF
                     ANKEALIDAIRTVLLDYPGVNFNFTQPIQMRVSEMLTGSIGDVAIKVFGNDIDTLGQL
                     TSQIQQLVNATSGSVDVKMAMIEGSPFINLTLDNELARGFGMSTMEFARYLKSQLEGV
                     IVTEVLQGKKRTPVLIANNQSHLSSINELKNQLLVMPDHSLKRLSDVATLSYKQGPIL
                     IEREQGNRFSVITTNVQGRDIVSFVEELNAKIAQEIKLPSGYSVSFGGEFENQQRATS
                     NLLLVIPIAIALITLILFTTFGSLAKAGLILANVPFAMMGGIVSLYLSGEYLSVPASV
                     GFIALLGVAVLNGVVMVSYYEQTKHMFSNLRERVEQGAARRLRPILMTATTAMFGLMP
                     LVFASGPGAEIQKPLAIVVIGGLLTSTITTLYLLPILYFWLEKRK"
     misc_feature    complement(110153..113200)
                     /locus_tag="Sbal_0099"
                     /note="Putative silver efflux pump [Inorganic ion
                     transport and metabolism]; Region: COG3696"
                     /db_xref="CDD:226220"
     misc_feature    complement(110174..>110719)
                     /locus_tag="Sbal_0099"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(113202..114230)
                     /locus_tag="Sbal_0100"
                     /db_xref="GeneID:4844719"
     CDS             complement(113202..114230)
                     /locus_tag="Sbal_0100"
                     /note="KEGG: shn:Shewana3_4065 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048504.1"
                     /db_xref="GI:126172355"
                     /db_xref="GeneID:4844719"
                     /translation="MMAKYGACLFCLSASVATLAQAESLTISSLGNLDLSYVQPQKVA
                     SYEGSPLPAQVEILPGNDYWISTPENIQQISFLVGQGQLVTKGQAIVKLTGPEVFHYL
                     AQVEAAGSLYQLAKSRYERNKPLLNNGSISAEKWREISQDYFSTHLEYEHMQHFMEIV
                     KSTDATTDSLVVGTPVAGIVKLNQVNGPYMAGSQLFSLVPSDSIRVKVSVPMSQSHSL
                     SAVNINQCHIAIESMSAIAEGAFVTAWSSPVPQECNLLLGQQITVIPEYQKAVYLLPK
                     NSVFSWEQDSQVFTKTADTLTSITIDILGSTPEQYIVESDQDLSQIQVLSQSVAAVKG
                     IMLGLGGE"
     misc_feature    complement(<113577..113720)
                     /locus_tag="Sbal_0100"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(114227..115450)
                     /locus_tag="Sbal_0101"
                     /db_xref="GeneID:4842434"
     CDS             complement(114227..115450)
                     /locus_tag="Sbal_0101"
                     /note="KEGG: shm:Shewmr7_3949 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048505.1"
                     /db_xref="GI:126172356"
                     /db_xref="GeneID:4842434"
                     /translation="MSVSTSCIKLCLLATLVSSSFLCHAANSELSQALSTSQARLHSL
                     SQSGGQLPQSQISLSSSSWLNGLPSISLSHLGSLDNGNSYEQELSLNLPIKSPALHSS
                     DKQIKQLTQGIQAQQVALQGLYLSGLLRQSLWEHRLAAVKLAKLNRKSQLLDKLHSQQ
                     KQLTDAGELPIAHILLLERELVDIALERVDLNQQQAEALALYQQLTGQDQIPQDITET
                     ARPLSASSQPNDILAQHPLWQLLSLQKQQQLLIIQSQQAGDKDPWTVSLTAKNTADNQ
                     VDDQQLGIAVSVPLTLGSALSQTELSQWQQANTEHTLNLDRTYIELKTQLKKLEQQQQ
                     NLLDQQTLLTQALHLSRTITEELAKVKDQNQVSYEVWLRRYMDALDTESRLALNQVAQ
                     QQLHSQQLQALGISL"
     misc_feature    complement(<114821..>115144)
                     /locus_tag="Sbal_0101"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     gene            115596..116123
                     /locus_tag="Sbal_0102"
                     /db_xref="GeneID:4842896"
     CDS             115596..116123
                     /locus_tag="Sbal_0102"
                     /note="SMART: regulatory protein, LuxR;
                     KEGG: shn:Shewana3_4063 transcriptional regulator, LuxR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_001048506.1"
                     /db_xref="GI:126172357"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="GeneID:4842896"
                     /translation="MKDLVIIGLLALIICFKLFDISSDIQLGIPQWHIAQEAMLLVLT
                     VIGAMYLSYDLIRRSREVKALAKRLEHADKKIDNMSTQMRSARQEYSQAVSQQFETWG
                     FTKSEQQVAFLLLKGLSFKEIAEVRQTKEKTVRQQASTIYGKAAVDGRHTFCAWFMED
                     FIQEHNQDLAANEAA"
     misc_feature    <115842..116045
                     /locus_tag="Sbal_0102"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    115899..>116027
                     /locus_tag="Sbal_0102"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cl17315"
                     /db_xref="CDD:266624"
     misc_feature    order(115905..115913,115950..115958,115980..115985,
                     115989..115994,115998..116012,116043..116045)
                     /locus_tag="Sbal_0102"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(115938..115940,115944..115946,115950..115952,
                     116043..116051,116058..116060)
                     /locus_tag="Sbal_0102"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            116249..116401
                     /locus_tag="Sbal_0103"
                     /db_xref="GeneID:4845565"
     CDS             116249..116401
                     /locus_tag="Sbal_0103"
                     /note="KEGG: shm:Shewmr7_3947 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048507.1"
                     /db_xref="GI:126172358"
                     /db_xref="GeneID:4845565"
                     /translation="MQLKNWLIIAFCLIALVASTQTTGLVRSLIEFSAFVGVLCWAWR
                     MKPTAE"
     gene            complement(116428..117378)
                     /locus_tag="Sbal_0104"
                     /db_xref="GeneID:4842723"
     CDS             complement(116428..117378)
                     /locus_tag="Sbal_0104"
                     /note="PFAM: conserved hypothetical protein 698;
                     KEGG: shm:Shewmr7_3946 conserved hypothetical protein 698"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048508.1"
                     /db_xref="GI:126172359"
                     /db_xref="InterPro:IPR004630"
                     /db_xref="GeneID:4842723"
                     /translation="MNSSSTSQQDNKTHRIVFICAGLLCLAPFISSPMALVLGFTLAS
                     LGWVPVQWNIAALTKKLLSYSIIGLGFGINLNAAIEASTHNFGLIVGSIFFTLSLGFV
                     LTRALKFDHVTGHLIASGTAICGGSAIAAVAPAINARNDQTATALACVFVLNSVALFL
                     FPALGHLLNMSQYDFGVWSAIAIHDTSSVVGAASAYGDEALKTATTIKLARALWIIPI
                     ALVSAMLFGGDKRKLNLPYFIGFYCLAIAVAHWLPQFNAVYDTLFMMSKRALVLCLFL
                     IGAGITVQKMRASGPKPLLLGVMLWAAIGITSLVYILYFQ"
     misc_feature    complement(116431..117279)
                     /locus_tag="Sbal_0104"
                     /note="Conserved hypothetical protein 698; Region:
                     Cons_hypoth698; cl01075"
                     /db_xref="CDD:260777"
     gene            complement(117665..118228)
                     /locus_tag="Sbal_0105"
                     /db_xref="GeneID:4843215"
     CDS             complement(117665..118228)
                     /locus_tag="Sbal_0105"
                     /EC_number="2.3.3.9"
                     /note="Catalyzes the aldol condensation of glyoxylate with
                     acetyl-CoA to form malate as part of the second step of
                     the glyoxylate bypass and an alternative to the
                     tricarboxylic acid cycle"
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="YP_001048509.1"
                     /db_xref="GI:126172360"
                     /db_xref="GeneID:4843215"
                     /translation="MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFL
                     DRLFPLNSGSHQDVSSYVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQ
                     DLGCHVELSFDRSGMIGARDVANLEDIQIGTSLNMVVGTPESRSAASRHWLSLLHAGM
                     SSANDTQDKLFTAKDGSDYNLKSIVNL"
     misc_feature    complement(117668..118228)
                     /locus_tag="Sbal_0105"
                     /note="malate synthase; Provisional; Region: PRK08951"
                     /db_xref="CDD:181593"
     gene            118480..120009
                     /locus_tag="Sbal_0106"
                     /db_xref="GeneID:4843282"
     CDS             118480..120009
                     /locus_tag="Sbal_0106"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: shm:Shewmr7_3944 transcriptional regulator, XRE
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001048510.1"
                     /db_xref="GI:126172361"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:4843282"
                     /translation="MRNDQSLMRKSHFLGTKIRNLRKRNNLTMEDLSARCIRVDAGSA
                     PSVSYLSMIERGKRVPSAGMLAVIAAVFQKDADWFLDDVPEESAITPDKGRRGGISGM
                     ALEPSFLFSNDILQIAIPEMLSQTGISGRQFAHLLIRAHQEHHQNHFPDLERAAEEVG
                     LKRMPLSLDDMLDIAKGMGLKIKWIDSTPQEVIDDMGVSSRQLVTSFFEPPSTIYVNK
                     ILKNRPNRLKYDLAVHIGHCVLHNKDGLKSVMTSGRKEEVDEEAGMQSNTLNAQDILH
                     AWRDFESSFFAGALLCPKVPYRQLLDRHGYEIEVHKQLQVSASVAMRRMTVVSPYPHW
                     HYFDAYAPGKLKAVYRGNGIPLPWGNMRLVEDPCQHWAVFRMISEPTVGTSAQISILN
                     VGNEPRIYCCESIKVEDSAGNPHVLCAGIDLNPAIEAQGKDALSIAHDLKDACVASGG
                     SVTIPKHIKSDLVSVAKILNINWIERGIKNDARLICSRGAVCPRQPSCYQAGKSQCDG
                     E"
     misc_feature    118519..>118743
                     /locus_tag="Sbal_0106"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    118522..118716
                     /locus_tag="Sbal_0106"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(118534..118536,118546..118548,118642..118644)
                     /locus_tag="Sbal_0106"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(118543..118545,118639..118641)
                     /locus_tag="Sbal_0106"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(118564..118569,118621..118623,118630..118632,
                     118642..118647)
                     /locus_tag="Sbal_0106"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    119455..119979
                     /locus_tag="Sbal_0106"
                     /note="Protein of unknown function (DUF3612); Region:
                     DUF3612; pfam12268"
                     /db_xref="CDD:152703"
     gene            120570..121478
                     /locus_tag="Sbal_0107"
                     /db_xref="GeneID:4845000"
     CDS             120570..121478
                     /locus_tag="Sbal_0107"
                     /note="KEGG: pha:PSHAa0008 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048511.1"
                     /db_xref="GI:126172362"
                     /db_xref="GeneID:4845000"
                     /translation="MKELHFSIVSDSLLKTHKAKLSDCEYLELSSAREILSKILDHEE
                     LYDQVIESYVEAKSTMYEMSVRAISDSVKYDYIKNHNNRSKLNRLYFNVLNFSKLYLD
                     RHFHDGDKKSFVKSITASESSHDEVKKHRQDISKNNPDYIFGCKLRNYVQHASLPVKT
                     FTTGVRWSPEDNQSVAIFHVPLAKKKLIDSGIFSQQMLLKYGEKIDLHQIMDGYIYAI
                     SEMHLKSRQLIKNYMEKSLEVINLKRRQIELEHSSSLCDINVVDTEQGVSLCSLHVEW
                     FSVVEHLQKKNLHSLNFKRFTHIPYQ"
     gene            complement(121674..122000)
                     /locus_tag="Sbal_0108"
                     /db_xref="GeneID:4842924"
     CDS             complement(121674..122000)
                     /locus_tag="Sbal_0108"
                     /note="KEGG: sdn:Sden_2357 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048512.1"
                     /db_xref="GI:126172363"
                     /db_xref="GeneID:4842924"
                     /translation="MTATGELLTCFIAMGLLALSYFSHHRAVRNRPLTDAQARGFRTA
                     GTATLVLCYWLASRHYGPAYASVLLLGWVCLSSIILVILLSYKPRWLQPILPASAVVC
                     LLGLLY"
     misc_feature    complement(121677..121982)
                     /locus_tag="Sbal_0108"
                     /note="Protein of unknown function (DUF3325); Region:
                     DUF3325; pfam11804"
                     /db_xref="CDD:152240"
     gene            complement(121997..123601)
                     /locus_tag="Sbal_0109"
                     /db_xref="GeneID:4842055"
     CDS             complement(121997..123601)
                     /locus_tag="Sbal_0109"
                     /note="PFAM: PepSY-associated TM helix domain protein;
                     KEGG: shm:Shewmr7_1218 PepSY-associated TM helix domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY-associated TM helix domain-containing
                     protein"
                     /protein_id="YP_001048513.1"
                     /db_xref="GI:126172364"
                     /db_xref="InterPro:IPR005625"
                     /db_xref="GeneID:4842055"
                     /translation="MKDSFFRSMTWLHTWVGLLTCWVLFLVFFAGTAAYYRAEINIWM
                     QPENHGSQYDVNADNQQLILKGLTALAQQAPDAETWWVYLPTQRTPLLTYAWSEPAAE
                     GQRFGDYHQSFINPATGEALPKARESRGGDFLYRLHFDLYYMSVITARWIVGFCTMFM
                     LVAIISGIVIHKRIFKDFFSFRPGKGPRSWLDAHVASSVLALPFHLMITYTGLVTLMF
                     MYMPWGLNTQYGDETQAFYSQWKPIYSSSVPSGEAATMQSPQQLLASLNAAMPMSDEA
                     SSPIEMLQVEHLNDANARVTVRISPEHSLNQQAPWYRFSAVTGKLTEESTATSAANKT
                     QSTMIALHSGRFAGQGLRLLYLLAGITGCVMIATGAIMWAEKLAQKQHKSGQFKPGLA
                     LVKMLNLATFAGLPIALASYFYANRLLPVSFVDRENWEIHCFFISWALVALFACFKRD
                     KQTWQRLFLFTALLYGLLPLLNAMTSQYQLISNLQRQAYVLAGFDLMMLALAALFYMA
                     AKRLRSSQKVRAAQVTKATAELGIES"
     misc_feature    complement(122465..123601)
                     /locus_tag="Sbal_0109"
                     /note="Uncharacterized iron-regulated membrane protein
                     [Function unknown]; Region: PiuB; COG3182"
                     /db_xref="CDD:225723"
     misc_feature    complement(123479..123583)
                     /locus_tag="Sbal_0109"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_3;
                     pfam13706"
                     /db_xref="CDD:258004"
     misc_feature    complement(122951..123205)
                     /locus_tag="Sbal_0109"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_2;
                     pfam13703"
                     /db_xref="CDD:258001"
     gene            complement(123598..123966)
                     /locus_tag="Sbal_0110"
                     /db_xref="GeneID:4842106"
     CDS             complement(123598..123966)
                     /locus_tag="Sbal_0110"
                     /note="KEGG: bbr:BB3605 putative iron uptake protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048514.1"
                     /db_xref="GI:126172365"
                     /db_xref="GeneID:4842106"
                     /translation="MTEKTNITPPLTQRLMRWKMSAIWSDSLHIGNRCLAATFGGYLL
                     SAIATILLAQILPLSQVDRVLTAMMLSFTVYTCAVIWVFSVKSTWRYWLDLFALSGLL
                     YLAYLAAKALDINPIQGGGL"
     misc_feature    complement(123640..123723)
                     /locus_tag="Sbal_0110"
                     /note="Protein of unknown function (DUF3649); Region:
                     DUF3649; pfam12365"
                     /db_xref="CDD:257009"
     gene            complement(123959..127138)
                     /locus_tag="Sbal_0111"
                     /db_xref="GeneID:4843284"
     CDS             complement(123959..127138)
                     /locus_tag="Sbal_0111"
                     /note="PFAM: acriflavin resistance protein;
                     KEGG: csa:Csal_2405 acriflavin resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="YP_001048515.1"
                     /db_xref="GI:126172366"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="GeneID:4843284"
                     /translation="MLKFGIKHGTLLSVIVLIFCVLGTAAALRIPIQMIPDLDVRTIS
                     VATGWPGATPQDVEKEILLEQERYLRTLPNLQRMTSWADTGSAWVELEFPQSTEISDA
                     LIRVSNALSQVSSYPENVDQPRLYSSSYSDNAFMYFRLVPVAGNPLNLDIDMMRDFAN
                     DFIRPQMERVKGVSSVTIQGGAERQIQILLDPAKLAQRGISIMDVRQAIRDRNKDTSA
                     GDIDSGKKRYLLRVIGRFEDLNQLKQLILKRQGNTNILLQDVAEIKLDHAEIRELSFA
                     EQERTLSLAVKRDVGSNVIAIKAAMMPVVAQINQNQLAQHAMQLELFSDDVRYVQDSV
                     ANVWVNLGLGALLATLVMYLFLRSSRATLIGVIGIPLCTLAAFVGLLVFNRTINVISL
                     AGVAFAIGMTVDNSIVVLESIEQARRRGLNRLEAAISGIYDVWPAVLASTLTTVLVFV
                     PILFIKQEAGQLYSDIAIAIASSIIASMLVAVFIVPAAIARFGFGKMHSAQTNQSEPP
                     KASRILSLVSQLVLSAKRRAAVIVLSLVSTIGLAAWLMPPAEYLPEGEEPKAFTSMVA
                     PPGYNLSEMAKIAEELTTQLSARVNAEATSFESGEQKIPPLKYYTLSVGVGSIWVMSE
                     PVRSQDMEAMMSSLTALFEQYPGMRAYSSRGSIISSNDGGTRAVALDISGPNQASLYR
                     AAEAAYQAAEKVFAEPQLYSDPSTLSLDQPLWQISPRWQRLVEQDFSGSEFGYAVSAL
                     SDGAYVDEFFLNDNKVDIFLFSLAGNQQSLSQLALAPIVTPKGNVLPLQALADISEQM
                     DSDSLRRVDGRRTVTLYIIPPRAIALETAVAKVREELVPILYQQGAVGKDVSLDISGA
                     ADQLEATKAALSSNFLVAVLIIYLLLVAIFNHWGYPLFVLVTIPLGLAGGLVGLQALN
                     YTGSLFAYLGGQGWHQPFDMITMLGFLILLGTVVNNPILIVEQSRKNLQSGLFSVVDA
                     VKSAVANRLRPILMSTATTLFGLLPLVLFPGAGSELYRGVGIVVLAGLIVATLLSLTF
                     LPALLISVLSYTNRANLTASSAKVAHHHD"
     misc_feature    complement(124037..127138)
                     /locus_tag="Sbal_0111"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    complement(125774..>126088)
                     /locus_tag="Sbal_0111"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    complement(124034..>124573)
                     /locus_tag="Sbal_0111"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(127143..128192)
                     /locus_tag="Sbal_0112"
                     /db_xref="GeneID:4842764"
     CDS             complement(127143..128192)
                     /locus_tag="Sbal_0112"
                     /note="TIGRFAM: efflux transporter, RND family, MFP
                     subunit;
                     PFAM: secretion protein HlyD family protein;
                     KEGG: hne:HNE_2191 efflux transporter, RND family, MFP
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_001048516.1"
                     /db_xref="GI:126172367"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:4842764"
                     /translation="MRYLMIGLYLLCFAVHASAVPVTVALPQTGSTNELLPLSGSIKS
                     ARVARLSARTDGLVAKVLVDAGSQVRAGQPLLALDDTLAVHQLAQRQADVIAVKTMLA
                     EKQRLLTEAQTLSAQQLFPETERAIRQAALTEAEANLQSLTAALAHQKEVVARHQLMA
                     PFAGVISSKQTETGEWVNVGTEIFTLVSQEQLWLDIQVPQEMFQSVATATHVDIAADM
                     LPEQQFIGHVNALVPVSDHNARSFLVRLTIPEADGLLMPGTSATATFHLQRAQHSVVV
                     PQDALIRHPDGQFSVFTVQNNIAQRHTVQVGHTSAIGIEILSPLPKDAPVVIRGNESL
                     QDQQSVSVLNSVIGG"
     misc_feature    complement(127167..128129)
                     /locus_tag="Sbal_0112"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    complement(127911..128057)
                     /locus_tag="Sbal_0112"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(127419..127724)
                     /locus_tag="Sbal_0112"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(128220..128861)
                     /locus_tag="Sbal_0113"
                     /db_xref="GeneID:4843709"
     CDS             complement(128220..128861)
                     /locus_tag="Sbal_0113"
                     /note="KEGG: xcv:XCV0280 putative secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048517.1"
                     /db_xref="GI:126172368"
                     /db_xref="InterPro:IPR000585"
                     /db_xref="GeneID:4843709"
                     /translation="MKQALVLLTLLGGIAFSAQAHEVWLERSSDGSVKVQFGEPGSEY
                     ATAEELASLSAARIFDANAKAPLTATAQADHLLVKTQDGKSDVSFYADTAWQPWKTET
                     GLQAAILYARTGQEHTKALQDFEFTPVKSGDPEFVLSYKGAPLVNHPVQVYRPGFWSK
                     SFTTDAQGKFALDTPDAGRYLLVSNHTTEGKQTLAGNEVDSVLHITTTSFITQ"
     misc_feature    complement(128295..128810)
                     /locus_tag="Sbal_0113"
                     /note="Peptidase associated domain: C-terminal domain of
                     M14 N/E carboxypeptidase; putative folding, regulation, or
                     interaction domain; Region: Peptidase_M14NE-CP-C_like;
                     cl17499"
                     /db_xref="CDD:266731"
     gene            complement(128902..131088)
                     /locus_tag="Sbal_0114"
                     /db_xref="GeneID:4843299"
     CDS             complement(128902..131088)
                     /locus_tag="Sbal_0114"
                     /note="TIGRFAM: TonB-dependent siderophore receptor;
                     PFAM: TonB-dependent receptor; TonB-dependent receptor,
                     plug;
                     KEGG: pen:PSEEN2529 TonB-dependent siderophore receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_001048518.1"
                     /db_xref="GI:126172369"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010105"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:4843299"
                     /translation="MPPLSVLTSWRSPLIPVLLSTLTLTVQANTDPKQDEKEDTEQIE
                     RLNVVGTYTRAAMNSATGLSMSLKETPQSVTLITEEMISDKGLITMESVLNHTPGVTM
                     VGDASENSKIFVRGYALDSGVQIDGLITTSSSNVYSGSIDQGLDPVIAERVEVLKGAA
                     GILSGLGEPSATVNFIRKRPTDDTRATASVSYGSWNTYRLEADVSGWLTDSGNVKGRF
                     VSAVKKGDSFIDRYQRDTTVLYGVVETSLSTDTSLSLFADYQKSQTDGVYNWNSNPAF
                     YTDGTAVDFGRSYSSSQDWTHWDVTQKSLMAEFKHRFDNDWSLVSAYRIANATIDALA
                     FYPGDNIVKSTGEFVGPWGDTYAAQHDRESDTNSFNLYATGNFDLLGREHSAVIGFNY
                     GDNEFDNINTNSAPQRRYNVADQGNYPKPNLPNSPTNGQKNEQSQSGVYGTVRINVLD
                     SLKLMVGGRVSNWSYEKHDLVGNSTDATMEKTGIFIPYYGLVYDVTEQISVYASRTEI
                     FKPGTYFGEDGQLLEPAEGTNVEGGIKVALFDDTLNMSAAVYETNKDNEPEYAGKGQL
                     PSGDFIYESIDGITTKGYELEIAGRLTDLWDISGGYTHNDAEDEDGLRRQTYLPEDIF
                     KLTTKYNFEDILPGVTAGASWRWQSSTFYQGTIWGVDGAPNVAYRQAQSAYSLVDLMF
                     GYQITPSISMQVNINNIFDKNYNRSLWGYADFGEPRNATLSLRWTL"
     misc_feature    complement(128905..130941)
                     /locus_tag="Sbal_0114"
                     /note="Outer membrane receptor for ferric coprogen and
                     ferric-rhodotorulic acid [Inorganic ion transport and
                     metabolism]; Region: FhuE; COG4773"
                     /db_xref="CDD:227114"
     misc_feature    complement(128908..130872)
                     /locus_tag="Sbal_0114"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(130558..130584,130618..130650,
                     130699..130722,130738..130755,130786..130815,
                     130843..130872))
                     /locus_tag="Sbal_0114"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(130003..130005,130099..130101))
                     /locus_tag="Sbal_0114"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(131491..132738)
                     /locus_tag="Sbal_0115"
                     /db_xref="GeneID:4843230"
     CDS             complement(131491..132738)
                     /locus_tag="Sbal_0115"
                     /note="TIGRFAM: gamma-glutamyl phosphate reductase;
                     KEGG: shm:Shewmr7_3942 gamma-glutamyl phosphate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl phosphate reductase"
                     /protein_id="YP_001048519.1"
                     /db_xref="GI:126172370"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="GeneID:4843230"
                     /translation="MTLIKNLSQEAAKAALILAQVDEQLKNTVLLDMARSLREKSYEI
                     QSANLIDLHRATADNVAPAMLDRLTLTPERVEAMALGIETIAALPDPIGNERYIGQRP
                     NGLSISKMRVPLGVVCMIYEARPNVTADAGALCFKSGNAVILRGGKEALHTSKIIATI
                     LQSVLKQYGLPEALITVVPDPDRALMLELMQQRDYIDVIIPRGGEGLINFVSDNSKIP
                     VIQHFKGVCHLYVDKDADLDIALDLLLNGKTQRTGVCNALEALLVHQEIASQFLPKVA
                     KALAEHKVKINACTQSGGYFENCTYMEEDDFGQEYLDLEIAIRQVDHFDHAIQHIARF
                     GSQHTEVICTENEVTAARFQRAVDASVVMVNASSRFSDGSELGLGAEIGIATSKLHAY
                     GPMGLESLTAEKYLVSGTGQVRA"
     misc_feature    complement(131509..132726)
                     /locus_tag="Sbal_0115"
                     /note="Gamma-glutamyl phosphate reductase (GPR), aldehyde
                     dehydrogenase families 18 and 19; Region:
                     ALDH_F18-19_ProA-GPR; cd07079"
                     /db_xref="CDD:143398"
     misc_feature    complement(131974..131976)
                     /locus_tag="Sbal_0115"
                     /note="putative catalytic cysteine [active]"
                     /db_xref="CDD:143398"
     gene            complement(132787..133887)
                     /locus_tag="Sbal_0116"
                     /db_xref="GeneID:4845058"
     CDS             complement(132787..133887)
                     /locus_tag="Sbal_0116"
                     /EC_number="2.7.2.11"
                     /note="catalyzes the formation of glutamate 5-phosphate
                     from glutamate in proline biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl kinase"
                     /protein_id="YP_001048520.1"
                     /db_xref="GI:126172371"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="GeneID:4845058"
                     /translation="MTDLPWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQG
                     IQVVLVSSGSVAAGWHHFGEVDKPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLT
                     HGDLRNRDRYISIKDTIFSLLEHGLLPIINENDAVTADKLKVGDNDNLSAMLAAAADA
                     DTLIICSDVNGLYTQNPHENPDAQLIKQVTEINAEIYAMAGGASSAVGTGGMRAKIQA
                     AKKAISHGIETFIINGFDADSFNQLLKGQNPGTLFTPDEKPMQDHLHWMTHTSQAQGE
                     VIVENDFNISLDIHSEQLTSDDVVAINGDFSAGDTILVRKGDGTKLAKAKSNYSSCLL
                     SFITDQDDREFASEFQQKTGPIISEKNIAILE"
     misc_feature    complement(132790..133884)
                     /locus_tag="Sbal_0116"
                     /note="gamma-glutamyl kinase; Provisional; Region:
                     PRK13402"
                     /db_xref="CDD:184032"
     misc_feature    complement(133126..133866)
                     /locus_tag="Sbal_0116"
                     /note="AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes
                     glutamate-dependent ATP cleavage; G5K transfers the
                     terminal phosphoryl group of ATP to the gamma-carboxyl
                     group of glutamate, in the first and controlling step of
                     proline (and, in mammals, ornithine)...; Region:
                     AAK_G5K_ProB; cd04242"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(133243..133245,133255..133257,
                     133261..133263,133369..133374,133381..133389,
                     133840..133842))
                     /locus_tag="Sbal_0116"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(133477..133482,133486..133488,
                     133516..133518,133525..133527,133543..133548,
                     133588..133590,133594..133596,133654..133656,
                     133666..133668,133753..133755,133762..133767))
                     /locus_tag="Sbal_0116"
                     /note="homotetrameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(133708..133731)
                     /locus_tag="Sbal_0116"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(133450..133452,133483..133485,
                     133726..133728))
                     /locus_tag="Sbal_0116"
                     /note="putative allosteric binding site; other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(<132895..>132993)
                     /locus_tag="Sbal_0116"
                     /note="PUA domain; Region: PUA; cl00607"
                     /db_xref="CDD:260527"
     gene            complement(133899..135395)
                     /locus_tag="Sbal_0117"
                     /db_xref="GeneID:4845126"
     CDS             complement(133899..135395)
                     /locus_tag="Sbal_0117"
                     /note="TIGRFAM: SSS sodium solute transporter superfamily;
                     sodium/proline symporter;
                     PFAM: Na+/solute symporter;
                     KEGG: she:Shewmr4_3847 sodium/proline symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/proline symporter"
                     /protein_id="YP_001048521.1"
                     /db_xref="GI:126172372"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR011851"
                     /db_xref="GeneID:4845126"
                     /translation="MNYLAYISLAIYFIVMLAIGLFAYKKSTSDVSGYILGGRKVSPQ
                     VTALSAGASDMSGWMLMGLPGAMFLVGFETIYIALGLLIGALINYLVVAPKLRVYTEV
                     ADNALTIPEFFAKRFGNANGSIRIISAVIIVIFFTLYTSAGLVAGGKLFESAFGLNYD
                     IGLVVTLAVVVSYTLLGGFLAVSLTDFVQGCIMFVALVLVPVVAYQEFTSADTMLNFA
                     YQSIPHFTDAMQNVTMLGLISSLSWGLGYFGQPHIIVRFMAIRSVADIKTARHIGMGW
                     MTVTIVGALATGLVGIAYANKFGMKLTDPETIFIVFSELLFHPIISGFLLAAILAAIM
                     STISSQLLVSSSSLTEDIYRVISKKESTEKDMVKMGRFGVAGVAIVASLLALDRSSSV
                     LSLVSNAWAGFGAAFGPLVLFSLYKANLTHKAAIAGIVSGAATVLFWIYAPVLADGQA
                     LTTVVYEMIPGFAVSSVVIWIVSLLDTDPCAKTTKLFHKAGRVLAEDR"
     misc_feature    complement(133971..135380)
                     /locus_tag="Sbal_0117"
                     /note="Na(+)/proline cotransporter PutP and related
                     proteins; solute binding domain; Region: SLC5sbd_PutP;
                     cd11475"
                     /db_xref="CDD:212045"
     misc_feature    complement(order(134388..134393,134400..134402,
                     135231..135233,135240..135242))
                     /locus_tag="Sbal_0117"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212045"
     gene            complement(135739..137811)
                     /locus_tag="Sbal_0118"
                     /db_xref="GeneID:4842218"
     CDS             complement(135739..137811)
                     /locus_tag="Sbal_0118"
                     /note="PFAM: Fusaric acid resistance protein conserved
                     region;
                     KEGG: pha:PSHAa1079 hypothetical protein ; membrane
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein region"
                     /protein_id="YP_001048522.1"
                     /db_xref="GI:126172373"
                     /db_xref="InterPro:IPR006726"
                     /db_xref="GeneID:4842218"
                     /translation="MTLLLKSLFFPDRRTLIFAIKGVISMELALYVAMFLNLERPYWA
                     LVSAVFLQIRPESGLVIEKGLCQIGGTLVGALAGIAILNWFTPYPELALGLLACWIGL
                     NSGLSAMVRQQNFVYAFAMAGMTACLIVLIVMASPSTADSAKIFDVAQSRISEIVVGA
                     ICAVLVSSLLWPTKVKHSLQLHAKNTINHTLNYLALELDLQGEHTSRHEHIDTIMVSV
                     SALSDDSSAVIYEGPEGRGQSHAANFLCNKTLSLLAAIQIFGRLQRNHSHLVSEPLAK
                     SLANMRSSFTLMAQSSDYQECYKMARTLRYQLQQNLMQYRDRAPLETRLLKVAMELSA
                     DLIMVLKSYNVLTSHSAVQLNAPPMEFHRDPLIGVTTGLRSMAVFVIGASLWIGTGSS
                     AVLMMILLPVVFSIMMARQPLPMLTTILRRILVGITIAVPLTVFYALPLLAQSSGDFE
                     ILVLVLAGPFFIGLLALANRPTLPYGLGICVPFAVLVQPSNTISFAIENTVSNALAIF
                     VGVTVLYWLFKLITEPSQRLMQYRLLQSIQKDLVHIAQHDDPEPWFNARMGDRLLRIA
                     SYEKGSGKSSRVFTDLVFTALNLGHVSIRMRRMLQGISDTHLNLGLENALNLWQHNLG
                     QAFIACAHGQVAEEFKISSEALLEALAQCPLPHEQFTMITGMFERITLTFERTAHSIA
                     EQKNTSEK"
     misc_feature    complement(<136234..137790)
                     /locus_tag="Sbal_0118"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; cl19401"
                     /db_xref="CDD:267754"
     misc_feature    complement(135775..137769)
                     /locus_tag="Sbal_0118"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     gene            complement(137817..138680)
                     /locus_tag="Sbal_0119"
                     /db_xref="GeneID:4845877"
     CDS             complement(137817..138680)
                     /locus_tag="Sbal_0119"
                     /note="PFAM: secretion protein HlyD family protein;
                     KEGG: abo:ABO_1136 efflux transporter, membrane fusion
                     protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="YP_001048523.1"
                     /db_xref="GI:126172374"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:4845877"
                     /translation="MGKIFRISLTLIVVAVAGIAGHWIWSHYLYSPWTRDGRVRAEII
                     TIAPDVSGWVNQLNVKDNQVVNKGDVLFTVDDTRYKATIAELNAKAESQKLAWELAKH
                     KYKRRIGLTNDNLVSKETFDEAFINTELARTSYELAQAQLNTAQIDLARTQIHAPENG
                     TLINLSLRNGNYVSKGNSVFSLVKQDSFYITGYFEETKIPLVHIGQNADVSLMSGGHV
                     LHGKVTSIGKAIANTNVTTNGQLLPQIGQTFNWVRLSQRIPVDIQLDSIPKDIELSVG
                     MTVSIQLQTDK"
     misc_feature    complement(137838..138680)
                     /locus_tag="Sbal_0119"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     misc_feature    complement(138414..138551)
                     /locus_tag="Sbal_0119"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(137973..138224)
                     /locus_tag="Sbal_0119"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(138687..138899)
                     /locus_tag="Sbal_0120"
                     /db_xref="GeneID:4845654"
     CDS             complement(138687..138899)
                     /locus_tag="Sbal_0120"
                     /note="PFAM: protein of unknown function DUF1656;
                     KEGG: pha:PSHAa1077 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048524.1"
                     /db_xref="GI:126172375"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR012451"
                     /db_xref="GeneID:4845654"
                     /translation="MNSVMLKELAFDGLLFSPLIIFIPLAFLLSCITRLVLYQTGLYH
                     KLWREAWFEVGLFICYLALVIYLLGS"
     misc_feature    complement(138708..138878)
                     /locus_tag="Sbal_0120"
                     /note="Protein of unknown function (DUF1656); Region:
                     DUF1656; pfam07869"
                     /db_xref="CDD:254477"
     gene            complement(139069..140424)
                     /locus_tag="Sbal_0121"
                     /db_xref="GeneID:4841416"
     CDS             complement(139069..140424)
                     /locus_tag="Sbal_0121"
                     /EC_number="1.8.1.7"
                     /note="catalyzes the reduction of 2 glutathione to
                     glutathione disulfide; maintains high levels of reduced
                     glutathione in the cytosol; involved in redox regulation
                     and oxidative defense"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione reductase"
                     /protein_id="YP_001048525.1"
                     /db_xref="GI:126172376"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006322"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4841416"
                     /translation="MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVN
                     VGCVPKKVMWYGAHVAEAMNLYAKDYGFDVTVNKFDWNTLVENREAYIGRIHDAYGRG
                     FANNKVTLLNGYGRFVDGNTIEVDGEHYTADNILIATGGAPTIPDIPGAEYGIDSDGF
                     FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVEAM
                     ATEGPTLHTHSVPKAVVKNADDSLTLSLENGESITVDCLIWAIGRSPATGNIGLENTE
                     VQLDSKGYVITDEQQNTTHKGIYCIGDIMAGGVELTPVAVKAGRLLSERLFNGMTDAK
                     MDYSLIPTVVFSHPPIGTMGLTEPEARTHYGDDNVKVYTSTFTSMYTAVTAHRQACKM
                     KLVCAGKDEKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTM
                     R"
     misc_feature    complement(139072..140424)
                     /locus_tag="Sbal_0121"
                     /note="glutathione reductase; Validated; Region: PRK06116"
                     /db_xref="CDD:235701"
     misc_feature    complement(139828..140397)
                     /locus_tag="Sbal_0121"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(139678..139920)
                     /locus_tag="Sbal_0121"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(139072..139407)
                     /locus_tag="Sbal_0121"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            complement(140604..141167)
                     /locus_tag="Sbal_0122"
                     /db_xref="GeneID:4843850"
     CDS             complement(140604..141167)
                     /locus_tag="Sbal_0122"
                     /note="KEGG: son:SO4701 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048526.1"
                     /db_xref="GI:126172377"
                     /db_xref="GeneID:4843850"
                     /translation="MLAQHFYLIRTAVIALLLLFLPVIHSADARQLLELEPESEPSLE
                     SLSQSTQTAPLPLGTLLDSEGKPINLPDQEQSSFEYSAPTLTPAEPSKATKSTKDTQS
                     TKATKSKKLSRKQQLASREHVANDPNCRWLDKRMDQLEAQLGGKQDNAATHQADELSA
                     RQKEWQCLKCGAEGPAQNDHSNCQYRR"
     gene            complement(141335..142126)
                     /locus_tag="Sbal_0123"
                     /db_xref="GeneID:4842401"
     CDS             complement(141335..142126)
                     /locus_tag="Sbal_0123"
                     /note="KEGG: son:SO4700 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048527.1"
                     /db_xref="GI:126172378"
                     /db_xref="GeneID:4842401"
                     /translation="MATHSVKLMASILCTLGINGLSYNAFANESLESIESISSAGLSS
                     QNSQALAVTLDLGWDSQYVSQGRNNLQDGGIYWLNTAVQQDNITAYALVGRGDSQAYT
                     EWNIGLEYGFDVAENLEANVGYQRIEGYSNTRCHDNELFAELAYTAEPWLVPSASYVY
                     STEAAGYFVEVSLHSYWHVTDQLSLTPYITQGFDFKYRTEEHDGRNNLQFGLEASYQL
                     SSYMSIDGHISHSIAQEDIEQEAMANGDMSSQDETYAGIHFAITF"
     gene            142395..144434
                     /locus_tag="Sbal_0124"
                     /db_xref="GeneID:4843395"
     CDS             142395..144434
                     /locus_tag="Sbal_0124"
                     /EC_number="3.4.24.70"
                     /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
                     F;
                     KEGG: son:SO4699 oligopeptidase A"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="YP_001048528.1"
                     /db_xref="GI:126172379"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:4843395"
                     /translation="MSNPLLSGAKLPLFSQIKPEHIQVAVEHAIAQCRTKIDEVLQNQ
                     GPYTWDNLVAPLEQVDDELSQIWSPVSHMNSVTSTDEWRAAHDACLPLLSEYGTYVGQ
                     HQGLYQAYKALRASNEFAQLSQAQQRVIEHSLRDFELSGIGLDDAQKVRYGEMVKRLS
                     ELTSGFSNQLLDATQAWTKLITDEAELAGLPESAKAAAKAMADARELDGWLFTLDFPS
                     YLPVMTYSENRSLREECYRAFVTRASDQGPNAGEFDNSPLMDEILALRHELALLLGFD
                     SFADKSLATKMAETPAQVMAFLNELALRSKDQAKAEVAELRAFAEAQYGVSEMASWDL
                     SFYAEKLQQHKYEISQEILRPYFPEDKVLSGLFYTVSRLFGLKIVEQKDLDRWHKDVR
                     FFDIFDETGEHRGSFYLDLYARTGKRGGAWMDDCRVRRQTAHGLQKPVAYLTCNFNGP
                     VDGKSALFTHDEVTTLFHEFGHGIHHMLTKIDVAGVSGINGVPWDAVELPSQFMENWC
                     WQEEALAEISGHFETGEPLPKALLDKMLAAKNFQSGMMMLRQLEFSLFDFRMHHEYDP
                     AKGARIQETLDEVRRQVAVLTPPDFNRFQHGFAHIFAGGYAAGYYSYKWAEVLSADAF
                     SRFEEEGIFNPETGRRFLHNILEMGGSAEPMDLFKQFMGREPNIDALLRHSGIAA"
     misc_feature    142395..144431
                     /locus_tag="Sbal_0124"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    142452..144425
                     /locus_tag="Sbal_0124"
                     /note="Peptidase family M3 dipeptidyl carboxypeptidase
                     (DCP); Region: M3A_DCP; cd06456"
                     /db_xref="CDD:188995"
     misc_feature    order(143655..143663,143796..143801,143808..143810,
                     143886..143888,143895..143897,144042..144044,
                     144168..144173,144189..144194,144204..144212,
                     144222..144224,144231..144233)
                     /locus_tag="Sbal_0124"
                     /note="active site"
                     /db_xref="CDD:188995"
     misc_feature    order(143796..143798,143808..143810,143886..143888)
                     /locus_tag="Sbal_0124"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188995"
     gene            144619..145149
                     /locus_tag="Sbal_0125"
                     /db_xref="GeneID:4843041"
     CDS             144619..145149
                     /locus_tag="Sbal_0125"
                     /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048529.1"
                     /db_xref="GI:126172380"
                     /db_xref="GeneID:4843041"
                     /translation="MNLYFRLFWLLFWRTRHCRKIDFLGTSRITYRALPSDCDINFHL
                     TNSRYPAFMDLARTYMLAEMGLLKRFLKLKWMPIVNAAEFTYIRDIKPLKTFEIETKV
                     VGWDEKYFYIEQRFASERGLHCIVHVRGVFVCKGKQVPLDVLVKEAGYTDAAPELPPE
                     VVKWKAFLQLKKERNM"
     misc_feature    144700..145017
                     /locus_tag="Sbal_0125"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    order(144778..144780,144847..144849,144853..144855,
                     144934..144945)
                     /locus_tag="Sbal_0125"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            complement(145175..145822)
                     /locus_tag="Sbal_0126"
                     /db_xref="GeneID:4843088"
     CDS             complement(145175..145822)
                     /locus_tag="Sbal_0126"
                     /note="PFAM: Glutathione S-transferase, N-terminal domain;
                     KEGG: she:Shewmr4_3840 glutathione S-transferase,
                     N-terminal domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase domain-containing
                     protein"
                     /protein_id="YP_001048530.1"
                     /db_xref="GI:126172381"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="GeneID:4843088"
                     /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRIIDLRDPFSRKEFHQ
                     TYPQARVPLLKTHDELLVPESSIIIEYLDRHCNNSTQLLPQEPQRNLQVRLFDRIIDN
                     DINNPLFQLEKLKHTEDSNEFEIKQLEKQLLVQFQRLDTQLTQHHWVCGDSFTLADCA
                     LIPCLSYSFQHLNLLDLDEIVRYWQQAQLRGAWMLVQEEVLLAEMEETAGIRGIP"
     misc_feature    complement(145229..145822)
                     /locus_tag="Sbal_0126"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    complement(145604..145822)
                     /locus_tag="Sbal_0126"
                     /note="Glutathione S-transferase (GST) family, N-terminal
                     domain; a large, diverse group of cytosolic dimeric
                     proteins involved in cellular detoxification by catalyzing
                     the conjugation of  glutathione (GSH) with a wide range of
                     endogenous and xenobiotic...; Region: GST_N_family;
                     cd00570"
                     /db_xref="CDD:238319"
     misc_feature    complement(order(145613..145618,145625..145627,
                     145760..145765,145772..145777,145781..145786,
                     145790..145792))
                     /locus_tag="Sbal_0126"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238319"
     misc_feature    complement(order(145628..145633,145667..145675,
                     145790..145792))
                     /locus_tag="Sbal_0126"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:238319"
     misc_feature    complement(order(145613..145615,145622..145627,
                     145631..145636,145673..145675))
                     /locus_tag="Sbal_0126"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238319"
     misc_feature    complement(145268..145546)
                     /locus_tag="Sbal_0126"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cd00299"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(145322..145324,145334..145336,
                     145343..145348,145355..145357,145520..145522,
                     145541..145543))
                     /locus_tag="Sbal_0126"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(145409..145411,145517..145519,
                     145526..145531,145538..145543))
                     /locus_tag="Sbal_0126"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(145322..145324,145331..145333,
                     145505..145510,145520..145522))
                     /locus_tag="Sbal_0126"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            146030..146719
                     /locus_tag="Sbal_0127"
                     /db_xref="GeneID:4842100"
     CDS             146030..146719
                     /locus_tag="Sbal_0127"
                     /note="KEGG: shm:Shewmr7_3932 conserved hypothetical
                     3-methyladenine DNA glycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="YP_001048531.1"
                     /db_xref="GI:126172382"
                     /db_xref="GeneID:4842100"
                     /translation="MSQLERFSSIYARASERKGGAAGLEALLSGCLSDDEIRQYRDAE
                     LLSAMSRQVFQSGFVWRVVVNKWPEYEKSFFGFEPHKVLMLSPEQIQARASDATLIRH
                     LKKTQAIYDNALMIHDVAREHGSLAQLIAAWPTQDIIGLWALLKKRGTRLGGNTGPYF
                     LRGIGKDTFLLTDDVQGYFKAHKLVDAGFTSQTALKQVQAVFNQWQQESGRCLADISR
                     ILACSVGDNRI"
     misc_feature    146141..146683
                     /locus_tag="Sbal_0127"
                     /note="Methyladenine glycosylase; Region: Adenine_glyco;
                     cl01059"
                     /db_xref="CDD:260770"
     gene            complement(146852..147598)
                     /locus_tag="Sbal_0128"
                     /db_xref="GeneID:4843089"
     CDS             complement(146852..147598)
                     /locus_tag="Sbal_0128"
                     /note="KEGG: shn:Shewana3_4047 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048532.1"
                     /db_xref="GI:126172383"
                     /db_xref="InterPro:IPR010239"
                     /db_xref="GeneID:4843089"
                     /translation="MMIMKTRTKFLLSGALLSLAMTAQAADDNQLFGGTINANVNFAS
                     DYVFRGESETLDGDIPVVQGTLSWNHNEGWYAGVFSSNIKFADPNLEIVTAPFIGKAG
                     EFGDSGFTYDVMLFSYLYPGASYSNYTELWLKVGKQFGRANLQLEVTPTVDDWFGVDG
                     WHGVNYALHPSYNFDNGVKISGSVGYQDLSGEGAEGWGHWNLGLSKVFYGLNFDVRYH
                     GSTVDTDHKVYGTQTEIFDDRFVVGISKSF"
     misc_feature    complement(146855..147535)
                     /locus_tag="Sbal_0128"
                     /note="conserved hypothetical protein, proteobacterial;
                     Region: gcw_chp; TIGR02001"
                     /db_xref="CDD:233680"
     gene            147869..148369
                     /locus_tag="Sbal_0129"
                     /db_xref="GeneID:4843685"
     CDS             147869..148369
                     /locus_tag="Sbal_0129"
                     /note="KEGG: aeh:Mlg_2336 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048533.1"
                     /db_xref="GI:126172384"
                     /db_xref="GeneID:4843685"
                     /translation="MNYQRHSGQFKEAILNKLSQSGLSVRQFAEQEGINLSTLYSWQK
                     QFNTSGLNVSKVSSSDKWSSEEKFSVVLETASLSAVELSEYCRAKGLYPEQVNGWKQA
                     CIAGNTSTTLTSKAKTTPGQKTDKKRINELERELRRKDKALAEAAALLVLGKKFDAYW
                     KEKEED"
     misc_feature    147896..>148126
                     /locus_tag="Sbal_0129"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3415"
                     /db_xref="CDD:225949"
     misc_feature    <147917..148021
                     /locus_tag="Sbal_0129"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:257710"
     gene            148345..149409
                     /locus_tag="Sbal_0130"
                     /db_xref="GeneID:4841929"
     CDS             148345..149409
                     /locus_tag="Sbal_0130"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: sdn:Sden_2168 integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001048534.1"
                     /db_xref="GI:126172385"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4841929"
                     /translation="MEGKRGRLISLTDRQKHAQWICTAVASGARQDKACDVIGLSSRT
                     LQRWRIDGDISADKRPTATRPEPGNKLSQAERQAVIDVCNSEEFASLPPSQIVPILAD
                     RGEYIASESSFYRVLHTENMLHHRGKAKPRNVHKKPTSYTAKKANEVWSWDISYLPTT
                     VIGKHYYLYMIEDIYSRKIVGWEVHDSETGEQAAALLERTVWSEKCLKKDVVLHSDNG
                     APMKSLTMRAKMYDLGVVTSRSRPRVSNDNPYSESLFRTVKYHPRWPSEGFKSLEAAR
                     KWVNEFVYWYNNEHRHSRIKFVTPNQRHDGLDVGILAKRKALYQTKRNEHPKRWSKEE
                     RNWQPIGAVELNPEQHKEAA"
     misc_feature    148414..148698
                     /locus_tag="Sbal_0130"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    148468..148695
                     /locus_tag="Sbal_0130"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    148768..149121
                     /locus_tag="Sbal_0130"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    148792..149217
                     /locus_tag="Sbal_0130"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     misc_feature    149041..149244
                     /locus_tag="Sbal_0130"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            149555..149845
                     /locus_tag="Sbal_0131"
                     /db_xref="GeneID:4842595"
     CDS             149555..149845
                     /locus_tag="Sbal_0131"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: son:SOA0146 ISSod1, transposase OrfA"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001048535.1"
                     /db_xref="GI:126172386"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:4842595"
                     /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLY
                     NWKEKHEALKQGITLEESERDELKRLRRENKELRMEKEILKKASAFFAREMK"
     misc_feature    149564..149782
                     /locus_tag="Sbal_0131"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    149576..149836
                     /locus_tag="Sbal_0131"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            149905..150714
                     /locus_tag="Sbal_0132"
                     /db_xref="GeneID:4843190"
     CDS             149905..150714
                     /locus_tag="Sbal_0132"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: sdn:Sden_3021 integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001048536.1"
                     /db_xref="GI:126172387"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4843190"
                     /translation="MSVSKSGYYDWHKRPANVISLETLKLYRLVRQLFKQSRGSLGNR
                     EMVKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNP
                     VSANEVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALIKAYNL
                     RQPARGLVFHSDRGSQYTSKQFGRLLLSYGIRASMGDVGACWDNAVVERFFGSLKHDW
                     IFKVNQPTREFMKQDVTAYMKYYNLERLHSANGDLSPVEFENSQLKVSSLG"
     misc_feature    149905..150702
                     /locus_tag="Sbal_0132"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    149977..150141
                     /locus_tag="Sbal_0132"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    150220..150558
                     /locus_tag="Sbal_0132"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    150526..150693
                     /locus_tag="Sbal_0132"
                     /note="Integrase core domain; Region: rve_2; pfam13333"
                     /db_xref="CDD:257663"
     gene            complement(151077..152219)
                     /locus_tag="Sbal_0133"
                     /db_xref="GeneID:4843991"
     CDS             complement(151077..152219)
                     /locus_tag="Sbal_0133"
                     /note="PFAM: lipolytic enzyme, G-D-S-L family;
                     KEGG: cvi:CV2266 probable SPI2 translocated effector"
                     /codon_start=1
                     /transl_table=11
                     /product="GDSL family lipase"
                     /protein_id="YP_001048537.1"
                     /db_xref="GI:126172388"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="GeneID:4843991"
                     /translation="MPFRIVQGTIFVPLNTNTQHLNPTIPIKHVQPLLASSKYPHSLL
                     KYQHHKSVVKGPVSTQDTIDGPNQVTDFSHRLFEVAVNDHQERQQRLSKPLTGHDHAS
                     LNHIKRLVVIGDSLSDSEGRMKSKTLGIMLSSKQYHDGRFTNGFVWPDFISSPAYLNK
                     ELVNYAEGGAVAAKYSKLNPVFWFISNMERQIKKHDFRSNDLVILALGSNDYMTFDKK
                     DTQKVVHCYEKQITTLVENKKIKNILVTGIPDFTKTAYAQKQDEAYHASNSVLVSGHN
                     ASLSQKVTELAERYKAEGVNIQFFDFDNQFTELLDKADKAGYDTHTANSVGYVDIFGT
                     SKAFDPAHRHVFHDEVHPSQEVHQMLASRMSDYITGKFGKLTTIKN"
     misc_feature    complement(151122..151898)
                     /locus_tag="Sbal_0133"
                     /note="Fatty acyltransferase-like subfamily of the SGNH
                     hydrolases, a diverse family of lipases and esterases. The
                     tertiary fold of the enzyme is substantially different
                     from that of the alpha/beta hydrolase family and unique
                     among all known hydrolases; its...; Region:
                     fatty_acyltransferase_like; cd01846"
                     /db_xref="CDD:238882"
     misc_feature    complement(order(151167..151169,151176..151178,
                     151590..151592,151713..151715,151875..151877))
                     /locus_tag="Sbal_0133"
                     /note="active site"
                     /db_xref="CDD:238882"
     misc_feature    complement(order(151167..151169,151176..151178,
                     151875..151877))
                     /locus_tag="Sbal_0133"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238882"
     misc_feature    complement(order(151590..151592,151713..151715,
                     151875..151877))
                     /locus_tag="Sbal_0133"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238882"
     gene            152922..154133
                     /locus_tag="Sbal_0134"
                     /db_xref="GeneID:4843958"
     CDS             152922..154133
                     /locus_tag="Sbal_0134"
                     /note="KEGG: vpa:VPA1321 cytotoxic necrotizing factor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048538.1"
                     /db_xref="GI:126172389"
                     /db_xref="GeneID:4843958"
                     /translation="MPMHIFSKANSYDLLTPNLKNSDNASPIQLVSVRPLTEQERKNL
                     TKKNQTYSNFTKNNKSIKSANGLTKIKSLFDNSSGKNKIVSKRGLTIEVKKGSTEEAS
                     AQWKNDPLRNHFKSAELSLQSLLDKEAVLQGQLSPLIGKGIIDCHEKYEYLPFPITHI
                     QNDKNGMYVSSDTIESKTGLIYYTGDHIVPEELIPGSPLGQYFHQAVFDSNLHILAVD
                     NGNKGTVGISFDLNQVKEGQPILIHAGSLSGCSVVFATKSSKLFAFHAGQNNNENNDW
                     ITGEKGAESIAQSAGFLANDTSNTLPCTNNQELVSYLSSHFEQSAFIYCGHGDSVVSQ
                     SNVNCFDYDMGPKRDEARVGNAMALVSNNKGKISVNVLGDDLSIDSGSFETRSLQNST
                     FALFTDKEFSR"
     misc_feature    153288..154109
                     /locus_tag="Sbal_0134"
                     /note="Rho-activating domain of cytotoxic necrotizing
                     factor; Region: CNF1; pfam05785"
                     /db_xref="CDD:147761"
     gene            complement(154264..154970)
                     /locus_tag="Sbal_0135"
                     /pseudo
                     /db_xref="GeneID:4841360"
     gene            155332..155841
                     /locus_tag="Sbal_0136"
                     /db_xref="GeneID:4842353"
     CDS             155332..155841
                     /locus_tag="Sbal_0136"
                     /note="TIGRFAM: transcription elongation factor GreB;
                     PFAM: transcription elongation factor GreA/GreB domain
                     protein;
                     KEGG: she:Shewmr4_3810 transcription elongation factor
                     GreB"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="YP_001048539.1"
                     /db_xref="GI:126172390"
                     /db_xref="InterPro:IPR001437"
                     /db_xref="InterPro:IPR006358"
                     /db_xref="GeneID:4842353"
                     /translation="MSMKAHLITRQGWQTLDKELKYLWKEYRPQITLKVQEAAAQGDR
                     SENADYTYNKRLLRQIDGRVRYLVKRLEELKIVDYSPQQEGKIFFGAWFELENEAGDR
                     VRYRIVGKDELDTKLGYITIDSPMARALIGKQVDDEVVVQTPSGPKEWYINQIRYTPF
                     ETTLASEAD"
     misc_feature    155338..155802
                     /locus_tag="Sbal_0136"
                     /note="transcription elongation factor GreB; Reviewed;
                     Region: greB; PRK01885"
                     /db_xref="CDD:179345"
     misc_feature    155353..155559
                     /locus_tag="Sbal_0136"
                     /note="Transcription elongation factor, N-terminal;
                     Region: GreA_GreB_N; pfam03449"
                     /db_xref="CDD:251961"
     misc_feature    155575..155802
                     /locus_tag="Sbal_0136"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            156005..158368
                     /locus_tag="Sbal_0137"
                     /db_xref="GeneID:4842584"
     CDS             156005..158368
                     /locus_tag="Sbal_0137"
                     /note="PFAM: RNA binding S1 domain protein;
                     SMART: Resolvase, RNase H domain protein fold;
                     KEGG: son:SO4629 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S1 domain-containing protein"
                     /protein_id="YP_001048540.1"
                     /db_xref="GI:126172391"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="GeneID:4842584"
                     /translation="MQTNAHNIAQIIAQELNVREQQVAATITLLDDGATVPFVARYRK
                     EATGGLDDTQLRTLYTRLGYLRELNDRRQVILSSIQAQGKLTPELQRAIDDADSKTRL
                     EDLYLPFKPKRRTKGQIAIEAGLEPLADALLADRSADVEAKAAGYINSDAGFVDVKAV
                     LEGARYILMERYAEDAELLRKVREHLSQNSVLESRLIAGKEKEGAKFRDYFEHTEQLA
                     KIPSHRALAMLRGRNEGFLALSMNADPAAEAGQGSYCEVIISDHLGLKLGDSSVDQWL
                     KTVVTATWRIKIALQMETEFISQMRERAEAEAIKVFARNLGDLLMAAPAGAKATMGLD
                     PGLRTGVKVAVVDNTGKMLCHATIFPHAPQNLWEKSIRTLANLVKMHKVELIAIGNGT
                     ASRETDKLAAELIAAVKDTHPQLTKVMVSEAGASVYSASELAALEFPDLDVSIRGAVS
                     IARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSGSLEAVVEDCVNGVGVDLNMASA
                     PLLSQVAGLNKTLAKNVVDYRDANGQFKNRKELLKVPRLGPKAYEQAAGFLRIREGDN
                     PLDASSVHPEAYSLVETIAKTKQVELASLMGNSDLLRSIKPEEFITAEFGLPTVTDIL
                     AELDKPGRDPRGEFKTAKFKDGVEELKHLKPEMVLEGVVTNVTNFGAFVDIGVHQDGL
                     VHISSLTDKFISDPHTVVKAGDVVKVKVMEVDVERRRIGLSMRLDEAIDQSKSQQRPH
                     NPARTHNSKAPQSAKPAARPTQKQAPKAPANAAMGNAFADAFAKLKK"
     misc_feature    156023..158359
                     /locus_tag="Sbal_0137"
                     /note="Transcriptional accessory protein [Transcription];
                     Region: Tex; COG2183"
                     /db_xref="CDD:225094"
     misc_feature    156038..156616
                     /locus_tag="Sbal_0137"
                     /note="Tex-like protein N-terminal domain; Region: Tex_N;
                     pfam09371"
                     /db_xref="CDD:255322"
     misc_feature    156986..157291
                     /locus_tag="Sbal_0137"
                     /note="Likely ribonuclease with RNase H fold; Region:
                     YqgFc; smart00732"
                     /db_xref="CDD:128971"
     misc_feature    157490..157684
                     /locus_tag="Sbal_0137"
                     /note="Helix-hairpin-helix motif; Region: HHH_3;
                     pfam12836"
                     /db_xref="CDD:257337"
     misc_feature    157973..158173
                     /locus_tag="Sbal_0137"
                     /note="S1_Tex: The C-terminal S1 domain of a transcription
                     accessory factor called Tex, which has been characterized
                     in Bordetella pertussis and Pseudomonas aeruginosa. The
                     tex gene is essential in Bortella pertusis and is named
                     for its role in toxin expression; Region: S1_Tex; cd05685"
                     /db_xref="CDD:240190"
     misc_feature    order(157994..157996,158018..158020,158048..158050,
                     158054..158056)
                     /locus_tag="Sbal_0137"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240190"
     gene            158586..160550
                     /locus_tag="Sbal_0138"
                     /db_xref="GeneID:4841812"
     CDS             158586..160550
                     /locus_tag="Sbal_0138"
                     /note="PFAM: sulfatase;
                     KEGG: son:SO4628 sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_001048541.1"
                     /db_xref="GI:126172392"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="GeneID:4841812"
                     /translation="MQSGLSPRGHNNAHGPFRAIFIFSLLVLFITTASRIAFGLWQAD
                     RVAAVDGWSHLLIQGFRIDIATLCWLWGIAALGTALFSGDHLIGRLWQPILRVWLTVG
                     LWIILFLEASTPAFIEEYGIRPNRLYVEYLIYPKEVLSMLWAGRKLELIFSVLLTIGT
                     LWGGWVLSGKLTKNLRFPRWYWRPVLAVLIIATTLLGARSTLGHRPINPAMVAFADDP
                     LVNSLVINSAYSLVFAIKQMGSEEDASKVYGKLDNAEIIATIRQESGRPESAFTSTDI
                     PSLSFNQASYTGKPKNLVILLQESLGARFVGSLGGLPLTPNIDALSKEGWYFDNLYAT
                     GTRSVRGIEAVTTGFTPTPARAVVKLGKSQVGFFSIAELLKNHGYTTQFIYGGESHFD
                     NMRSFFLGNGFSDIIDQKDYKSPAFVGSWGASDEDLMRKANSEFERLHSEGKPFFSLV
                     FSSSNHDPFEFPDDRIELYEQPKQTRNNAAKYADYAIGEFFKLAKNADYWKDTIFIVV
                     ADHDSRVGGADLVPVSRFRIPGLILGDNLAPKRDHRIVSQIDLPPTLLSLIGISDSYP
                     MLGRDLTQVSDDWPGRALMQYDKNFALMEGKDVVILQPEKAAQGFEYNEKTEQLTPYA
                     PAAAALEKKALSWALWGSLAYQQELYRLPK"
     misc_feature    158643..160430
                     /locus_tag="Sbal_0138"
                     /note="Phosphoglycerol transferase and related proteins,
                     alkaline phosphatase superfamily [Cell envelope
                     biogenesis, outer membrane]; Region: MdoB; COG1368"
                     /db_xref="CDD:224287"
     misc_feature    159456..160268
                     /locus_tag="Sbal_0138"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            complement(160648..161205)
                     /locus_tag="Sbal_0139"
                     /db_xref="GeneID:4841369"
     CDS             complement(160648..161205)
                     /locus_tag="Sbal_0139"
                     /note="KEGG: she:Shewmr4_3807 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048542.1"
                     /db_xref="GI:126172393"
                     /db_xref="GeneID:4841369"
                     /translation="MLVVSNYPQVPLATSNVATDSARVDNQLKPVVIPPQAATKGHEE
                     RAFNPQNERTADQTQQQTKTLENNQQQVQEKQQQQQSSQQQSQQQQEKKAPLVVAERV
                     LPKTLKVAARGQAALQRKDIRLKVSQGAANYASSNAKANTSSAARQSLQGEPTQFYQQ
                     LGQRIGQFYQQQTQPEQESIMSTWI"
     gene            complement(161267..161989)
                     /locus_tag="Sbal_0140"
                     /db_xref="GeneID:4845351"
     CDS             complement(161267..161989)
                     /locus_tag="Sbal_0140"
                     /note="TIGRFAM: bioH protein;
                     PFAM: alpha/beta hydrolase fold;
                     KEGG: shn:Shewana3_4010 BioH protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bioH protein"
                     /protein_id="YP_001048543.1"
                     /db_xref="GI:126172394"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR010076"
                     /db_xref="GeneID:4845351"
                     /translation="MLHGWGVNSAVFTPLHESLSQYRVHYVDLPGFGHSQMVEGDLLA
                     WVDVLVAALPEHAIWAGWSLGGLVATQAALSYPQKIKGLITIASSPCFMAREDEAWPG
                     IPPQVLNQFREQLGQNLPKTIERFLAIQAMGSETAKEDIKRLRDLVLARPLPDARALT
                     QGLTMLTDIDLRQQLTGLQQPWLRIWGRLDGLVPKRVQPKMPITPQIEDVMLAKASHA
                     PFISHQQEFLQIFMPWLALQTR"
     misc_feature    complement(161297..161989)
                     /locus_tag="Sbal_0140"
                     /note="pimelyl-[acyl-carrier protein] methyl ester
                     esterase; Region: bioH; TIGR01738"
                     /db_xref="CDD:130799"
     misc_feature    complement(<161738..161950)
                     /locus_tag="Sbal_0140"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            162094..162885
                     /locus_tag="Sbal_0141"
                     /db_xref="GeneID:4844611"
     CDS             162094..162885
                     /locus_tag="Sbal_0141"
                     /note="KEGG: shm:Shewmr7_3881 competence protein ComF"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComF"
                     /protein_id="YP_001048544.1"
                     /db_xref="GI:126172395"
                     /db_xref="GeneID:4844611"
                     /translation="MSRFVKRIWPPSAWRIVCLGYQLSTRWLAGSLPNRCLLCHQSIP
                     IPETGICIVCLQSGLYHGPICLGCGKSMQIEVDYCGECQKRQPRKVVAPCSYHQGLGA
                     WIGAIKYQGQLAALPVLCRALVARIKLLEQQGLIMLPQAIVPVPLHPKRLQQRGFNQA
                     WLIAHELSQLLQLPLVSEGLTRQQDTRPQAGLSGAQRRRNLHDAFMLADDFAFQRIAL
                     VDDVVTTGTTVSEIARLFEARYVHVQVWCLARAEAPGLLDDLDNE"
     misc_feature    162139..162846
                     /locus_tag="Sbal_0141"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    162448..162858
                     /locus_tag="Sbal_0141"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(162529..162531,162556..162558,162751..162759,
                     162763..162777,162844..162846)
                     /locus_tag="Sbal_0141"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            163127..163705
                     /locus_tag="Sbal_0142"
                     /db_xref="GeneID:4845606"
     CDS             163127..163705
                     /locus_tag="Sbal_0142"
                     /note="cytoplasmic protein that may be involved in the
                     utilization of double-stranded DNA as a carbon source"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA uptake protein"
                     /protein_id="YP_001048545.1"
                     /db_xref="GI:126172396"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="GeneID:4845606"
                     /translation="MITISDAAQAHFVKLLADQPEGTHIRVFVISPGTSQAECGVSYC
                     PPDAVESDDIEIEFTGFNAMVDEKSAPFLEDATIDFVTDQLGSQLTLKAPNAKMRKVS
                     GDAPLVERIEYVIQSEINPQLAGHGGNIMLVEITKEGVAVLQFGGGCNGCSQVDITLK
                     DGIEKQLLDMFPGELTGVRDVTDHQHGEHSYA"
     misc_feature    163127..163699
                     /locus_tag="Sbal_0142"
                     /note="Fe/S biogenesis protein NfuA; Provisional; Region:
                     PRK11190"
                     /db_xref="CDD:183027"
     misc_feature    163127..163417
                     /locus_tag="Sbal_0142"
                     /note="Fe-S cluster assembly scaffold protein
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: sufA; COG0316"
                     /db_xref="CDD:223393"
     misc_feature    163418..163696
                     /locus_tag="Sbal_0142"
                     /note="Thioredoxin-like proteins and domains
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0694"
                     /db_xref="CDD:223766"
     gene            complement(163789..165726)
                     /locus_tag="Sbal_0143"
                     /db_xref="GeneID:4844186"
     CDS             complement(163789..165726)
                     /locus_tag="Sbal_0143"
                     /note="PFAM: peptidase S15; peptidase S9, prolyl
                     oligopeptidase active site domain protein;
                     phospholipase/Carboxylesterase;
                     KEGG: she:Shewmr4_3803 peptidase S9, prolyl oligopeptidase
                     active site domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9 prolyl oligopeptidase"
                     /protein_id="YP_001048546.1"
                     /db_xref="GI:126172397"
                     /db_xref="InterPro:IPR000383"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="GeneID:4844186"
                     /translation="MKRILPLLFLWLCNHAVADTASQLPVEAFASIPDVSSVQLSPNG
                     KKLASVVRVDQAKLKGTVVSIQDIETGEKSIPLHTDNQKFVILSLQWANDNILLISAK
                     FPANRYGTPTTETRLVKYDLTTKKTSSVLPRSVLDRLNWIPQHQGQIIDLMADDPDNI
                     LLSLDGMGENVGEDSVLKVNLAQGKSSYTQNAKKKIISWITDRQHKVRISIYNDDTEY
                     RIYEQAEQKRDSRLLWTFKAFSEDSIWPLGFDADPNILYVRAYHQGFEAIFKVNLTDP
                     KLTKELVYANENTDVEGNLLYSKLKKKVIGISEGDGEEYTFWEKEYVGLQNGLKAVLP
                     NAHNYITQFSADERRYIVYSTSSTEPGTYYFGDRDEKTLYPIANRYGRLKSELLADTQ
                     YLTYEARDKLKIDAYLTVPKGLEAKQLPTIIFPHGGPISYDSNDFDYWAQFFANRGYA
                     VFRMNFRGSAGYGYEFMKAGLKSWGLEMQNDVEDGTRYLIAQGISDPKRICIVGASYG
                     GYAALMGAAMTPDLYRCAVSVAGVTDVAYLVKSSRRFTNYKVVKEQIGDDFDALYDRS
                     PISKADKINIPVLLLHGDKDRVVKVQHSREMYDELKSLKKPVEYIELENGDHYLSNND
                     NRLATFKALDKFLADNLNPKL"
     misc_feature    complement(163804..165666)
                     /locus_tag="Sbal_0143"
                     /note="Dipeptidyl aminopeptidases/acylaminoacyl-peptidases
                     [Amino acid transport and metabolism]; Region: DAP2;
                     COG1506"
                     /db_xref="CDD:224423"
     misc_feature    complement(163801..164424)
                     /locus_tag="Sbal_0143"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:249771"
     gene            complement(165807..167174)
                     /locus_tag="Sbal_0144"
                     /db_xref="GeneID:4845768"
     CDS             complement(165807..167174)
                     /locus_tag="Sbal_0144"
                     /note="TIGRFAM: MATE efflux family protein;
                     PFAM: multi antimicrobial extrusion protein MatE;
                     KEGG: she:Shewmr4_3802 MATE efflux family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MATE efflux family protein"
                     /protein_id="YP_001048547.1"
                     /db_xref="GI:126172398"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="GeneID:4845768"
                     /translation="MNTAKSTWLDLMLNCAKNRQLLALALPMILSNITIPLLGLVDTA
                     VIGHLSEAYYLGGVAVGSTIITLIIWLLGFLRMATTGLVAQAYGANDLHAQHKLLVQG
                     AMLAVLLGAGVIALQVPILNLALGLSEASSEVERYCREYFQVRIWSTPFALLNLVMLG
                     WLLGRQQPKAAMWQLILANLANIILDVVFVLGLGWGVKGAALASVFADITAFSVALTM
                     VLQQLKREADFHLSQLLPHVTLTGYGKLLRLNTDIFIRSLCLQAAFAFMTFHGAGLGD
                     NTVAANAVLLNLLLLISYALDGIAYYAEAEVGRAYGQKQAEQLREAVILAWSWSAITA
                     LGFCAVFSLFGSNIIALLTSINEVRATAQTYLIWLIFLPLWSFSSYLFDGVYIGAAKG
                     KVMRNSMILATFGAFFPTWYLLQQLLLPEQGNHALWAAMSVFMIARSLTLTGHYYFSK
                     DFLNK"
     misc_feature    complement(165849..167129)
                     /locus_tag="Sbal_0144"
                     /note="DNA-damage-inducible SOS response protein;
                     Provisional; Region: PRK10367"
                     /db_xref="CDD:182413"
     misc_feature    complement(165834..167126)
                     /locus_tag="Sbal_0144"
                     /note="DinF and similar proteins, a subfamily of the
                     multidrug and toxic compound extrusion (MATE)-like
                     proteins; Region: MATE_DinF_like; cd13136"
                     /db_xref="CDD:240541"
     gene            167197..168243
                     /locus_tag="Sbal_0145"
                     /db_xref="GeneID:4842799"
     CDS             167197..168243
                     /locus_tag="Sbal_0145"
                     /note="PFAM: polysaccharide deacetylase;
                     KEGG: she:Shewmr4_3801 polysaccharide deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="YP_001048548.1"
                     /db_xref="GI:126172399"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="GeneID:4842799"
                     /translation="MVKRVLLALIGLMTFSAHAVVILQYHHVSETTPAATSVTPAQFR
                     EQMQFLADDGFKVIPLSQVVEAIKQKQDLPAKTVAITFDDGYRSIATTAHPILKEFGF
                     PYTLFVAIEPIKQKFTEMMTWDELITLSKEGADIANHSWAHEHLIRALENESQAQWLA
                     RVKANILDTEKAIADATGHNFKMLAYPYGEYNQALQDMLTENGFVALGQQSGAAGPYS
                     PLTALPRFPVAGQYADLKSLKAKLYSLNMPVIAQSPSDPELKGGHWRPELKVTLDMSD
                     ISAKQVMCYIQGQGSKQPTWLSESEFSVQADLALPAGRSRYNCTAPSKARNGYYWFSQ
                     PWVRPKDDGSWVKE"
     misc_feature    167422..167892
                     /locus_tag="Sbal_0145"
                     /note="Putative catalytic NodB homology domain of
                     uncharacterized bacterial polysaccharide deacetylases
                     which consist of a 5-stranded beta/alpha barrel; Region:
                     CE4_DAC_u4_5s; cd10973"
                     /db_xref="CDD:213028"
     misc_feature    order(167443..167448,167611..167613,167623..167625,
                     167755..167763)
                     /locus_tag="Sbal_0145"
                     /note="putative active site [active]"
                     /db_xref="CDD:213028"
     misc_feature    order(167446..167448,167611..167613,167623..167625)
                     /locus_tag="Sbal_0145"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:213028"
     gene            complement(168244..168876)
                     /locus_tag="Sbal_0146"
                     /db_xref="GeneID:4842446"
     CDS             complement(168244..168876)
                     /locus_tag="Sbal_0146"
                     /note="PFAM: electron transport protein SCO1/SenC;
                     KEGG: shn:Shewana3_3999 electron transport protein
                     SCO1/SenC"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transport protein SCO1/SenC"
                     /protein_id="YP_001048549.1"
                     /db_xref="GI:126172400"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="GeneID:4842446"
                     /translation="MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELA
                     PFELVDQHQQAFTNASLQGKWSLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIAPLQVV
                     FLSVDPKRDTPDKLLTYVNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMVGEGENYQVD
                     HSAGYVLVSPQGTRVAVFKPTAALGKPPQVLNDEIISDFRKIVAQYKPSR"
     misc_feature    complement(168337..168744)
                     /locus_tag="Sbal_0146"
                     /note="SCO (an acronym for Synthesis of Cytochrome c
                     Oxidase) family; composed of proteins similar to Sco1, a
                     membrane-anchored protein possessing a soluble domain with
                     a TRX fold. Members of this family are required for the
                     proper assembly of cytochrome c...; Region: SCO; cd02968"
                     /db_xref="CDD:239266"
     misc_feature    complement(order(168394..168396,168640..168642,
                     168652..168654))
                     /locus_tag="Sbal_0146"
                     /note="Cu(I) binding site [ion binding]; other site"
                     /db_xref="CDD:239266"
     gene            complement(168924..169829)
                     /locus_tag="Sbal_0147"
                     /db_xref="GeneID:4842826"
     CDS             complement(168924..169829)
                     /locus_tag="Sbal_0147"
                     /note="converts protoheme IX and farnesyl diphosphate to
                     heme O"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="YP_001048550.1"
                     /db_xref="GI:126172401"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="GeneID:4842826"
                     /translation="MAKPLSITSSLPTFSVTWRAYFEMTKPKVVALMLLTVLVGMCLA
                     VPHAVPVQPLLAGMLGIAMMAGSAAALNHLIDRRIDGLMARTYNRPLPKGRISATRAL
                     IFAASLGSLGFIVLYSLVNPLTAWLTFASLIGYALVYTAYLKRATSQNIVIGGLAGAM
                     PPLLGWTAVTNEFHGHALLLVIIIFTWTPPHFWALAIHRRAEYAKVDIPMLPVTHGVE
                     FTKTCILLYTVLLAIACLLPVLVGMCGPVYFVCSSLLSTGFIYKAWQLKYRDHDGLAM
                     QVFRFSIYHLMLLFMALLLDHYLWN"
     misc_feature    complement(168975..169766)
                     /locus_tag="Sbal_0147"
                     /note="Protoheme IX farnesyltransferase; Region:
                     PT_UbiA_Cox10; cd13957"
                     /db_xref="CDD:260120"
     misc_feature    complement(order(169224..169226,169590..169592,
                     169602..169604))
                     /locus_tag="Sbal_0147"
                     /note="putative active site [active]"
                     /db_xref="CDD:260120"
     gene            complement(169844..170821)
                     /locus_tag="Sbal_0148"
                     /db_xref="GeneID:4843394"
     CDS             complement(169844..170821)
                     /locus_tag="Sbal_0148"
                     /note="PFAM: cytochrome oxidase assembly;
                     KEGG: son:SO4613 cytochrome oxidase assembly protein,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase assembly"
                     /protein_id="YP_001048551.1"
                     /db_xref="GI:126172402"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="GeneID:4843394"
                     /translation="MQLTWVLRLTLVFTLLVILMGAYTRLSDAGLGCPDWPGCYGHIK
                     VPTQDHEIAHAQTIFPDHDIHPEKAWLEMIHRYIAGGLGLLVLFILVLCLKTPEAPKK
                     LPLIIVLLILFQAALGMWTVTMRLMPIVVMSHLIGGFSLISLLLLLYLRTRPRRIFNS
                     ETHARNLAPLALVSLFVLVGQIMLGAWTSSNYAALACTSLPICEGNWVDNLAIAEAFS
                     PFQGQHHSFEFGVLDYPARMTIHIAHRIGAVVTASLLLVLAYRLFVGAAGMRALSLLL
                     VGLVILQVSLGISNVVMHLPLGIAVSHNGGAALLLLTLVAINYFLWRKA"
     misc_feature    complement(169904..170809)
                     /locus_tag="Sbal_0148"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; pfam02628"
                     /db_xref="CDD:251431"
     gene            complement(170821..171366)
                     /locus_tag="Sbal_0149"
                     /db_xref="GeneID:4842380"
     CDS             complement(170821..171366)
                     /locus_tag="Sbal_0149"
                     /note="KEGG: son:SO4612 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048552.1"
                     /db_xref="GI:126172403"
                     /db_xref="GeneID:4842380"
                     /translation="MNSQNKSKHKALGLLLLAFIAPVVIAKLVLSLNLYHGGATNHGE
                     LINPETSYASLGVENPNPKEWQLLYLLPAQCDDACRERLYILRQSHTALGPDQARVEP
                     LILTHPDSDLNALSAFHFNTRPANAGLSHWLDEQQLIIVDPLGSLVLRYPQVQGREAH
                     LAQGKDLVADLRKLLKLSRVD"
     gene            complement(171458..172222)
                     /locus_tag="Sbal_0150"
                     /db_xref="GeneID:4841930"
     CDS             complement(171458..172222)
                     /locus_tag="Sbal_0150"
                     /note="KEGG: she:Shewmr4_3796 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048553.1"
                     /db_xref="GI:126172404"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="GeneID:4841930"
                     /translation="MQYPYVLLNKLTVFLLILTVAVFVMLVKLGLWQLARGEEKTMLL
                     AQMEARQSLLPLSFEQLQLKIDKEGVTGYRLHVHAIPASSQIWLLDNQIYQGQVGYLA
                     FQPLQVAAGQPWVLVELGFVAASSHRDELPHISPLSGELNIEGRLYQKQINPLSQALM
                     AETGTSVRFQNLNIPEMAQLLGHPLLDAVLQPDELPALALPHPWQPFPLSAQKHWGYA
                     LQWFSMAAVFAGLMLWQGIKYVKRHSAETIANSRSE"
     misc_feature    complement(171530..172147)
                     /locus_tag="Sbal_0150"
                     /note="SURF1 superfamily. Surf1/Shy1 has been implicated
                     in the posttranslational steps of the biogenesis of the
                     mitochondrially-encoded Cox1 subunit of cytochrome c
                     oxidase (complex IV). Cytochrome c oxidase (complex IV),
                     the terminal electron-transferring...; Region: SURF1;
                     cd06662"
                     /db_xref="CDD:119401"
     gene            complement(172444..173319)
                     /locus_tag="Sbal_0151"
                     /db_xref="GeneID:4843508"
     CDS             complement(172444..173319)
                     /locus_tag="Sbal_0151"
                     /note="PFAM: cytochrome c oxidase, subunit III;
                     KEGG: shm:Shewmr7_3867 cytochrome c oxidase, subunit III"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="YP_001048554.1"
                     /db_xref="GI:126172405"
                     /db_xref="InterPro:IPR000298"
                     /db_xref="GeneID:4843508"
                     /translation="MTTKHENYYVPAQSAWPIIGAIGLFLIALGAGHFVHQLKSGASG
                     GGYILLAGIAVILFMLVGWFRTVINESMTGLYSHQMDRSFRQGMSWFIFSEVMFFGAF
                     FGALFYARMVAVPWLGGASNNAMTHEVLWPQFEAVWPLLTTPDGTKTEAMPWNGLPLI
                     NTIVLLTSSVTLHFSHVSLEKGKRSAITLWLGITILLGMGFLALQAEEYMHAYHEMGL
                     TLTSGVYGNTFFLLTGFHGMHVSLGTLFLLVLFFRVLKGHFSADKHFAFQAGSWYWHF
                     VDVVWLCLFIFVYVL"
     misc_feature    complement(172450..173268)
                     /locus_tag="Sbal_0151"
                     /note="Cytochrome c oxidase subunit III.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_III; cd01665"
                     /db_xref="CDD:238834"
     misc_feature    complement(order(173101..173106,173113..173115,
                     173122..173127,173134..173136))
                     /locus_tag="Sbal_0151"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    complement(order(172522..172527,172561..172563,
                     172582..172584,173047..173049,173056..173061,
                     173092..173094,173107..173109,173116..173121,
                     173128..173133))
                     /locus_tag="Sbal_0151"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    complement(order(172627..172629,172639..172641,
                     172648..172653,172996..172998,173014..173019,
                     173029..173031,173038..173040,173071..173076,
                     173083..173085))
                     /locus_tag="Sbal_0151"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    complement(172897..172899)
                     /locus_tag="Sbal_0151"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    complement(order(172651..172659,172684..172692,
                     172720..172722,172798..172800,172849..172857))
                     /locus_tag="Sbal_0151"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    complement(172762..172764)
                     /locus_tag="Sbal_0151"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            complement(173316..173897)
                     /locus_tag="Sbal_0152"
                     /db_xref="GeneID:4842692"
     CDS             complement(173316..173897)
                     /locus_tag="Sbal_0152"
                     /note="involved in the insertion of copper into subunit I
                     of cytochrome C oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase assembly protein"
                     /protein_id="YP_001048555.1"
                     /db_xref="GI:126172406"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="GeneID:4842692"
                     /translation="MTNHHQPEKPKSNRKLISMLVMGCIGMFGFGFALVPLYDVLCEK
                     LGINGKTSNTASSYQAITIDTSRIVTVEFISQVQTGMPWKFEPQTKRLEVHPGELIHT
                     AFLARNVSDRATVGQAIPSISPGQGAAYFNKTECFCFNQQHLAASTSAELPLIFFVDP
                     QLPESIHTLTLSYTLYDITDKQLASAIEQGAAK"
     misc_feature    complement(173322..173888)
                     /locus_tag="Sbal_0152"
                     /note="cytochrome C oxidase assembly protein; Provisional;
                     Region: PRK05089"
                     /db_xref="CDD:235341"
     gene            complement(173899..175491)
                     /locus_tag="Sbal_0153"
                     /db_xref="GeneID:4843852"
     CDS             complement(173899..175491)
                     /locus_tag="Sbal_0153"
                     /EC_number="1.9.3.1"
                     /note="PFAM: cytochrome c oxidase, subunit I;
                     KEGG: son:SO4607 cytochrome c oxidase, subunit I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome-c oxidase"
                     /protein_id="YP_001048556.1"
                     /db_xref="GI:126172407"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="GeneID:4843852"
                     /translation="MSTTTQDQTAAHDDHHHGAPKGIMRWVLTTNHKDIGTLYLWFSF
                     IMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLI
                     PMMIGAPDMALPRMNNWSFWILPFAFTILLSSLFMEGGGPNFGWTFYAPLSTTYSPDS
                     TALFVFSIHIMGISSIMGAINVIVTIVNLRAPGMTWMKLPLFVWTWLITAFLLIAVMP
                     VLAGAVTMVLTDKFFGTSFFEAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIV
                     PAFSRKPLFGYASMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTG
                     VKVFNWVATMWRGSLSFETPMLFAVAFIILFTIGGFSGLMLAITPADFQYHDTYFVVA
                     HFHYVLVTGAIFSIMAAAYYWLPKWTGHMYNERLGQWHFWCSVISVNVLFFPMHFLGL
                     AGMPRRIPDYSIQFADVNQIVSIGGFAFGLSQLIFLVLVIKCIRGGEKAPAKPWEGSE
                     GLEWTLPSPAPYHSFTTPPEVK"
     misc_feature    complement(173905..175443)
                     /locus_tag="Sbal_0153"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    complement(173950..175404)
                     /locus_tag="Sbal_0153"
                     /note="Cytochrome C oxidase subunit I.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174583..174585,174595..174600,
                     174607..174609,174616..174618,174727..174729,
                     174757..174759,174763..174768,174781..174789,
                     174814..174816,174838..174840,174847..174849,
                     174868..174870,174928..174930,174940..174942,
                     174994..174996,175126..175128,175147..175149,
                     175153..175155,175165..175167,175402..175404))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174937..174939,174949..174951,
                     174967..174972,175132..175134,175141..175143,
                     175162..175164,175195..175197,175375..175377))
                     /locus_tag="Sbal_0153"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174013..174015,174022..174024,
                     174241..174243,175084..175089,175324..175326,
                     175336..175338,175345..175347,175357..175359))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174052..174054,174106..174108,
                     174205..174210,174217..174219,175303..175308,
                     175315..175317))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174091..174096,174121..174129,
                     174139..174144,174334..174348,174352..174354,
                     174358..174363,174415..174417,174451..174459,
                     174478..174480,174487..174489,174511..174513,
                     174535..174537,174544..174546,174553..174561,
                     174634..174639,174646..174648,174757..174759,
                     175267..175269))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174058..174060,174169..174171,
                     174295..174297,174307..174309,175249..175251))
                     /locus_tag="Sbal_0153"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(175084..175086,175093..175095))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174790..174801,175027..175029))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174583..174585,174595..174600,
                     174607..174609,174616..174618,174727..174729,
                     174847..174849,174868..174870))
                     /locus_tag="Sbal_0153"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174127..174129,174334..174339,
                     174349..174351,174739..174744,174757..174759))
                     /locus_tag="Sbal_0153"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174313..174315,174568..174573,
                     174718..174720))
                     /locus_tag="Sbal_0153"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174484..174486,174493..174495,
                     174568..174573,174673..174675,174706..174708,
                     174718..174720))
                     /locus_tag="Sbal_0153"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(173953..173955,174631..174633,
                     174643..174645))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/Vb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174124..174129,174334..174339,
                     174568..174570))
                     /locus_tag="Sbal_0153"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(174553..174555)
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(174454..174456)
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174124..174129,174310..174312))
                     /locus_tag="Sbal_0153"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174043..174045,174214..174216))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    complement(order(174094..174096,174106..174108))
                     /locus_tag="Sbal_0153"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     gene            complement(175501..177057)
                     /locus_tag="Sbal_0154"
                     /db_xref="GeneID:4845346"
     CDS             complement(175501..177057)
                     /locus_tag="Sbal_0154"
                     /note="PFAM: cytochrome c oxidase, subunit II; cytochrome
                     c, class I; cytochrome C oxidase subunit II, transmembrane
                     region;
                     KEGG: shm:Shewmr7_3864 cytochrome c oxidase, subunit II"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="YP_001048557.1"
                     /db_xref="GI:126172408"
                     /db_xref="InterPro:IPR001505"
                     /db_xref="InterPro:IPR002429"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR011759"
                     /db_xref="GeneID:4845346"
                     /translation="MKQLLYCLLVVLFAPPLAAADMRFNMTPGVTEISGKVYHLHMTI
                     LYICCAIGLVVFGVMIYAMINHRKSKGAVASHFHESTKVEIAWTILPFIILILMAIPA
                     TKTLIAMEDPSDADLTVKVTGSQWKWHYSYFDQDIDFYSILATPRAQIDGTETKGEHY
                     LLEVDKPLVLPINRKIRFLMTSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGIY
                     RGQCAELCGKDHGFMPIVVQAIPEAEFEAWVTEQKQAAGAAAEAAQAALSQTLSKDDL
                     MTQGEQVYLGHCAACHQPNGEGLQGVFPHLKGSPIATGPLSGHLEIVLNGKTGTAMQA
                     FSKQLSAQEIAAVITYERNAWGNNTGDAVQAKDVNEHMNGSAGTQAPATTPAKTAPTP
                     APTTKPAAVVDSATIVDPASLPTLTHEALMAEGETVYTTTCAACHQLTGAGIPPAFPA
                     LAGSAIATGPVANHLDIVMHGKTGTAMQAFGKQLSPQQLAAVITYERNAWGNNTGDTV
                     QPADIASHGQ"
     misc_feature    complement(176305..176994)
                     /locus_tag="Sbal_0154"
                     /note="cytochrome c oxidase subunit II; Provisional;
                     Region: COX2; MTH00168"
                     /db_xref="CDD:177223"
     misc_feature    complement(176755..176988)
                     /locus_tag="Sbal_0154"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:202397"
     misc_feature    complement(176314..176712)
                     /locus_tag="Sbal_0154"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     misc_feature    complement(175951..>176241)
                     /locus_tag="Sbal_0154"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    complement(176008..176229)
                     /locus_tag="Sbal_0154"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     misc_feature    complement(175513..>175809)
                     /locus_tag="Sbal_0154"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    complement(175573..175800)
                     /locus_tag="Sbal_0154"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            complement(177460..177972)
                     /locus_tag="Sbal_0155"
                     /db_xref="GeneID:4842118"
     CDS             complement(177460..177972)
                     /locus_tag="Sbal_0155"
                     /note="KEGG: shm:Shewmr7_3863 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048558.1"
                     /db_xref="GI:126172409"
                     /db_xref="GeneID:4842118"
                     /translation="MNKLLGNAPRHPGLWLDEVRDADYDWHHAPIACMPTKTQGRQEL
                     IHLSAQLAQLSQQGRWLVLINPPSIGYKQMLANAGVRMDRVLLVHAKDEVETLWAMEK
                     ALTSGTSSAVITWTQSLDARDNRRLQIVAKSARAMGIVLEDVNSHLHGDVRIEQGSLF
                     GQQSFFSAVH"
     misc_feature    complement(177523..>177822)
                     /locus_tag="Sbal_0155"
                     /note="Cell division inhibitor SulA; Region: SulA;
                     cl01880"
                     /db_xref="CDD:242760"
     gene            complement(177969..178589)
                     /locus_tag="Sbal_0156"
                     /db_xref="GeneID:4842750"
     CDS             complement(177969..178589)
                     /locus_tag="Sbal_0156"
                     /EC_number="3.4.21.88"
                     /note="Represses a number of genes involved in the
                     response to DNA damage"
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="YP_001048559.1"
                     /db_xref="GI:126172410"
                     /db_xref="InterPro:IPR006197"
                     /db_xref="InterPro:IPR006198"
                     /db_xref="InterPro:IPR006199"
                     /db_xref="InterPro:IPR006200"
                     /db_xref="GeneID:4842750"
                     /translation="MRPLTPRQAEILELIKRNIADTGMPPTRAEIATRLGFKSANAAE
                     EHLKALAKKGCIEIMPGTSRGIRLTAEVEEVTETGLPLIGQVAAGEPILAQEHVEQYY
                     QVDPSMFHPAADFLLRVKGDSMKNIGILEGDLLAVHKVQQARNGQVVVARVDDDVTVK
                     RFEKKGNVVYLHAENEDYSPIKVDLGYQSLTIEGLAVGVIRNGDWL"
     misc_feature    complement(177981..178583)
                     /locus_tag="Sbal_0156"
                     /note="LexA repressor; Validated; Region: PRK00215"
                     /db_xref="CDD:234688"
     misc_feature    complement(178395..178583)
                     /locus_tag="Sbal_0156"
                     /note="LexA DNA binding domain; Region: LexA_DNA_bind;
                     pfam01726"
                     /db_xref="CDD:201938"
     misc_feature    complement(178038..178247)
                     /locus_tag="Sbal_0156"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    complement(order(178110..178112,178221..178223))
                     /locus_tag="Sbal_0156"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            178750..181173
                     /locus_tag="Sbal_0157"
                     /db_xref="GeneID:4841666"
     CDS             178750..181173
                     /locus_tag="Sbal_0157"
                     /EC_number="2.3.1.15"
                     /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
                     3-phosphate by transfering the acyl moiety from acyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_001048560.1"
                     /db_xref="GI:126172411"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="GeneID:4841666"
                     /translation="MPKHDSLWLKSLRWIQKHLVHTIVVPQDPFADLNLDASRPLAYV
                     MKTESLSDIAALSEITAKLGLPSPYEPLVANGVIAPRVVCLQGRKPLFGERAGNEPFL
                     ECFMRLLAVHKERPELDIQLVPVSLYWGRTPGKEDDTMKAAVFERENPTWLRKCLMIL
                     FLGRHNFVQFSNAVSLRYMADEHGTDMGIAHKLARVARVHFRRQRKVMTGPVLPNRQA
                     LFHSLLKSESLRKAIQEEAANKKISETQARETAIEYLDEIAADYSDSLVRIAERFLTW
                     LWNKLYSGINIKGAEQVRQLHHDGHEIVYVPCHRSHMDYLLLSYILYYQGMVPPHIAA
                     GINLNFWPAGPMFRRGGAFFIRRSFNGNKLYTAVFREYLDQLFAKGYSVEYFSEGGRS
                     RTGRLLAPKTGMIAMTMNSVLRGIERPVTLVPVYLGYDHVMEVATYHKELSGKKKKKE
                     SVWQVFGAIRKLGNFGQGYVNFGEPITLQNFLNERAPNWRTELADDPEQKPSWLTPAV
                     NVLANRVMTNINDAAAASSVTLTSLVLLATDQNALERSLLERQLDLYLTLLKKVPYTT
                     YTSVAEGDGKHLVQQGLELNKFVVCADPLGEIVSIEASQAVSMTYYRNNIIHLFIVPS
                     LIASCLTHNKQIPRQQVVSIVADFYPLLKAELFMGIKDVPAYVNQVLDFFIEQGLVVE
                     TDTLTVVPEHTSQLLLLASSVSETLQRYAIIFNLLANRPKMERSELESESHLLAQRLG
                     ALHGITAPEFYDKKLYGTLSVKLKELGYLADNQDKSNINRIRDQANSLLRPSVKQTIV
                     ASVTAEHTV"
     misc_feature    178750..181140
                     /locus_tag="Sbal_0157"
                     /note="Glycerol-3-phosphate O-acyltransferase [Lipid
                     metabolism]; Region: PlsB; COG2937"
                     /db_xref="CDD:225488"
     misc_feature    179593..180198
                     /locus_tag="Sbal_0157"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: GPAT-like; Region:
                     LPLAT_DHAPAT-like; cd07993"
                     /db_xref="CDD:153255"
     misc_feature    order(179674..179676,179683..179685,179689..179691,
                     179752..179763,179914..179922)
                     /locus_tag="Sbal_0157"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153255"
     gene            181173..182429
                     /locus_tag="Sbal_0158"
                     /db_xref="GeneID:4845268"
     CDS             181173..182429
                     /locus_tag="Sbal_0158"
                     /note="TIGRFAM: aromatic amino acid transporter;
                     PFAM: aromatic amino acid permease;
                     KEGG: she:Shewmr4_3787 aromatic amino acid transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid transporter"
                     /protein_id="YP_001048561.1"
                     /db_xref="GI:126172412"
                     /db_xref="InterPro:IPR002091"
                     /db_xref="InterPro:IPR013059"
                     /db_xref="GeneID:4845268"
                     /translation="MANHMNAAKHKPAGKSLLGGAMIIAGTTVGAGMFSLPVVGAGMW
                     FGYSILMLLGIWFCMLMSGLLLLETNLHFEPGASFDTLSKQTLGQFWRIVNGVSIAFV
                     LYILTYAYISGGGSIVNHSLQGMGIELPQSVAGLVFAIVLASIVLISTKAVDRITTIM
                     LGGMIITFFLAIGNLLIEIDVTKLLEPDGNSSFSPYLWAALPFGLASFGYHGNVPSLV
                     KYYGKDSATIIKAIFVGTFIALVIYACWLVATMGNIPRSQFIDIIAQGGNMGVLVGAL
                     SEVMASSWLNSMLTLFANLAVASSFLGVTLGLFDYLADLFGFDDSRSGRMKTALVTFV
                     PPTILGLLFPDGFLVAIGFAALAATVWAVIVPALMAYKSRQLFPDSTGFRVIGGTPLI
                     ILVVLFGIVTGACHLLAMANLLPQYS"
     misc_feature    181203..182414
                     /locus_tag="Sbal_0158"
                     /note="Amino acid permeases [Amino acid transport and
                     metabolism]; Region: SdaC; COG0814"
                     /db_xref="CDD:223884"
     misc_feature    181218..182426
                     /locus_tag="Sbal_0158"
                     /note="Tryptophan/tyrosine permease family; Region:
                     Trp_Tyr_perm; cl17316"
                     /db_xref="CDD:266625"
     gene            182579..183352
                     /locus_tag="Sbal_0159"
                     /db_xref="GeneID:4843062"
     CDS             182579..183352
                     /locus_tag="Sbal_0159"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: shm:Shewmr7_3859 glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_001048562.1"
                     /db_xref="GI:126172413"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:4843062"
                     /translation="MKITQYAQGHACWVELANHDWQAAKTFYQALFGWDSVDMPIPEG
                     HFSLFNLAGDDLGAMYQIPESESQIPSHWRVYFAVDDMDASIAAIQAAGGQVHMGPHI
                     VADAGVMAQVSDPQGARFALWQAKNHIGARRQGELNTLCWVELACKEPRTEEAFYCKI
                     FPWTNSPSDMPDIEYSEWQVDGQSIGGMMTIMPEWGDISPHWLLYFAVADCDAFAEKA
                     QALGAQVCIPPSDIPDVGRFSVIADAQGATFAVIKLNQM"
     misc_feature    182612..182950
                     /locus_tag="Sbal_0159"
                     /note="N-terminal domain of Streptomyces griseus SgaA
                     (suppression of growth disturbance caused by A-factor at a
                     high concentration under high osmolality during early
                     growth phase), and similar domains; Region: SgaA_N_like;
                     cd07247"
                     /db_xref="CDD:176671"
     misc_feature    182996..183334
                     /locus_tag="Sbal_0159"
                     /note="N-terminal domain of Streptomyces griseus SgaA
                     (suppression of growth disturbance caused by A-factor at a
                     high concentration under high osmolality during early
                     growth phase), and similar domains; Region: SgaA_N_like;
                     cd07247"
                     /db_xref="CDD:176671"
     gene            complement(183558..185519)
                     /locus_tag="Sbal_0160"
                     /db_xref="GeneID:4842481"
     CDS             complement(183558..185519)
                     /locus_tag="Sbal_0160"
                     /note="PFAM: histidine kinase, HAMP region domain protein;
                     chemotaxis sensory transducer;
                     KEGG: shn:Shewana3_3985 methyl-accepting chemotaxis
                     sensory transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_001048563.1"
                     /db_xref="GI:126172414"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="GeneID:4842481"
                     /translation="MFSINQLALTKKLAIVPVLLVAMLITLGLTSYFALTDIDNRMRL
                     VTEDLAPESAITSNLLQEIYRLRLAVKTYVKTGSAEAATDFSNQSSKAHEMIAKAKAH
                     ISFPERIKLINQIGEHQVEYVDIFNRKIIVNQQNRERLVSGTLDIKGPEVEKTLSQIM
                     QSSFNDGDVRGAFYAGKTLRELLLVRLYVVKFLVDNQPEQAKRFTDELNKTHLAIDEL
                     AASLENLEYQSQVKQANQLLKEYEQAAQSVVEAINNRNTAIVELDKIGIEMAEMTSDL
                     QDSTMKSLSDAGDKAAQEVSQKITFISIILIIAILMAALITFIVTQSLLSSIREVVTL
                     LNEIADGEADLTQRLPENGHDELTQLAKNFNRFVVRIQVLVSQVKNTTVQLVSASTQL
                     SSVTHSATKDMSSQQNETQQVASAITEMAASAIEVAASADTANKLSEEAREQSLSGRE
                     IVANATHSMKELAEKVEASANTIELLRNDSDKIGEVLDVIRAIAEQTNLLALNAAIEA
                     ARAGEQGRGFAVVADEVRSLASRTQESTKQIQQIIQTLQNRSSSAATMMGQSREATST
                     TVIQVTKVEAALSTITDMVMSISHSVSQMAHAAEQQSTVVEEINISINSVSESANRTL
                     GGVNQTASSANDLLKLGHQLDNLVSEFRV"
     misc_feature    complement(184404..184550)
                     /locus_tag="Sbal_0160"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(184407..184412,184419..184424,
                     184428..184433,184440..184445,184449..184454,
                     184506..184508,184512..184517,184524..184529,
                     184533..184538,184545..184550))
                     /locus_tag="Sbal_0160"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(183564..184349)
                     /locus_tag="Sbal_0160"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(183669..184268)
                     /locus_tag="Sbal_0160"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(183672..183677,183684..183686,
                     183693..183698,183705..183707,183714..183719,
                     183723..183728,183735..183740,183744..183749,
                     183756..183758,183765..183770,183777..183779,
                     183786..183791,183798..183803,183807..183812,
                     183819..183821,183828..183833,183840..183842,
                     183849..183854,183891..183896,183903..183908,
                     183912..183917,183924..183929,183936..183938,
                     183945..183950,183957..183959,183966..183968,
                     183978..183980,183999..184001,184008..184010,
                     184020..184022,184029..184034,184041..184043,
                     184050..184052,184059..184064,184071..184076,
                     184083..184085,184092..184097,184101..184103,
                     184113..184118,184122..184127,184134..184136,
                     184143..184148,184155..184160,184167..184169,
                     184176..184181,184188..184190,184197..184202,
                     184206..184211,184218..184220,184227..184232,
                     184239..184244))
                     /locus_tag="Sbal_0160"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(183933..184034)
                     /locus_tag="Sbal_0160"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(185873..187042)
                     /locus_tag="Sbal_0161"
                     /db_xref="GeneID:4842424"
     CDS             complement(185873..187042)
                     /locus_tag="Sbal_0161"
                     /note="PFAM: ribonuclease T2;
                     KEGG: son:SO4599 ribonuclease, T2 family"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease T2"
                     /protein_id="YP_001048564.1"
                     /db_xref="GI:126172415"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="GeneID:4842424"
                     /translation="MTKPFCLTIRRIWPQALSLKSLSRTLLAAFGLCAALIISAAPAF
                     AAPATGEFVADKRCELFQSKNKQTNPDQWQSNIGERYPVLEILGNSAKPDWLRVRTNA
                     VKSPMRWISGACGQYLSNVAGSNVSTPATAVEPAQTTTASDIKAKSRDGLKEHGTPEK
                     RPGDQCRIGGEFDANVLALSWQSTFCELYGRRKAECRALSQTPESSQWQHFSLHGLWP
                     NKQQCGTRYGYCSTVKLQPNDFCTYPELELNPSVRKNLEEVMPSAQYGTCLERHEWWK
                     HGTCRSQDPNEYFLLATQLTQAVNASAWVQKFIHDNIGKSVSKSELNQSFDSSFGQGA
                     HAKMSLECGKGLLSEIRINLPEVIKASDSLPSLLAKANKAGRGSCPETIMIDNAN"
     misc_feature    complement(185903..186529)
                     /locus_tag="Sbal_0161"
                     /note="Ribonuclease T2 (RNase T2) is a widespread family
                     of secreted RNases found in every organism examined thus
                     far.  This family includes RNase Rh, RNase MC1, RNase LE,
                     and self-incompatibility RNases (S-RNases).  Plant T2
                     RNases are expressed during leaf...; Region:
                     RNase_T2_prok; cd01062"
                     /db_xref="CDD:238513"
     misc_feature    complement(order(185990..185992,186392..186394,
                     186515..186517))
                     /locus_tag="Sbal_0161"
                     /note="B1 nucleotide binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:238513"
     misc_feature    complement(order(185996..185998,186236..186238,
                     186488..186490,186503..186505))
                     /locus_tag="Sbal_0161"
                     /note="B2 nucleotide binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:238513"
     misc_feature    complement(order(186203..186238,186389..186412))
                     /locus_tag="Sbal_0161"
                     /note="CAS motifs; other site"
                     /db_xref="CDD:238513"
     misc_feature    complement(order(186212..186217,186224..186229,
                     186386..186388,186392..186394,186401..186403))
                     /locus_tag="Sbal_0161"
                     /note="active site"
                     /db_xref="CDD:238513"
     gene            complement(187251..190400)
                     /locus_tag="Sbal_0162"
                     /db_xref="GeneID:4844475"
     CDS             complement(187251..190400)
                     /locus_tag="Sbal_0162"
                     /note="TIGRFAM: heavy metal efflux pump, CzcA family;
                     PFAM: acriflavin resistance protein;
                     KEGG: son:SOA0153 heavy metal efflux pump, CzcA family"
                     /codon_start=1
                     /transl_table=11
                     /product="CzcA family heavy metal efflux protein"
                     /protein_id="YP_001048565.1"
                     /db_xref="GI:126172416"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR004763"
                     /db_xref="GeneID:4844475"
                     /translation="MLKYIIEASIRQRFMVLIIAIMITVWGVQELRKTPLDALPDLSD
                     VQVIIKTPYPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGYSMFGDSYVYVIFEDGTD
                     IYWARSRVLEYLSQISSRLPQNVQPSLGPDASGVGWVYEYALVDRSGNLDLSQLKSLQ
                     DWYLKLELQSVAGVSEVATVGGMEQTYQIVLEPDKMAIYKLDIATIKQAIDKANSEAG
                     GSVIEMAEAEYMVRAKGYRQTLEDFREIPLGITSPSGTGLTLKDVATVRKGPASRRGI
                     AELDGEGEVVGGIVVMRYGENALATIDAVKAKLEELKAGLPDGVEIIPTYDRSHLILK
                     SVDNLFSKVVEEMLVVGLVCLLFLLHARSTLVAVITLPLSILIAFIVMNKMGVNANIM
                     SLGGIAIAIGAVVDCAIVMIENLHKHLEHFKADHDREPDTKEHWRIVTEASIEVGPAL
                     FFSLIIITLSFVPVFALEAQEGRLFAPLAYTKTFAMAAAAFLSITLVPILMGYFIRGK
                     IPSERSNPISRFLIAIYQPSLKLVLKFPKVTLMLALIALASAWYPMTRMGSEFMPALE
                     EGDLLYMPTALPGISASKAAEVLQQTDRLIKTVPEVARVFGKVGRAETATDPAPLTML
                     ETTIMLKPHDEWREGMTLDGIIAQLQQTVKVPGLTNAWVQPIKTRIDMLSTGIKTPVG
                     IKITGADVNELQSIGTKIEAILSKVPHTKSAYAERSGGGRYIDISPKLDVAARYGMTL
                     QDIQDVVRYAIGGMDIGESVQGAERYPINLRYPRELRDNIEKLRELPVITKSGHYLPL
                     RNLADIEINDGAPMLKSENGRLISWVFIDIEGTSIGEYIATAKTALDAELVVPPRYSY
                     SFAGQYEYMQRVDAKLKQVIPMALAVIFILLMMTFGSTIQASIIMLSLPFALVGSTWL
                     LYLLDYNISVAVAVGMIALAGVAAEFGVVMLVYLNNAIKHRQEKDNYHSVNDLKEALI
                     EGAVMRIRPKAMTVATIFFGLLPIMWGAGSGNDVMQKIAAPMVGGMVTAPILSLFVLP
                     ALYLLIYSRKLKKDPAHVS"
     misc_feature    complement(187266..190400)
                     /locus_tag="Sbal_0162"
                     /note="Putative silver efflux pump [Inorganic ion
                     transport and metabolism]; Region: COG3696"
                     /db_xref="CDD:226220"
     misc_feature    complement(187260..>187787)
                     /locus_tag="Sbal_0162"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(190410..191951)
                     /locus_tag="Sbal_0163"
                     /db_xref="GeneID:4841987"
     CDS             complement(190410..191951)
                     /locus_tag="Sbal_0163"
                     /note="TIGRFAM: efflux transporter, RND family, MFP
                     subunit;
                     KEGG: son:SOA0154 heavy metal efflux protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_001048566.1"
                     /db_xref="GI:126172417"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:4841987"
                     /translation="MNQFNTVKKQAPKAVLILSSLLISTPWLSHAQLANTQEPTATEA
                     AANSATAPKHNPLNQVKTYTCPMHPEVISHEPGRCPKCNMFLVEKLDAANPAAEHAQH
                     QAADHQASEHGQTSADKATSQVFDTPTPKADSLVKAQNHVTTIKYVCPMHAHIISDVP
                     GTCPICGMNLEKVETGGNTQEININVSGSMQQALALKVAKVERDTLWKFVETVGQIDY
                     DESQITHIHARVTGWIEKLMIKSVGDTVKKDQLIYEIYSPDLINAQDDYLLAMDTAKA
                     NGQGRYKDLVRNAGLRLSFLGFNDRQIKQLAESHQTQYRVPFYAKEDGIVKALDIRDG
                     MYIQPSTEVMSVVDLSKVWVIADVFENEQSWIAKGQKAEIAVPAMNISGIEGTIDYIY
                     PELDPVTRSLRVRVVLNNTEVDLRPKTLAKVSLFGGPNKDVLVIPQEALIQTGKENRV
                     IVKQTDDSFTAKAVTVGMMSQGKAEIISGLNEGERVVISGQFLLDSEASLKGSLMRLS
                     SGHQH"
     misc_feature    complement(190470..191363)
                     /locus_tag="Sbal_0163"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    complement(190701..190997)
                     /locus_tag="Sbal_0163"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(191973..192233)
                     /locus_tag="Sbal_0164"
                     /db_xref="GeneID:4844066"
     CDS             complement(191973..192233)
                     /locus_tag="Sbal_0164"
                     /note="KEGG: son:SOA0155 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048567.1"
                     /db_xref="GI:126172418"
                     /db_xref="GeneID:4844066"
                     /translation="MKTLTNLALIAFLLTSTSVFATAAPHEHQHDNANPQQQAQTYVC
                     PMHPEVTGNKGDTCPKCGMDLEPKATEVKTAEGTMHNAHEHH"
     gene            complement(192501..192974)
                     /locus_tag="Sbal_0165"
                     /db_xref="GeneID:4844095"
     CDS             complement(192501..192974)
                     /locus_tag="Sbal_0165"
                     /note="KEGG: son:SOA0156 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048568.1"
                     /db_xref="GI:126172419"
                     /db_xref="GeneID:4844095"
                     /translation="MLDSSRSSFGILMHHTLGRYFLVMFTLLALVGQSVVSNGHAMVP
                     HTMDMSAMNHEASPQMHHAAMMQMNTENPSDSHSMANADCCNDKMLPGAKQHCCDGTT
                     SCSNDCGHCLTISVAGTLFSPHLWPSVSMSDTAMATPMPHFHSISLSSAFKPPIA"
     gene            complement(193048..193503)
                     /locus_tag="Sbal_0166"
                     /db_xref="GeneID:4841730"
     CDS             complement(193048..193503)
                     /locus_tag="Sbal_0166"
                     /note="KEGG: son:SOA0157 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048569.1"
                     /db_xref="GI:126172420"
                     /db_xref="GeneID:4841730"
                     /translation="MKTSLLNKSLLGLTFVIGALLSSTTVTAASLKSTDSLSVISING
                     VPATPFKPIQLSAGKVLLELKYQDIFDYRADDSGNWVKSAPLYLVLDVKASDSYQITQ
                     PKIMTEAEARQFIKYPTIQLSINGDKAGEYPLQSHSQLMAKMLVSNPAF"
     misc_feature    complement(<193111..193419)
                     /locus_tag="Sbal_0166"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2057); Region: DUF2057; cl11437"
                     /db_xref="CDD:264368"
     gene            complement(193604..193909)
                     /locus_tag="Sbal_0167"
                     /db_xref="GeneID:4845675"
     CDS             complement(193604..193909)
                     /locus_tag="Sbal_0167"
                     /note="KEGG: son:SOA0158 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048570.1"
                     /db_xref="GI:126172421"
                     /db_xref="GeneID:4845675"
                     /translation="MVSAMPTSANTNGHSSQTMLMMDAEMNCTMPDCSASDCLQHCQD
                     SMTSHCQTHCLSSLYLEPAVLELAFANPASKRIAIQGWAMQTADLGLTTPPPTSNSL"
     gene            194401..194964
                     /locus_tag="Sbal_0168"
                     /db_xref="GeneID:4844472"
     CDS             194401..194964
                     /locus_tag="Sbal_0168"
                     /note="PFAM: NapC/NirT cytochrome c domain protein;
                     KEGG: saz:Sama_3471 tetraheme cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="NapC/NirT cytochrome c domain-containing
                     protein"
                     /protein_id="YP_001048571.1"
                     /db_xref="GI:126172422"
                     /db_xref="InterPro:IPR005126"
                     /db_xref="InterPro:IPR011031"
                     /db_xref="GeneID:4844472"
                     /translation="MNWRALFKPSAKYSILALLVVGIVIGVVGYFATQTTLHATSQDA
                     FCMSCHSQHSLKDEVMASAHGNNRVGIVVQCQQCHIAQEPFQYLKKKIIVSKDVIGFL
                     TIDGFNTQAWLDENRKEQAELARDYLRAIDSSTCQNCHNRIYENQSENMSKMAVRMHS
                     NNFKKAPEDRKTCIDCHKGVAHPYPKG"
     misc_feature    194422..194961
                     /locus_tag="Sbal_0168"
                     /note="NapC/NirT cytochrome c family, N-terminal region;
                     Region: Cytochrom_NNT; pfam03264"
                     /db_xref="CDD:251838"
     gene            complement(195061..195345)
                     /locus_tag="Sbal_0169"
                     /db_xref="GeneID:4845605"
     CDS             complement(195061..195345)
                     /locus_tag="Sbal_0169"
                     /note="PFAM: protein of unknown function DUF1145;
                     KEGG: shn:Shewana3_3974 protein of unknown function
                     DUF1145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048572.1"
                     /db_xref="GI:126172423"
                     /db_xref="InterPro:IPR009525"
                     /db_xref="GeneID:4845605"
                     /translation="MKAMPLLINLGKAITLIAWLMMAYNLVMPFEGNVAIILNILFGI
                     TCMMHCFQVAIFHMLFKTLLLLTKLDYLQVFIFGIFSLLAYRQKVMTPAS"
     misc_feature    complement(195172..195330)
                     /locus_tag="Sbal_0169"
                     /note="Protein of unknown function (DUF1145); Region:
                     DUF1145; pfam06611"
                     /db_xref="CDD:253821"
     gene            complement(195320..195988)
                     /locus_tag="Sbal_0170"
                     /db_xref="GeneID:4842914"
     CDS             complement(195320..195988)
                     /locus_tag="Sbal_0170"
                     /note="TIGRFAM: putative methyltransferase;
                     PFAM: conserved hypothetical protein 95;
                     KEGG: she:Shewmr4_3775 putative methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="YP_001048573.1"
                     /db_xref="GI:126172424"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004398"
                     /db_xref="GeneID:4842914"
                     /translation="MVKNRTVKNNVTKSPTAKNKPGSGQVRIIAGQWRSRRLPIQDLE
                     GLRPTTDRVRETLFNWLANDLVNARVLDCFGGSGALALEALSRYASFAKIIELQRGAA
                     MQLKENLQTLKCDKAEVLNADTLVVLQRGCEQGFDVVFIDPPFRKGLAEKTIQLLDTQ
                     AWLNDGALIYVEIESELTQLAIPPCWHALKEKNAGQVSYRLYQYQAENTAEPIEDESH
                     ALAD"
     misc_feature    complement(<195554..195784)
                     /locus_tag="Sbal_0170"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(195563..195565,195617..195625,
                     195698..195703,195752..195772))
                     /locus_tag="Sbal_0170"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            196202..198067
                     /locus_tag="Sbal_0171"
                     /db_xref="GeneID:4844687"
     CDS             196202..198067
                     /locus_tag="Sbal_0171"
                     /note="KEGG: shm:Shewmr7_3847 signal recognition
                     particle-docking protein FtsY;
                     TIGRFAM: signal recognition particle-docking protein FtsY;
                     PFAM: GTP-binding signal recognition particle SRP54, G-
                     domain; GTP-binding signal recognition particle SRP54,
                     helical bundle;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="YP_001048574.1"
                     /db_xref="GI:126172425"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004390"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="GeneID:4844687"
                     /translation="MAKKGFFSWFRKDKSQDEVVAETPVVTPTQDTEAAERLEQERAE
                     AQRLAVEAEAQAAAAKLAAEQLAAEQAQAERIVQEQAAIEAQRLAEQQAEAARLAAAQ
                     LEAEQLAKVQAERIAQEQAQIEAQRLAEQQAETARLAAAQLEAEQLAVDKLAAEQAAA
                     EQLAQAQAKAEAERIAQEQAQIEAQRLAEQQAEAARLAAAQLESERLAANNLAQAQAK
                     AEAERIDHEQAQIEAQRLAEQQAEAARLAAAQLEAERARVAAEQAAEALAAEQLAAEA
                     LAREQAEALAQQQAEATQTAGPVTELQPEPQARPVKEGLFARLKRGLMRTSENIGSGF
                     IGLFRGKKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQASRKQLKDAEALYDLLR
                     EEMQKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAG
                     DTFRAAAVEQLQVWGQRNDITVIAQHTGADSASVLFDALQAAKARKVDVLIADTAGRL
                     QNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQEAVGVTGITI
                     SKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDALFTQEKADS"
     misc_feature    197135..198055
                     /locus_tag="Sbal_0171"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    197156..197386
                     /locus_tag="Sbal_0171"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    197444..197980
                     /locus_tag="Sbal_0171"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    197462..197485
                     /locus_tag="Sbal_0171"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(197552..197554,197717..197719,197900..197902,
                     197909..197914)
                     /locus_tag="Sbal_0171"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     gene            198071..198784
                     /locus_tag="Sbal_0172"
                     /db_xref="GeneID:4842828"
     CDS             198071..198784
                     /locus_tag="Sbal_0172"
                     /note="KEGG: shn:Shewana3_3971 cell division ATP-binding
                     protein FtsE;
                     TIGRFAM: cell division ATP-binding protein FtsE;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division ATP-binding protein FtsE"
                     /protein_id="YP_001048575.1"
                     /db_xref="GI:126172426"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005286"
                     /db_xref="GeneID:4842828"
                     /translation="MIDFQQVSKIYPGGQMALEDVNFHLQQGEMAFLTGHSGAGKSTL
                     LKLITVIERATTGRVAINGHDIAKVSPKHVPYLRRNIGMIFQNHHLLMDRSVFDNVAL
                     PLVIEGFSHGEIRKRVAGALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPPLLL
                     ADEPTGNLDPKLSMDILRLFETFNDAGTSVLIATHDLGLIARMKYRTFTLKQGRMLGA
                     QELHPSVHTRAPTNRGEGQ"
     misc_feature    198071..198715
                     /locus_tag="Sbal_0172"
                     /note="Predicted ATPase involved in cell division [Cell
                     division and chromosome partitioning]; Region: FtsE;
                     COG2884"
                     /db_xref="CDD:225438"
     misc_feature    198074..198715
                     /locus_tag="Sbal_0172"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    198173..198196
                     /locus_tag="Sbal_0172"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(198182..198187,198191..198199,198326..198328,
                     198554..198559,198653..198655)
                     /locus_tag="Sbal_0172"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    198317..198328
                     /locus_tag="Sbal_0172"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    198482..198511
                     /locus_tag="Sbal_0172"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    198542..198559
                     /locus_tag="Sbal_0172"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    198566..198577
                     /locus_tag="Sbal_0172"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    198641..198661
                     /locus_tag="Sbal_0172"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            198781..199746
                     /locus_tag="Sbal_0173"
                     /db_xref="GeneID:4844089"
     CDS             198781..199746
                     /locus_tag="Sbal_0173"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: son:SO4584 cell division ABC transporter, permease
                     protein FtsX"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048576.1"
                     /db_xref="GI:126172427"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="GeneID:4844089"
                     /translation="MSDSAKLTRSKLPLSGRIVMFFIRHVQQAMASMGELWRNPVSSV
                     MTMAVLGVSLSLPAALQVLVKNAETITSSWNSAAEISLFIEDNRSEQTIQSLLTRIRT
                     YSEVDKVQYIDKNQALEEFQRLSGFGEALAYLDKNPLPAVITVTPTPRYSTPVGAREL
                     LTKLEREPEISFGRLDIEWLERLQAVVRLLERTVMAIAALLVLAVVLVIGNTIRLAIM
                     NRRSEIEVMKLVGATEAFIQRPFLYTGIWYGVIGGILAWLIINLLVWYLDSALAELLG
                     LYGSQLEMKSLTFTELLQLVGLASFLGWLGSYLSVRQHLRSIEPS"
     misc_feature    198832..199740
                     /locus_tag="Sbal_0173"
                     /note="Cell division protein [Cell division and chromosome
                     partitioning]; Region: FtsX; COG2177"
                     /db_xref="CDD:225088"
     misc_feature    198868..199743
                     /locus_tag="Sbal_0173"
                     /note="cell division ABC transporter subunit FtsX;
                     Provisional; Region: ftsX; PRK11026"
                     /db_xref="CDD:182910"
     gene            199971..200828
                     /locus_tag="Sbal_0174"
                     /db_xref="GeneID:4845569"
     CDS             199971..200828
                     /locus_tag="Sbal_0174"
                     /note="binds with the catalytic core of RNA polymerase to
                     produce the holoenzyme; this sigma factor is responsible
                     for the expression of heat shock promoters"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="YP_001048577.1"
                     /db_xref="GI:126172428"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR012759"
                     /db_xref="GeneID:4845569"
                     /translation="MTFQTQSMALTVPQGASSLEAYIHSVTSISMLDAEAEYELAKRL
                     QETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPDVGV
                     RLVSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNIRKAKKRLGWFSDAEVTMV
                     AENLGVSKADVTEMESRMAAQDPAFDLTNDQDEEHDFAPVHYLEDHSSDLAENIENDN
                     WESNAQGRLLSAIKTLDERSQHILRARWLDDDKTTLQELAETYQVSAERIRQLEKNAM
                     NKLKACMEA"
     misc_feature    199983..200825
                     /locus_tag="Sbal_0174"
                     /note="RNA polymerase factor sigma-32; Reviewed; Region:
                     PRK06596"
                     /db_xref="CDD:235838"
     misc_feature    200136..200348
                     /locus_tag="Sbal_0174"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    200646..200810
                     /locus_tag="Sbal_0174"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(200673..200675,200703..200705,200727..200732,
                     200760..200762,200766..200771,200775..200783,
                     200787..200792,200796..200798)
                     /locus_tag="Sbal_0174"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(200930..202342)
                     /locus_tag="Sbal_0175"
                     /db_xref="GeneID:4843645"
     CDS             complement(200930..202342)
                     /locus_tag="Sbal_0175"
                     /note="TIGRFAM: O-succinylbenzoate-CoA ligase;
                     PFAM: AMP-dependent synthetase and ligase;
                     KEGG: son:SO4576 O-succinylbenzoic acid--CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate--CoA ligase"
                     /protein_id="YP_001048578.1"
                     /db_xref="GI:126172429"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010192"
                     /db_xref="GeneID:4843645"
                     /translation="MSDKRLSKSLTLSPVHQAALAFPQQTAIKLAGQDIRYSELSQRV
                     IALGQQLRAAGIAEGEPLACISLNNLEMICLYWACIDIGAIFFPISPRFPLAQIQGLI
                     DEHQIRYVWRAEISDLQNCSQLALDFNRLSNELAQPVDITRPANVILTSGSSGFPKAA
                     VHCLANHIANAEGARSLIPLEQGDAWLLSLPLFHIGGLAILNRCALVGATVVMPDQAL
                     SLSQQIDQDKLTHLSLVPAQLSKLLADTSSKLQSIKALLLGGGAVSLDLLAELKQRNI
                     ASYTSYGMTEMGSQITTGPALSDGSSGKLLPKRELKIEDSVIWVRGECLFMGYLAPEG
                     IQAGVDQEGWFYTKDRGEWDENGNLHILGRVDNMFICGGENIQPEEIEAALKQHPQID
                     DAIVFAIPNAQFGNLPAAILRGSLTHHTESIANELELFLADKIARFKRPRQYYVWPEN
                     HEQAGLKVNRKALIANLVKH"
     misc_feature    complement(200954..202318)
                     /locus_tag="Sbal_0175"
                     /note="O-succinylbenzoic acid--CoA ligase; Provisional;
                     Region: PRK09029"
                     /db_xref="CDD:236363"
     misc_feature    complement(200948..202234)
                     /locus_tag="Sbal_0175"
                     /note="O-succinylbenzoate-CoA ligase (also known as
                     O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or
                     MenE); Region: OSB_CoA_lg; cd05912"
                     /db_xref="CDD:213280"
     misc_feature    complement(order(201869..201874,201878..201895,
                     201902..201904))
                     /locus_tag="Sbal_0175"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213280"
     misc_feature    complement(order(200972..200974,201218..201220,
                     201251..201253,201260..201262,201296..201298,
                     201488..201505,201563..201568,201893..201895))
                     /locus_tag="Sbal_0175"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213280"
     misc_feature    complement(order(201029..201031,201218..201229,
                     201251..201253,201260..201262,201296..201298,
                     201488..201505,201563..201568,201620..201622,
                     201629..201634,201638..201640,201770..201775,
                     201893..201895))
                     /locus_tag="Sbal_0175"
                     /note="putative active site [active]"
                     /db_xref="CDD:213280"
     misc_feature    complement(order(201029..201031,201047..201049,
                     201221..201229,201566..201568,201620..201622,
                     201629..201634,201773..201775))
                     /locus_tag="Sbal_0175"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213280"
     gene            complement(202343..203443)
                     /locus_tag="Sbal_0176"
                     /db_xref="GeneID:4842426"
     CDS             complement(202343..203443)
                     /locus_tag="Sbal_0176"
                     /note="catalyzes the dehydration of
                     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
                     to form O-succinylbenzoate"
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoate synthase"
                     /protein_id="YP_001048579.1"
                     /db_xref="GI:126172430"
                     /db_xref="InterPro:IPR001354"
                     /db_xref="GeneID:4842426"
                     /translation="MILTSLNLYQYRLPLDVLLPVGKQRIDHRAGLVLQACASANVGD
                     EYKQVEVEIAPLSGIDVDEQVFVGFSRETLAQVQTALTELLPQLGGQHIDTLLDYAEQ
                     SPYPSLAFGLSLLHAKLMGKLDAIRPQTATVPLIYHPSDAGKDLHDNKIAALGMHVHS
                     VKVKVAQTSIEDELSLIYGILRTRPDLKLRLDANRGFTLEQAIEFAACLPLDTIEYIE
                     EPCQNPQDNLEFYQAIGMPYALDESLNDPDYQFAMQNGLTALVIKPMLLGSIEKLANL
                     IDTAQSYGVRCIISSSLESSLGISDLAHLAAILTPDEIPGLDTLSAFNQDLIVSSGKK
                     HFLSLAQLEPVAQHAIDSTQQSDLGAAKREEN"
     misc_feature    complement(202406..203437)
                     /locus_tag="Sbal_0176"
                     /note="O-succinylbenzoate synthase; Provisional; Region:
                     PRK05105"
                     /db_xref="CDD:235345"
     misc_feature    complement(202487..203428)
                     /locus_tag="Sbal_0176"
                     /note="o-Succinylbenzoate synthase (OSBS) catalyzes the
                     conversion of
                     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate
                     (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate
                     (o-succinylbenzoate or OSB), a reaction in the menaquinone
                     biosynthetic pathway; Region: OSBS; cd03320"
                     /db_xref="CDD:239436"
     misc_feature    complement(order(202496..202498,202571..202576,
                     202655..202657,202721..202723,202790..202792,
                     202862..202864,202868..202870,202958..202960))
                     /locus_tag="Sbal_0176"
                     /note="active site"
                     /db_xref="CDD:239436"
     gene            complement(203471..204265)
                     /locus_tag="Sbal_0177"
                     /db_xref="GeneID:4844477"
     CDS             complement(203471..204265)
                     /locus_tag="Sbal_0177"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: shn:Shewana3_3966 alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="YP_001048580.1"
                     /db_xref="GI:126172431"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="GeneID:4844477"
                     /translation="MPNMARYGDPSLPTLVLLHGFLGTKADWLPLMPALSQHFYCICL
                     DLPGHGDNQAEGSTEARLDFDFCVESIMARLDSLNPSPDKFHLYGYSLGGRIALHLAK
                     AYPQRLLSLNLESCHPGLADPQEKTARTKNDTQWAERLLHLASKDFLNLWYQQPVFAD
                     MTAAKRKALIEQRSAILDQHPKQLLKEVFLATSLARQASMWDVPSQLACECHFFAGSQ
                     DTKFHALAQEWQLHAPILVHNISGAGHNIHQAAPEALITKIVKLLG"
     misc_feature    complement(203477..204235)
                     /locus_tag="Sbal_0177"
                     /note="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase; Region:
                     menH_SHCHC; TIGR03695"
                     /db_xref="CDD:234315"
     misc_feature    complement(203477..204229)
                     /locus_tag="Sbal_0177"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(204265..205986)
                     /locus_tag="Sbal_0178"
                     /db_xref="GeneID:4843720"
     CDS             complement(204265..205986)
                     /locus_tag="Sbal_0178"
                     /EC_number="4.1.1.71"
                     /note="SEPHCHC synthase; forms
                     5-enolpyruvoyl-6-hydroxy-2-succinyl-cyclohex-3-ene-1-
                     carboxylate from 2-oxoglutarate and isochorismate in
                     menaquinone biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylate synthase"
                     /protein_id="YP_001048581.1"
                     /db_xref="GI:126172432"
                     /db_xref="InterPro:IPR004433"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="GeneID:4843720"
                     /translation="MRTENTATLNLIWGALILEELARLGVQHVCMAPGSRSTPLTLAA
                     AQQTKLQRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAVANLYPAIVEAWLTHVP
                     LIVLSGDRPPELLGCGANQAIVQPGIFANYATQVNLPTPDAHIAPQALLTTVDEAVAN
                     QTRPVHINCMYREPLYPSELSGVILDAESPYLKPLQTWLQLARPYTQYGKSKQLSSPS
                     DDAIMRFVHGKGVIVVGTLTPEQDPQQLIALSQKIGWPLLTDAQSQLRQHPAAIGNID
                     QLLQHPKARNLLQEADRVLVFGGRLLSKRVIGYLAEQNWHSYWQVLPEQDRLDPSHNA
                     KHIWHANAEQFAALNWYRSSSANWANTLITYNDELHNLFVRNIDQGEFGEAQVIRAIA
                     NTRPLEQQLFIGNSLPVRLYDMYAPVSCCTATTYTNRGASGIDGLLATACGIAAHEGK
                     PTSLIIGDLSQLHDLNSLAIAKGLSSPLVIVILNNDGGNIFNLLPVPNEQVRSEYYRL
                     SHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALDFQGASIIEVNVSQNQASDQIAAL
                     NLWVKQS"
     misc_feature    complement(204268..205980)
                     /locus_tag="Sbal_0178"
                     /note="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
                     carboxylate synthase; Validated; Region: PRK07449"
                     /db_xref="CDD:236020"
     misc_feature    complement(205474..205944)
                     /locus_tag="Sbal_0178"
                     /note="Pyrimidine (PYR) binding domain of
                     2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-
                     carboxylate synthase (MenD) and related proteins; Region:
                     TPP_PYR_MenD; cd07037"
                     /db_xref="CDD:132920"
     misc_feature    complement(order(205591..205596,205603..205605,
                     205615..205617,205624..205629,205648..205650,
                     205705..205707,205714..205719,205723..205728,
                     205735..205737,205810..205827,205831..205833,
                     205873..205875,205885..205890,205894..205896))
                     /locus_tag="Sbal_0178"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132920"
     misc_feature    complement(order(205591..205596,205603..205605,
                     205615..205617,205624..205629,205648..205650,
                     205705..205707,205714..205719,205723..205728,
                     205735..205737,205810..205827,205831..205833,
                     205873..205875,205885..205890,205894..205896))
                     /locus_tag="Sbal_0178"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132920"
     misc_feature    complement(order(205624..205629,205693..205695,
                     205702..205704,205714..205716,205723..205725,
                     205735..205737,205774..205779,205783..205791,
                     205795..205800,205807..205833,205873..205875,
                     205885..205890,205894..205896))
                     /locus_tag="Sbal_0178"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132920"
     misc_feature    complement(205813..205815)
                     /locus_tag="Sbal_0178"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132920"
     misc_feature    complement(<205051..205302)
                     /locus_tag="Sbal_0178"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(204322..204843)
                     /locus_tag="Sbal_0178"
                     /note="Thiamine pyrophosphate (TPP) family, SHCHC synthase
                     subfamily, TPP-binding module; composed of proteins
                     similar to Escherichia coli
                     2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid
                     (SHCHC) synthase (also called MenD). SHCHC synthase plays
                     a key...; Region: TPP_SHCHC_synthase; cd02009"
                     /db_xref="CDD:238967"
     misc_feature    complement(order(204526..204528,204532..204534,
                     204607..204618,204685..204687))
                     /locus_tag="Sbal_0178"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238967"
     gene            complement(206168..207136)
                     /locus_tag="Sbal_0179"
                     /db_xref="GeneID:4841665"
     CDS             complement(206168..207136)
                     /locus_tag="Sbal_0179"
                     /note="PFAM: regulatory protein, LysR;
                     KEGG: shn:Shewana3_3964 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048582.1"
                     /db_xref="GI:126172433"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="GeneID:4841665"
                     /translation="MHISNMDGLDILSLKILVSLYENKSATYVSKALDIPAPKISRSL
                     KNLREIFGDELFIRRKYGLFPNEFATHLYPIAKEAIECTDKFHKARAANANLVKTHIE
                     IAAPGLIAYAFPKALMQAIKDEQKLMHINITPWSMHTTQDIINGDTTLGICCNKSTAD
                     VAAFGDKLLTTTLQSMDKVYLLASRNHPIFKREITLETIAEYPYVNTDLGNPSSKLSP
                     YQEFCLKSNIKLNTEITITSISSLFEYLGESQALSLLPYRVVYEMVSDVAELHTCQLS
                     QLEAERLYAHAEAPTIFLVQKNQPNKVNDDLVWLSGQIKKIVDHII"
     misc_feature    complement(206345..207112)
                     /locus_tag="Sbal_0179"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(206930..207097)
                     /locus_tag="Sbal_0179"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(206312..206830)
                     /locus_tag="Sbal_0179"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(206393..206398,206402..206407,
                     206423..206440,206735..206755,206759..206761,
                     206771..206773,206780..206785,206789..206794))
                     /locus_tag="Sbal_0179"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            207546..208022
                     /locus_tag="Sbal_0180"
                     /db_xref="GeneID:4845674"
     CDS             207546..208022
                     /locus_tag="Sbal_0180"
                     /note="KEGG: shn:Shewana3_3963 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048583.1"
                     /db_xref="GI:126172434"
                     /db_xref="GeneID:4845674"
                     /translation="MNTSVILSYAFMYFVLFVAVPFVFVMFVMTCIKFFKAGPDEAEH
                     HEMKLKPVLFDKQSFNFFKSLKTVVEGKYDVCCNVPLDTVFEMDQHDADLNHECRLDY
                     VLIDHDSSEVKMVISDFGKEHNSPMKKLFSKFNINFIEMNQHKQWDTQSLKQALAV"
     misc_feature    207648..>207890
                     /locus_tag="Sbal_0180"
                     /note="radical SAM peptide maturase, FibroRumin system;
                     Region: rSAM_FibroRumin; TIGR04136"
                     /db_xref="CDD:200387"
     gene            208100..208561
                     /locus_tag="Sbal_0181"
                     /db_xref="GeneID:4842517"
     CDS             208100..208561
                     /locus_tag="Sbal_0181"
                     /note="KEGG: she:Shewmr4_3764 formate-dependent nitrite
                     reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="formate-dependent nitrite reductase"
                     /protein_id="YP_001048584.1"
                     /db_xref="GI:126172435"
                     /db_xref="InterPro:IPR011031"
                     /db_xref="GeneID:4842517"
                     /translation="MSKRQWLWSIRLGAIALLLSFGATSAESALQINSDTTCMKCHKR
                     NGQMLGHHGQDAMKMTCSTCHGEKGDHPKKPNDIVVFGMKDGSELDTQLAVCHKCHTQ
                     RKLGETEWTHNVHAQKVPCAACHKLHSPTEPMADMTPKVRSELCRNCHSGQ"
     misc_feature    208187..208558
                     /locus_tag="Sbal_0181"
                     /note="cytochrome c nitrite reductase, pentaheme subunit;
                     Region: cyt_nit_nrfB; TIGR03146"
                     /db_xref="CDD:132190"
     misc_feature    208265..208552
                     /locus_tag="Sbal_0181"
                     /note="Cytochrome c3; Region: Cytochrom_c3_2; pfam14537"
                     /db_xref="CDD:258677"
     gene            208571..209257
                     /locus_tag="Sbal_0182"
                     /db_xref="GeneID:4842612"
     CDS             208571..209257
                     /locus_tag="Sbal_0182"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: she:Shewmr4_3763 twin-arginine translocation pathway
                     signal"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_001048585.1"
                     /db_xref="GI:126172436"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4842612"
                     /translation="MENSKRRFLKGTCALFAGATGASLLATVNAAEGAKAESDIKYAM
                     IHDETKCIGCRACEVACRETNQVPEGVSRVRIEQTGPFGEYPNEYYHFSRISCQHCED
                     APCVNVCPTGAAFIDKETGIVSVNAWKCVGCQYCIAACPYKIRFINPVTHAADKCDFC
                     RETNLAQGKQPACVEACPTKALVFGNLKDPTSELVQVLRANPTQRAKVALGTRPKLFR
                     ILAKSGEVIL"
     misc_feature    208580..209248
                     /locus_tag="Sbal_0182"
                     /note="cytochrome c nitrite reductase, Fe-S protein;
                     Region: cyt_nit_nrfC; TIGR03149"
                     /db_xref="CDD:234122"
     misc_feature    208835..209131
                     /locus_tag="Sbal_0182"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            209254..210195
                     /locus_tag="Sbal_0183"
                     /db_xref="GeneID:4841805"
     CDS             209254..210195
                     /locus_tag="Sbal_0183"
                     /note="PFAM: Polysulphide reductase, NrfD;
                     KEGG: shn:Shewana3_3960 polysulphide reductase, NrfD"
                     /codon_start=1
                     /transl_table=11
                     /product="polysulfide reductase, NrfD"
                     /protein_id="YP_001048586.1"
                     /db_xref="GI:126172437"
                     /db_xref="InterPro:IPR005614"
                     /db_xref="GeneID:4841805"
                     /translation="MSALHFDTLVWHWPIAIYLFLAGVSAGAMFFAVLLKHFVLKQNA
                     YQSGFVRAACIVAPVAVMAGLGILVADLTKPLDFWKILVFYNPKSVMSMGVLILLIYQ
                     VFMFMWIGLTFRKPVDAWCESRFPIVLKLTALLARFEATITGLLVILSLALGAYTGFL
                     LSALPGYPMLKNPVLPLLFLASGLSSGAASSLLGGVLMNGKPNDKEVHFIHKVEIPLI
                     LVEIVLLFTFFVGLLLTGGQSKIAAFNALGYGFWGWIFWVGIIGLGLSGPLAMNLFMT
                     TTSKRKWAYVAGTACLSLIGVLLLRNFILYTGQMTIA"
     misc_feature    209257..210192
                     /locus_tag="Sbal_0183"
                     /note="cytochrome c nitrite reductase, NrfD subunit;
                     Region: cyt_nit_nrfD; TIGR03148"
                     /db_xref="CDD:234121"
     gene            complement(210474..210905)
                     /locus_tag="Sbal_0184"
                     /db_xref="GeneID:4844685"
     CDS             complement(210474..210905)
                     /locus_tag="Sbal_0184"
                     /note="PFAM: regulatory protein, AsnC/Lrp family;
                     KEGG: shn:Shewana3_3959 transcriptional regulator, AsnC
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_001048587.1"
                     /db_xref="GI:126172438"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="GeneID:4844685"
                     /translation="MDKFDTAIIHSLRQDARQSVSNIAEQVNLSRSAVAERIKKLEQT
                     GVIRGYQVLLSESQKEGVSAYFEIQHQCPRCADVVHVFQAIPEVITCRGISGDMDLLV
                     YVHAPSMRRLHEIREYIDTHTDIIKIKTHVVMSEWINNLGE"
     misc_feature    complement(210486..210905)
                     /locus_tag="Sbal_0184"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(210639..210887)
                     /locus_tag="Sbal_0184"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(210639..210647,210651..210659,
                     210663..210668,210771..210773,210861..210863,
                     210873..210878,210885..210887))
                     /locus_tag="Sbal_0184"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(210666..210668,210840..210842,
                     210849..210851))
                     /locus_tag="Sbal_0184"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(210708..210716,210729..210737,
                     210777..210782,210786..210791,210798..210803,
                     210807..210818,210843..210851))
                     /locus_tag="Sbal_0184"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(210498..210683)
                     /locus_tag="Sbal_0184"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            211157..212419
                     /locus_tag="Sbal_0185"
                     /db_xref="GeneID:4842622"
     CDS             211157..212419
                     /locus_tag="Sbal_0185"
                     /note="uncharacterized member of the APC superfamily of
                     amino acid transporters; unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YjeH"
                     /protein_id="YP_001048588.1"
                     /db_xref="GI:126172439"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="GeneID:4842622"
                     /translation="MNSNSGTIGRWQGAGLMATTLLGTGVFILPQMTIEKAQSGALVA
                     WILLTLAIIPVALVFGRLASVFPHAAGPAYFVEKAFGRTAGRTIGLIFLLVVPMGAPA
                     AILMTFQFVNALMPISGWSKVGVEVLVIFGLFLINLRGIQVSAKLQFGLTLCIVAVVV
                     LLFGASSFQPGHLTTLASHGMPEMPTVMIAAGIAFWSFLGIEAMTHLADDFRRPQQDM
                     IPAMMMGTVLVGVIYVACTLLLLLVPTDKSVAMIGVFDQLLGGYGAQVIGVLGIASGL
                     ATVNVYSASAARLVWSFSCEGILPRFFAVKNAHGVPIRALAALLSVMASVIVLTYLTG
                     QELEHLIAWSNGVFVVIYLMAMLAAAKLLPRHNWPLVALGCAFCLALGFALGASMSYV
                     LVLILVVAPFLWWQKTHISRKQGLAIPE"
     misc_feature    211178..212395
                     /locus_tag="Sbal_0185"
                     /note="putative transporter; Provisional; Region:
                     PRK11021"
                     /db_xref="CDD:236823"
     gene            complement(212510..213121)
                     /locus_tag="Sbal_0186"
                     /db_xref="GeneID:4841797"
     CDS             complement(212510..213121)
                     /locus_tag="Sbal_0186"
                     /note="TIGRFAM: TonB family protein;
                     PFAM: Gram-negative tonB protein;
                     KEGG: shm:Shewmr7_3832 TonB family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB family protein"
                     /protein_id="YP_001048589.1"
                     /db_xref="GI:126172440"
                     /db_xref="InterPro:IPR003538"
                     /db_xref="InterPro:IPR006260"
                     /db_xref="GeneID:4841797"
                     /translation="MSQNALVSRTGLILASALITLGLFVFMAQLINNPQTITGQASDA
                     PQINILMAERTPIPPKEKTKPEPPKPIPVRERVSVPGETSESLTFTPETFMPEMPTQT
                     TLYTQSAMTAEALPVVQVSPRYPIDAAQSGKEGYVVVGFDITADGTVSNVRVLDANPK
                     RVFDKAALSAVQNWKYKPKFDAGKAVAQLNQQVQLDFKLDQKI"
     misc_feature    complement(212735..>212977)
                     /locus_tag="Sbal_0186"
                     /note="TIGR03809 family protein; Region: TIGR03809"
                     /db_xref="CDD:163521"
     misc_feature    complement(212516..>212956)
                     /locus_tag="Sbal_0186"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    complement(212525..212758)
                     /locus_tag="Sbal_0186"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     gene            213462..214286
                     /locus_tag="Sbal_0187"
                     /db_xref="GeneID:4841840"
     CDS             213462..214286
                     /locus_tag="Sbal_0187"
                     /note="PFAM: HDOD;
                     KEGG: shn:Shewana3_3956 putative signal transduction
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein"
                     /protein_id="YP_001048590.1"
                     /db_xref="GI:126172441"
                     /db_xref="InterPro:IPR013976"
                     /db_xref="GeneID:4841840"
                     /translation="MDSAALLNRVDELPRLPKAISELLDAVNDDNATVKSIATKVAHD
                     PLISARVLRLANCAHYGRSREVGTIDEAVVRLGMQTLRTLVLASAVIGAVPKCEGIDL
                     AQFWGQTFEIALYSQEMAKRCGAIPEEAFTCGILHRIGDLLIAAVSPEDAAKIAEAVA
                     QGKDKHEFERELLGYDSPDIGALLAKNWKFTTALVEGILYQDHPKDSDPFSKLAALLC
                     LSYKVLDEWDTIEDDEKTSWLSQLATKKGLRMEMGGLRTKLTELRGSGFEIGKALA"
     misc_feature    213498..214073
                     /locus_tag="Sbal_0187"
                     /note="HDOD domain; Region: HDOD; pfam08668"
                     /db_xref="CDD:254961"
     gene            complement(214571..215044)
                     /locus_tag="Sbal_0188"
                     /db_xref="GeneID:4842769"
     CDS             complement(214571..215044)
                     /locus_tag="Sbal_0188"
                     /note="PFAM: protein of unknown function DUF1332;
                     KEGG: son:SO4562 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048591.1"
                     /db_xref="GI:126172442"
                     /db_xref="InterPro:IPR010755"
                     /db_xref="GeneID:4842769"
                     /translation="MIAKLRRFFEAHTQAVSPEDKAHQLKLAAASMLLEVVFADDTLT
                     AEEEALLPKLLTDTLSMSEADAKILIDEAKSVQGSATSLFEFTSAINAEFSLAQKQQL
                     LLAMWQLAYADGQLSQYEDQIIRRTADLLYLKHSELIQMRNLAIAANRHIDQAPQ"
     misc_feature    complement(214652..214963)
                     /locus_tag="Sbal_0188"
                     /note="tellurium resistance terB-like protein, subgroup 2;
                     Region: terB_like_2; cd07313"
                     /db_xref="CDD:143584"
     misc_feature    complement(order(214685..214687,214706..214708,
                     214904..214906,214925..214927))
                     /locus_tag="Sbal_0188"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:143584"
     gene            complement(215145..215675)
                     /locus_tag="Sbal_0189"
                     /db_xref="GeneID:4842725"
     CDS             complement(215145..215675)
                     /locus_tag="Sbal_0189"
                     /note="KEGG: she:Shewmr4_3756 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048592.1"
                     /db_xref="GI:126172443"
                     /db_xref="GeneID:4842725"
                     /translation="MKHTLTLSIFLGTCILAAPASAGWLDNLAGTQAKTEKAATTATA
                     TQSNDLVGSVMSQLGLNQTQAEGGLGSLLGLAQSSLGTTDYSKLAASIPNADSLLAAA
                     PKLDSKSGVSGLLSKAGDLGSSLQGSAMVLDAFEKLGISKDLAMPMINIAKSYLDTNG
                     TEGTSDLLMKGLNSLL"
     misc_feature    complement(215157..215651)
                     /locus_tag="Sbal_0189"
                     /note="Protein of unknown function VcgC/VcgE (DUF2780);
                     Region: DUF2780; pfam11075"
                     /db_xref="CDD:256279"
     gene            215865..216572
                     /locus_tag="Sbal_0190"
                     /db_xref="GeneID:4844938"
     CDS             215865..216572
                     /locus_tag="Sbal_0190"
                     /note="KEGG: shm:Shewmr7_3828 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048593.1"
                     /db_xref="GI:126172444"
                     /db_xref="GeneID:4844938"
                     /translation="MSLSAILSEAYNFFRNHLAQLAMLTIPLLLIQVGIQLWLGVEMS
                     KVDLENPQFGVPHMVAMMLLLLTFSVLIAALTLFLELRSQGHSPSAGMVLKASLPFVP
                     PLLLAGVFSGLAILAPVMLFAAFGPLWLVGLVISFYLFARLAYVNFMVVVERLTPLEA
                     IKGSFSFSGPIVLRTIALLMLYLPLSVVGNLLSGAASMGGLPLQMLSDTFMSFIGLFV
                     NVALFRLYMVSKKPSVE"
     gene            216606..218081
                     /locus_tag="Sbal_0191"
                     /db_xref="GeneID:4842319"
     CDS             216606..218081
                     /locus_tag="Sbal_0191"
                     /note="PFAM: Sel1 domain protein repeat-containing
                     protein;
                     KEGG: she:Shewmr4_3754 Sel1 domain protein
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein"
                     /protein_id="YP_001048594.1"
                     /db_xref="GI:126172445"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="GeneID:4842319"
                     /translation="MGTKTVIKDSEFIQDFSASLSDDYLKAKSYVQDVPTQSLLHIRS
                     FTHKLTELLGQDKHIVFSSPNLYDRIEQLNQQRVIDVKTTRALHRLRADGNRGAHPEK
                     YHLTQAQLLALVQKSIKDVLALVEHLYPKVKGQVAPDYRYEASDAMTAKDLCYRAVME
                     DDAEAQYLVGISFKTKALILKEQELQQDQEFATSAEATSNPEFSGVSPLTSHISAADS
                     FARAAYWFALAAPRHMEALHEHGVALIHGYQGVPEVAKGEQLIATAAEAGVVNAMALL
                     GYFYLVGSESFQPDSKLALQYLQRAAEGEQTEAMANLGVLYYQQKNLTQAYHFISKAA
                     QAGYPHAQYHLALMLANGDGCTRDMIASEYWMAEAAEQGQLDAMLTRAQHMINDDNAF
                     GSDLTQAEDYLRQVIKYGHSVPAMIELSMALADGMLGRIDVVGAAALLKLARQHANKK
                     EAEIIEPLWRSLALQIKNVLKVTQDPAEIHSLNRAQTLLVI"
     misc_feature    216684..216950
                     /locus_tag="Sbal_0191"
                     /note="Domain of unknown function (DUF4145); Region:
                     DUF4145; pfam13643"
                     /db_xref="CDD:257953"
     misc_feature    217185..217841
                     /locus_tag="Sbal_0191"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    217620..217724
                     /locus_tag="Sbal_0191"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            complement(218167..218514)
                     /locus_tag="Sbal_0192"
                     /db_xref="GeneID:4844609"
     CDS             complement(218167..218514)
                     /locus_tag="Sbal_0192"
                     /note="KEGG: shm:Shewmr7_3826 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048595.1"
                     /db_xref="GI:126172446"
                     /db_xref="GeneID:4844609"
                     /translation="MIYQQFQQSPLQTRISGPRAWLAMAISVSLICLSLFLLPFVLLF
                     GAIALGCLVLFSRFYMARQLAKFNQAQANAKQHAHAADEPLSQVYGSETIVRESNATR
                     HQGRTFEHKEDEH"
     gene            218889..220760
                     /locus_tag="Sbal_0193"
                     /db_xref="GeneID:4841806"
     CDS             218889..220760
                     /locus_tag="Sbal_0193"
                     /note="PFAM: histidine kinase, HAMP region domain protein;
                     Cache domain protein; chemotaxis sensory transducer;
                     KEGG: shm:Shewmr7_3825 methyl-accepting chemotaxis sensory
                     transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_001048596.1"
                     /db_xref="GI:126172447"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004010"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="GeneID:4841806"
                     /translation="MNSYSLKQKILFSVVVALSLVIGLLSWQSYSSQKSQLLKNSLEQ
                     VQRLGEQQAERIQEWLAGRQDIMGALASKVEGDSLNTLQQAQASGRFQLTYFGSQAGQ
                     MLDSDPSVDRTGYDPRSRPWYQQAISARGPILTKPYVDVAYNILVVTMAQPTAQGVVG
                     GDLSIASLVDGVNRMKLPANGYAIMMHKDGTVIAYKDQAKTMKPIGEIDNDLNRNVPE
                     QSRAAGTLLPMYFENEGRDKLVWSVDIPNTDWELVLVLDKETLEAPLSSLLFTQLGLA
                     ALALLLSVLAISWLVGMLLGPLSRVSQALAHIADGNGDLTQRISVDTQDEVGVLADSF
                     NRFVGSQHQLISHIRQLANELDADAERSLATTQTSVTELQRQQQEVAMVATAVTEMAS
                     ATNEIAANAENTATAAQQSAASSLQGKELVNKTRNSINSLADEVTQATDVIADLSRHA
                     QSISSILATIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQE
                     VHTTIETLQRTTARAVSLMESSQALAGHSVEDANAAAKALEEITQAVNVISDMAGQIA
                     TAAEEQTQVTGEITQNTVAIKDVTDEITASAMADLAQARGLKARANDLNAQVATFIL"
     misc_feature    219288..219512
                     /locus_tag="Sbal_0193"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    219768..219908
                     /locus_tag="Sbal_0193"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(219768..219773,219780..219785,219789..219794,
                     219801..219806,219810..219812,219864..219869,
                     219873..219878,219885..219890,219894..219899,
                     219906..219908)
                     /locus_tag="Sbal_0193"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    220005..220751
                     /locus_tag="Sbal_0193"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    220050..220634
                     /locus_tag="Sbal_0193"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(220074..220079,220086..220091,220098..220100,
                     220107..220112,220116..220121,220128..220130,
                     220137..220142,220149..220151,220158..220163,
                     220170..220175,220182..220184,220191..220196,
                     220200..220205,220215..220217,220221..220226,
                     220233..220235,220242..220247,220254..220259,
                     220266..220268,220275..220277,220284..220289,
                     220296..220298,220308..220310,220317..220319,
                     220338..220340,220350..220352,220359..220361,
                     220368..220373,220380..220382,220389..220394,
                     220401..220406,220410..220415,220422..220427,
                     220464..220469,220476..220478,220485..220490,
                     220497..220499,220506..220511,220515..220520,
                     220527..220532,220539..220541,220548..220553,
                     220560..220562,220569..220574,220578..220583,
                     220590..220595,220599..220604,220611..220613,
                     220620..220625,220632..220634)
                     /locus_tag="Sbal_0193"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    220284..220385
                     /locus_tag="Sbal_0193"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            221163..223034
                     /locus_tag="Sbal_0194"
                     /db_xref="GeneID:4844123"
     CDS             221163..223034
                     /locus_tag="Sbal_0194"
                     /note="PFAM: histidine kinase, HAMP region domain protein;
                     Cache domain protein; chemotaxis sensory transducer;
                     KEGG: shm:Shewmr7_3825 methyl-accepting chemotaxis sensory
                     transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_001048597.1"
                     /db_xref="GI:126172448"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004010"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="GeneID:4844123"
                     /translation="MKSYSLRQKILLSVILALSAVILLLSWQSYTSQKKVLLDVNLEQ
                     AQRLGDQQALLIGEWLASRQKIVKGLAGQRNNDIVQAMKQAKQSGGFESTYFGESNGN
                     MRDSEPATDYTNYDPRTRPWYQEAMRTGGSVLTRPYLDTAFNILVVTLAEPVAGGVIA
                     GDLSISNLIEEVNRMKLPANGYAIMMHKDGTVIAYKDQAKTMKPIGEIDNELNNNLPE
                     LSRTTSTLLPMYFEGEARDKLVWGVDIPNTDWELVLVLDKETLEAPLSSLLLTQFGLS
                     ALVLILSVLAISWLVSVLLGPLSRVSQALARIADGNGDLTQRISVDTQDEVGVLADSF
                     NRFVGSQHQLISHIRQLANELDADAERSLATTQTSVTELQRQQQEVAMVATAVTEMAS
                     ATNEIAANAENTATAAQQSAASSLQGKELVNKTRNSINSLADEVAQATDVIEDLSRHA
                     KSISSILATIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQE
                     VHTTIETLQRTTARAVSLMESSQALAGHSVEDANAAAKALEEITQAVNVISDMAGQIA
                     TAAEEQTQVTGEITQNTVAIKDVTDEITASAMADLAQARGLKARANDLNAQVATFIL"
     misc_feature    221562..221786
                     /locus_tag="Sbal_0194"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    222042..222182
                     /locus_tag="Sbal_0194"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(222042..222047,222054..222059,222063..222068,
                     222075..222080,222084..222086,222138..222143,
                     222147..222152,222159..222164,222168..222173,
                     222180..222182)
                     /locus_tag="Sbal_0194"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    222252..223025
                     /locus_tag="Sbal_0194"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    222324..222908
                     /locus_tag="Sbal_0194"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(222348..222353,222360..222365,222372..222374,
                     222381..222386,222390..222395,222402..222404,
                     222411..222416,222423..222425,222432..222437,
                     222444..222449,222456..222458,222465..222470,
                     222474..222479,222489..222491,222495..222500,
                     222507..222509,222516..222521,222528..222533,
                     222540..222542,222549..222551,222558..222563,
                     222570..222572,222582..222584,222591..222593,
                     222612..222614,222624..222626,222633..222635,
                     222642..222647,222654..222656,222663..222668,
                     222675..222680,222684..222689,222696..222701,
                     222738..222743,222750..222752,222759..222764,
                     222771..222773,222780..222785,222789..222794,
                     222801..222806,222813..222815,222822..222827,
                     222834..222836,222843..222848,222852..222857,
                     222864..222869,222873..222878,222885..222887,
                     222894..222899,222906..222908)
                     /locus_tag="Sbal_0194"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    222558..222659
                     /locus_tag="Sbal_0194"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(223119..224090)
                     /locus_tag="Sbal_0195"
                     /db_xref="GeneID:4845811"
     CDS             complement(223119..224090)
                     /locus_tag="Sbal_0195"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: shm:Shewmr7_3824 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048598.1"
                     /db_xref="GI:126172449"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:4845811"
                     /translation="MNIDNLARIDLNLLVILKVLLEEQSVTRAASRLHISQSALSKSL
                     NRLRETLDDPLFQRTAHGLKPTAHALILGQKLPNILQDLYQLTQPPTFNPASSNRQFS
                     FAMVESAYETLIPYFIGPMLTTAPNVKLDSYVWTEKSMQDLQQGQIDFGISGRDLHPL
                     SDFQVDRLPEGIAYQTLFTDQQVCLVREDHPLMAALTSAQWKLPLYLDMAHVQVRCEG
                     SDWWALDYFLADLGHRRRISTTVPDFYGAASVCAHSDLIFTLPSSFARHACQLYPLKL
                     LPLPFEFMPMAYVLLWHQRNDEDQGHKWIRETICESVAKLFTPAEIL"
     misc_feature    complement(223164..224075)
                     /locus_tag="Sbal_0195"
                     /note="DNA-binding transcriptional regulator YidZ;
                     Provisional; Region: PRK10216"
                     /db_xref="CDD:182312"
     misc_feature    complement(223884..224060)
                     /locus_tag="Sbal_0195"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(223158..223793)
                     /locus_tag="Sbal_0195"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    complement(order(223227..223229,223428..223430,
                     223551..223553,223752..223754,223764..223769,
                     223773..223775))
                     /locus_tag="Sbal_0195"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    complement(order(223332..223334,223341..223346,
                     223353..223358,223365..223379,223461..223463,
                     223689..223691,223695..223709,223713..223718,
                     223725..223730,223734..223739,223746..223751,
                     223758..223763,223770..223772))
                     /locus_tag="Sbal_0195"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            224204..225412
                     /locus_tag="Sbal_0196"
                     /db_xref="GeneID:4843951"
     CDS             224204..225412
                     /locus_tag="Sbal_0196"
                     /note="TIGRFAM: drug resistance transporter, Bcr/CflA
                     subfamily;
                     PFAM: major facilitator superfamily MFS_1;
                     KEGG: she:Shewmr4_3750 drug resistance transporter,
                     Bcr/CflA subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Bcr/CflA subfamily drug resistance transporter"
                     /protein_id="YP_001048599.1"
                     /db_xref="GI:126172450"
                     /db_xref="InterPro:IPR004812"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:4843951"
                     /translation="MRRNLLPILMSMVLLSPLAIDIYLPSMPTMAAEFAVSASDVQST
                     IVLFLFAMGLGQVLIGPLADRYGRRPVAIFGVLLYGASSLLAAAAIEFHWLQIARLLQ
                     GLAACSTSIVVFSAVRDCYDQKEGAKIYSYLNGAICVIPALAPTLGGLLAMQFGWRST
                     FVFMTLYAMLMLLVVGYRLPETRPANTVTTGPLYRWGRYKPVLGNTHFLFYAFACMSA
                     MAAILCYVSYAPVWLIGHLGLSELMFSGLFGFNAVFNIVACFTAPLVIRKLGNRPTTI
                     LALSILVLSAAITVAGQQFGPSTGMMAAFAFMLPMLMLGVGFSFLLGPATSMALSAFG
                     ERAGTAAAMLGFIQMSGASVLAGLVQQTNLTAPYAVALVMGVFPIGLLLMMALSRFDH
                     WHQEQLAGEH"
     misc_feature    224219..225361
                     /locus_tag="Sbal_0196"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    224225..225352
                     /locus_tag="Sbal_0196"
                     /note="drug resistance transporter, Bcr/CflA subfamily;
                     Region: efflux_Bcr_CflA; TIGR00710"
                     /db_xref="CDD:233099"
     misc_feature    order(224261..224263,224270..224278,224282..224287,
                     224336..224338,224345..224350,224357..224359,
                     224369..224374,224378..224383,224519..224524,
                     224531..224536,224543..224548,224555..224557,
                     224591..224596,224603..224608,224624..224626,
                     224858..224860,224867..224872,224879..224884,
                     224891..224893,224933..224935,224945..224947,
                     224957..224959,224966..224968,224978..224980,
                     225146..225148,225155..225160,225167..225169,
                     225179..225184,225191..225193,225221..225226,
                     225233..225238,225245..225250,225257..225259)
                     /locus_tag="Sbal_0196"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(225584..226417)
                     /locus_tag="Sbal_0197"
                     /db_xref="GeneID:4844976"
     CDS             complement(225584..226417)
                     /locus_tag="Sbal_0197"
                     /note="KEGG: sfr:Sfri_3123 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048600.1"
                     /db_xref="GI:126172451"
                     /db_xref="GeneID:4844976"
                     /translation="MHKRLISIAVVFGLLSTNTFAATDKAYQHDANINYGASSEAFSD
                     GGWSADYRYYSTPVSQDSAPYALSGFLAQTSNFGGKYSFNDDIDSYGVNGEYVFASKW
                     FVGANYFNLDSNFYDANTYGMNLGYYFNATSAVYASYSSSDGDYDAGLSAKGNSDTDA
                     FGIGIRSFIPLQSTAGIDLQANVYYSQSDNTLANGPNGQYNNSNNSTTVNLAADWYIT
                     RAWSIGANYSIQDDEDPYGINTAYHWRITDLISARAGIAKSLEPDWDGVDISLSLNGR
                     F"
     gene            226642..227265
                     /locus_tag="Sbal_0198"
                     /db_xref="GeneID:4844144"
     CDS             226642..227265
                     /locus_tag="Sbal_0198"
                     /note="PFAM: DTW domain containing protein;
                     KEGG: shn:Shewana3_3947 DTW domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DTW domain-containing protein"
                     /protein_id="YP_001048601.1"
                     /db_xref="GI:126172452"
                     /db_xref="InterPro:IPR005636"
                     /db_xref="GeneID:4844144"
                     /translation="MPRFYCAICRYPLNACLCASVQPISPMTQLVVLQHPSEVEHKKN
                     SVRVLSLVVAETQVYVGESEADFNGLREHLTACNKPIYLVYPSEQSVSVEQQPINPDC
                     VLLLLDGTWRKAFKMLQLNPWLTQYPAVHLAEGYESRYRIRKSSRSDSLSTLEACAYM
                     LSALDPRLDVQPLMTAFDAMVELRIKAMPSTVQARYQNSNKPNCETK"
     misc_feature    226642..227208
                     /locus_tag="Sbal_0198"
                     /note="DTW domain; Region: DTW; cl01221"
                     /db_xref="CDD:260840"
     gene            complement(227527..229647)
                     /locus_tag="Sbal_0199"
                     /db_xref="GeneID:4844572"
     CDS             complement(227527..229647)
                     /locus_tag="Sbal_0199"
                     /note="KEGG: son:SO4552 sensory box protein;
                     TIGRFAM: PAS sensor protein; diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; EAL domain protein;
                     PAS fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC and GAF sensor-containing diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="YP_001048602.1"
                     /db_xref="GI:126172453"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4844572"
                     /translation="MIRWQHLLKKLSTDDPVLQEKLSLWQAHPHKTPLALIQGFSFIS
                     ANQAALGYFEAEYDAFVNATPYDFSPRIQSSGRNSVEYAREMILEAIAGKNVEFNWLH
                     LSQVGNELPTRVYLYRCYLQQQPVVLVEFQALNRRNQLRATISDGFAHIPKEILSTTL
                     EESAEAVYITDTDDHILAVNKAMCRICGYSAEQLISKTPEFLELKSHHLGEETECQIA
                     LKQRGFWQGETWKKRSDGSNFPAWQSSRKIITEDGDHYNVNIFSDISTKKLLETQLTT
                     RAMYDTLTGLPNRFHLKQILNKALEKLKTDPLTLGALMFLDLNGFKNINDSFGHSMGD
                     RVLQLVAARLEAGCIEKADIARMGGDEFTLVLQDCSCKDEIQLFAEQILSLFESPFEI
                     EGQKFFLGTSIGIALFPTHSDKAGQLISLADTAMYCAKKSLPHLVFYDKAMSQAAELK
                     LQLINSLRHAHSLKQFTLAYQAIVDLHTNQTIAAEALLRWQKSPTEYYDAADFVPLLE
                     ETGLIVSIGQWVLEQACVQAALWRAHNQADFRISVNVSPLQLEHLDFIDQVINALEMA
                     NLPAEALILEITESALLRQPEQARLTLNRIKALGVSIAIDDFGTGLSSLSRLGTLPID
                     SVKIDAEFALRLNEVSGQKLCNAIVQLAQALDIHFVAEGIETQQQRDIMTDMGQGFAQ
                     GFLFGYPSSVDNFTQTFLTEKHIA"
     misc_feature    complement(228856..229161)
                     /locus_tag="Sbal_0199"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(228853..229155)
                     /locus_tag="Sbal_0199"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(order(228940..228942,228955..228957,
                     229033..229044,229081..229083,229099..229101,
                     229111..229113))
                     /locus_tag="Sbal_0199"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(228910..228912,228916..228918,
                     229003..229008,229015..229017,229039..229041,
                     229051..229053))
                     /locus_tag="Sbal_0199"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(228352..228813)
                     /locus_tag="Sbal_0199"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(228568..228570,228697..228699))
                     /locus_tag="Sbal_0199"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(228565..228576,228580..228582,
                     228646..228648,228658..228660,228670..228675,
                     228682..228684))
                     /locus_tag="Sbal_0199"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(228505..228507,228592..228594))
                     /locus_tag="Sbal_0199"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(227566..228285)
                     /locus_tag="Sbal_0199"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            229974..230312
                     /locus_tag="Sbal_0200"
                     /db_xref="GeneID:4842123"
     CDS             229974..230312
                     /locus_tag="Sbal_0200"
                     /note="KEGG: she:Shewmr4_3747 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048603.1"
                     /db_xref="GI:126172454"
                     /db_xref="GeneID:4842123"
                     /translation="MLMPLILISSVYFAVANAAESPKPKLTLEQRADKARIDSQRLEQ
                     AQLEKARQATKETAEREDKIKQQSQTNDWEAQQKLKAQKQFDERESREQKYLREAKEA
                     AAKERKIPKP"
     gene            230420..231073
                     /locus_tag="Sbal_0201"
                     /db_xref="GeneID:4841603"
     CDS             230420..231073
                     /locus_tag="Sbal_0201"
                     /note="PFAM: Methyltransferase type 11; Methyltransferase
                     type 12;
                     KEGG: shn:Shewana3_3944 methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_001048604.1"
                     /db_xref="GI:126172455"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:4841603"
                     /translation="MLNICPLCHGTELLVYHQDKKRDYHQCQICQLVSVPPEFYLSAE
                     AEKAEYDKHENRADDLGYQTFLNRTLEPLLSRVSTSAKGLDFGCGEGKALSMMAKARG
                     YQIDNYDLYYANNPEALARQYDFITLTEVIEHVSDAAGLLAQLDRLLKPNGILAVMTK
                     RVQDQTAFTRWHYKNDPTHINFYAEATFEWLAHHYGWRLEIIDKDVVFLYKEMHKVN"
     misc_feature    230663..230893
                     /locus_tag="Sbal_0201"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(230675..230695,230744..230749,230804..230806)
                     /locus_tag="Sbal_0201"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(231159..231488)
                     /locus_tag="Sbal_0202"
                     /db_xref="GeneID:4841510"
     CDS             complement(231159..231488)
                     /locus_tag="Sbal_0202"
                     /note="PFAM: Antibiotic biosynthesis monooxygenase;
                     KEGG: hch:HCH_05533 uncharacterized enzyme involved in
                     biosynthesis of extracellular polysaccharides"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="YP_001048605.1"
                     /db_xref="GI:126172456"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="GeneID:4841510"
                     /translation="MMVVIFEVVPNPGCQERYLEIAADLKSSLSEIAGFISIERFQSM
                     VNPERLLSLSFWENEAAVQAWRRQIYHREAQTQGHEQLFADYRLRVAEVVRDYGMFDR
                     AQAPRSN"
     misc_feature    complement(231192..231488)
                     /locus_tag="Sbal_0202"
                     /note="Uncharacterized enzyme involved in biosynthesis of
                     extracellular polysaccharides [General function prediction
                     only]; Region: COG2329"
                     /db_xref="CDD:225209"
     gene            complement(231485..231868)
                     /locus_tag="Sbal_0203"
                     /db_xref="GeneID:4844705"
     CDS             complement(231485..231868)
                     /locus_tag="Sbal_0203"
                     /note="PFAM: NIPSNAP family containing protein;
                     KEGG: hch:HCH_05534 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NIPSNAP family protein"
                     /protein_id="YP_001048606.1"
                     /db_xref="GI:126172457"
                     /db_xref="InterPro:IPR012577"
                     /db_xref="GeneID:4844705"
                     /translation="MQLKPLAHKPMAPNTMKITCFIEYKIDPFKLEQFAQYAENWGDI
                     IPVYGGELLGYFLPHEGTNDTAFGLISFDSLAHYERYRYKLKTEAAGKANFQLAKQGE
                     FILSEKRSFLKPIAKTYQRAAETKL"
     misc_feature    complement(231521..231808)
                     /locus_tag="Sbal_0203"
                     /note="NIPSNAP; Region: NIPSNAP; pfam07978"
                     /db_xref="CDD:254560"
     gene            231897..232652
                     /locus_tag="Sbal_0204"
                     /db_xref="GeneID:4844706"
     CDS             231897..232652
                     /locus_tag="Sbal_0204"
                     /note="PFAM: regulatory protein, ArsR;
                     KEGG: hch:HCH_05536 predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein ArsR"
                     /protein_id="YP_001048607.1"
                     /db_xref="GI:126172458"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="GeneID:4844706"
                     /translation="MVIELSPNEITSMEPNIAFIANLIGDAARSRMLIALMGGEALTA
                     TELALEADITPQTASSHLTKLVEGELLLVRKQGRHKYFQLQSRQVAELLESLLNMSAA
                     IANPNVIHGPADPRLRLARICYDHLAGELGVALYDSLSRQDLIVHEGGETKITAAGMT
                     FFAKRGVEHSLLGAPDDVFDVPKSRQSRRPLCKSCLDWSERRSHLAGVLGQWVLKDIL
                     AKGWAEKALDTRALQFSSRGLKSFRADYGIESK"
     misc_feature    231957..232190
                     /locus_tag="Sbal_0204"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(231957..231962,231966..231968,231975..231977,
                     231984..231989,231996..232001,232008..232010,
                     232101..232103,232158..232163,232167..232175,
                     232179..232187)
                     /locus_tag="Sbal_0204"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(231960..231965,231975..231983,232023..232031,
                     232056..232067,232071..232076,232083..232088,
                     232092..232097,232113..232121,232134..232142)
                     /locus_tag="Sbal_0204"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(232023..232025,232032..232034,232158..232160)
                     /locus_tag="Sbal_0204"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            233540..233731
                     /locus_tag="Sbal_0205"
                     /db_xref="GeneID:4845705"
     CDS             233540..233731
                     /locus_tag="Sbal_0205"
                     /note="KEGG: sfr:Sfri_0292 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048608.1"
                     /db_xref="GI:126172459"
                     /db_xref="GeneID:4845705"
                     /translation="MSQFKLELAESELKYVLEGLMALELQMAETCEASDDPDEIADIG
                     NDLIELRLLLNPLKEKAIS"
     gene            234359..235774
                     /locus_tag="Sbal_0206"
                     /db_xref="GeneID:4843055"
     CDS             234359..235774
                     /locus_tag="Sbal_0206"
                     /EC_number="3.5.1.14"
                     /note="KEGG: shn:Shewana3_3941 amidohydrolase;
                     TIGRFAM: amidohydrolase;
                     PFAM: peptidase M20; peptidase dimerisation domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_001048609.1"
                     /db_xref="GI:126172460"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010168"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="GeneID:4843055"
                     /translation="MTLPSVSPSAISKSAIPKAFEFKSFANKAIFSKTLLASALALSF
                     MGAGLNSAQAATNTMPDAAKLAAGVEQKVIDWRRDLHQHPELSNREFRTSKIIEKHLK
                     SLGLEVQTGVAHTGVVAILKGGKLKGGKSGPLIAIRADMDALPVTEVVDLPFASKATD
                     TYRNQKVGVMHACGHDTHVAMLMGVAENLVKVKDSLAGDVMFIFQPAEEGAPDGEEGG
                     AELMLKEGLFAKRKPDQVFGMHVTSSMPSGMIGVRSGPAMASEDSFTIKVKGRQTHGS
                     RPWNGVDPIVAAAQIITNVQTIVSRQVDITKAPAVVSFGAVNGGIRSNIIPDEVELIG
                     TIRTFDQPMRADIKVRLAEMAELSAKTLGASATTEIHPGYPVVVNNPELVASMRPVLA
                     SVVGDKMLIEPGLITGAEDFSYYALEAPGMFFFLGVTPKGTDPETAASNHSPAFYVDE
                     SALKVGVEAMTKVALTALNAQ"
     misc_feature    234539..235771
                     /locus_tag="Sbal_0206"
                     /note="Metal-dependent
                     amidase/aminoacylase/carboxypeptidase [General function
                     prediction only]; Region: AbgB; COG1473"
                     /db_xref="CDD:224390"
     misc_feature    234542..235753
                     /locus_tag="Sbal_0206"
                     /note="M20 Peptidase Aminoacylase 1 subfamily; Region:
                     M20_Acy1_like2; cd05667"
                     /db_xref="CDD:193543"
     misc_feature    order(234875..234877,234881..234883,234983..234985,
                     235076..235078,235682..235684)
                     /locus_tag="Sbal_0206"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193543"
     misc_feature    order(235145..235147,235211..235216,235226..235228,
                     235235..235237,235244..235246,235298..235318,
                     235328..235333,235337..235339,235355..235363)
                     /locus_tag="Sbal_0206"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193543"
     gene            235912..237243
                     /locus_tag="Sbal_0207"
                     /db_xref="GeneID:4842684"
     CDS             235912..237243
                     /locus_tag="Sbal_0207"
                     /note="PFAM: peptidase M16 domain protein;
                     KEGG: son:SO4537.2 hypothetical Zn-dependent peptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16 domain-containing protein"
                     /protein_id="YP_001048610.1"
                     /db_xref="GI:126172461"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="GeneID:4842684"
                     /translation="MKRTLSALVLAMGLFNPLSQAQATTAEDIKSFTLDNGMKIMVLE
                     DASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGSKKYGPKMFDRTMEAAGGAN
                     NAYTTEDMTVYTDWFPANALETMFDLEADRIANLDINQTMVDSERGVVQSERSTGLEN
                     SNWNALEGEIKGVAFLAHPYSWSVIGHESDIAAWTLEDLVQYHKTYYAPNNAVVVIAG
                     DVKVAQVKALADKYFAPIPAQTPPKAIRTVEPEQKGERRTFVQKASVSTPNVMLAYHI
                     PAATHADFYALDLLSSILSQGNSSRLYQSLVDKQVALEAQTYMPMSVDPNLFYVMGVA
                     TPEVKASTLEQALIEQIDAIATMGVTQQELDKVKNIKLMDFYRSMETINGKANTIGTY
                     EMYFGSYDKLFNAPEAYNKVTPADIQRVAQTYLRKSNRTVAVLAANEEISQ"
     misc_feature    235984..237216
                     /locus_tag="Sbal_0207"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    236026..>236373
                     /locus_tag="Sbal_0207"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    236488..237021
                     /locus_tag="Sbal_0207"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            237240..238703
                     /locus_tag="Sbal_0208"
                     /db_xref="GeneID:4842197"
     CDS             237240..238703
                     /locus_tag="Sbal_0208"
                     /note="PFAM: peptidase M16 domain protein;
                     KEGG: shm:Shewmr7_3814 peptidase M16 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16 domain-containing protein"
                     /protein_id="YP_001048611.1"
                     /db_xref="GI:126172462"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="GeneID:4842197"
                     /translation="MKSMAMKSLKMASLGKPSKLMAALALGTSLALAGCATTSAPKRV
                     ETGSFVMPSYDKFVLDNGLTVYLMPQREVPLVTLNAVVRAGAVNDTTAGVAQMTAEGL
                     LLGAAGKSKADIEQQVDFLGASLGAEADKEGSYLSADFMAKDTDVMLGLFSAAMLTPD
                     FDAAEFDKLKQRAIAGLQQDKESPRAVIGRYFDKLVFGAHPYGNAASGNSDSLEQVTV
                     SQLRAFHKSYYQPANTAITVVGDFDVAAMKAKLTQTFGQWKGSEKLVQPDLNQGLPQL
                     TAAKVLLVDKPDAIETTFVIGGLGISRDNPDYVGLTVVNTILGGRFTSWLNDELRVNA
                     GLTYGARSGFSPYTDSGVFTISTFTKTETTQEAIDLALKTYARLWEKGVDQTTLDSAK
                     AYVKGQFPPKFETSGQLAGLLSGMYLYGFDDKFINEFQAKVDGLTLEETQRLVKTYFP
                     QKDLQFVLIGNAAKIAPIAAKYGKVQTVDIKATGFGQ"
     misc_feature    237390..238622
                     /locus_tag="Sbal_0208"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    237465..237863
                     /locus_tag="Sbal_0208"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    237885..238418
                     /locus_tag="Sbal_0208"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(238822..240918)
                     /locus_tag="Sbal_0209"
                     /db_xref="GeneID:4843826"
     CDS             complement(238822..240918)
                     /locus_tag="Sbal_0209"
                     /note="PFAM: peptidase S9, prolyl oligopeptidase active
                     site domain protein; WD40 domain protein beta Propeller;
                     KEGG: shm:Shewmr7_3813 peptidase S9, prolyl oligopeptidase
                     active site domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9 prolyl oligopeptidase"
                     /protein_id="YP_001048612.1"
                     /db_xref="GI:126172463"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR011659"
                     /db_xref="GeneID:4843826"
                     /translation="MLTCYLAKIRNIIILVTVCITRRHIVKKTGILLLCLLMPFSSAF
                     ADQGKPLSAELLWQLKRIGSPIVSPTGEHIIAPVTEYDLKADKGSTQLWHFDGKHNRA
                     ITAKGLRVSEPVFSPDGKTLAFVSQRNEDEASQIYLLPMDGPGEAQRLTDIPTGVNSI
                     KWVGKHLYFISNIFPNQSWEEMKTQLTTDTDNKVSAHQWNALPYSQFDHWLDERRQAH
                     VFRIPAKGGNVENITQPAGHELPRSDQSSASYDVSPNERWIAFNAYGSENKVDPKIDI
                     FLATIGGNKAENLTADNQAPDLNPSFSPNGKTLAFTRQKIPGFYADTSRLMLLDIDSR
                     KLTTLTSDWDRSVSQFSWTPDNKGFYATVEDAATNRIYSIDAKNGKVKAITEATDFSQ
                     PAIGKDGELIATNQSFLYPARLVSINPRNGKIERLENFNDDILKDVDLGTYESVTYKG
                     YQGKDIQMWVHYPAGFDRSKKYPLFMLVHGGPHNAITNGFHFRWNAQTFASWGYVTAW
                     PNFHGSSGFGQEFADSINPDWKTKPLEDVLKAADWFKQQSWIDSDRMVAGGASYGGYL
                     TSIILGQPHPFKALLIHAAVYDMYAQMASDFAVHSTRFGNYWDNPELYKAISPHYFAA
                     NFNTPTLVSHGQLDYLVPATQGFELFHTLQSRHVESRMIYFPDENHWIMKPNNSVYWY
                     NEVKKWMTHFAEPGAR"
     misc_feature    complement(238846..240774)
                     /locus_tag="Sbal_0209"
                     /note="Dipeptidyl aminopeptidases/acylaminoacyl-peptidases
                     [Amino acid transport and metabolism]; Region: DAP2;
                     COG1506"
                     /db_xref="CDD:224423"
     misc_feature    complement(240508..>240585)
                     /locus_tag="Sbal_0209"
                     /note="WD40-like Beta Propeller Repeat; Region: PD40;
                     pfam07676"
                     /db_xref="CDD:203719"
     misc_feature    complement(238852..239451)
                     /locus_tag="Sbal_0209"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:249771"
     gene            241138..241710
                     /locus_tag="Sbal_0210"
                     /db_xref="GeneID:4841547"
     CDS             241138..241710
                     /locus_tag="Sbal_0210"
                     /note="KEGG: shn:Shewana3_3937 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048613.1"
                     /db_xref="GI:126172464"
                     /db_xref="GeneID:4841547"
                     /translation="MPLKIDRLNLMLVFATLLSVFSSSSVMAAKVSFKEFCPQLVGQW
                     AGDAAKAGEIPRNVAVTGFCSHDQRQLILSVSIGTKAPFSETWWFREQGDQVLLTYYD
                     GVAEDKQQVFSLYRQNGDYSLLGEGVVNARPALIQLLFDAQTQTQTQAQAQNQAGGWQ
                     WTQNIQYLDDDIDRYQLFRGIEMTPVAPSP"
     gene            complement(241753..242217)
                     /locus_tag="Sbal_0211"
                     /db_xref="GeneID:4844718"
     CDS             complement(241753..242217)
                     /locus_tag="Sbal_0211"
                     /note="TIGRFAM: RNA methyltransferase, TrmH family, group
                     2;
                     PFAM: tRNA/rRNA methyltransferase (SpoU);
                     KEGG: shn:Shewana3_3934 RNA methyltransferase, TrmH
                     family, group 2"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="YP_001048614.1"
                     /db_xref="GI:126172465"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004440"
                     /db_xref="GeneID:4844718"
                     /translation="MFHIALYEPEIAPNTGNIIRLCANNGSQLHLIEPLGFDLEEKKL
                     RRAGLDYADLTNVTRHKDFDAFLEAMAGKRIMACTTKGSRPHTELSFAKDDVLLFGPE
                     TRGLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISYEAWRQLDFAGAL"
     misc_feature    complement(241759..242217)
                     /locus_tag="Sbal_0211"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            242378..243151
                     /locus_tag="Sbal_0212"
                     /db_xref="GeneID:4841990"
     CDS             242378..243151
                     /locus_tag="Sbal_0212"
                     /note="KEGG: son:SO4528 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048615.1"
                     /db_xref="GI:126172466"
                     /db_xref="GeneID:4841990"
                     /translation="MFSHFITLFIFYVLFLQSIFTPAYAADDAVTSAGGKRQMTAYLG
                     EIPGLINADGTGPFVELVKAIDRADPEVEIDIKVFPLSRAMLGVTLGRADFGLPAIRN
                     NAALDALPYRFSSVSFGQVTHVLYTNVDKPITKAMLFDQQQTGRVFTVEAIPDYMPIP
                     AEPSITIKRSLLKLSHGRIDAFVWAQEEADMMLKQLKLHNIHREDFGDFEDVFVIAKG
                     PEGDAVDAYLSRMIELLRQTGELSQIYQTIHLSYNDWQP"
     misc_feature    242519..243115
                     /locus_tag="Sbal_0212"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     misc_feature    242552..243115
                     /locus_tag="Sbal_0212"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(242618..242620,242711..242713,242927..242929)
                     /locus_tag="Sbal_0212"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(242879..242881,242891..242893,242909..242911)
                     /locus_tag="Sbal_0212"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    243002..243019
                     /locus_tag="Sbal_0212"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            243278..244135
                     /locus_tag="Sbal_0213"
                     /db_xref="GeneID:4845595"
     CDS             243278..244135
                     /locus_tag="Sbal_0213"
                     /note="PFAM: protein of unknown function DUF6,
                     transmembrane;
                     KEGG: shm:Shewmr7_3806 protein of unknown function DUF6,
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048616.1"
                     /db_xref="GI:126172467"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:4845595"
                     /translation="MPFVIALLAPVFWGTTYALVSLYLHDMSPYWVAVWRALPAGILM
                     LMLRPRLPTLVWSKLGLLAFCNIGAFFTLLFIGAYRLPVAVAGTLGATLPLIFLILAW
                     VIDKKRPGMKWLLLGLMGLGGVILLLNPSADLDPIGVLCMLSATTLIAFSSRWMQKWD
                     VGDFLVLTAWQLFLGGLMLIPLAWFMAGPPQLPSLTVVPSLIWLVIANTAIAYWAWLW
                     SMRNLGPEIMGMVALVNPVVAVSLGVIIVGETLDMRQWAGIGVILLSLLLMKLPQNLR
                     LNPFKKVQP"
     misc_feature    243308..243607
                     /locus_tag="Sbal_0213"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    243314..244063
                     /locus_tag="Sbal_0213"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    243764..244063
                     /locus_tag="Sbal_0213"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            244164..245105
                     /locus_tag="Sbal_0214"
                     /db_xref="GeneID:4843416"
     CDS             244164..245105
                     /locus_tag="Sbal_0214"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: shm:Shewmr7_3805 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048617.1"
                     /db_xref="GI:126172468"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:4843416"
                     /translation="MLKRLDLNLLPVLEILLEEQSVTAAAARLHLSQSAVSKQLTRLR
                     EVFDDPLFERTAYGLKPTPKALSLAPELRQCLQQLAQFTRPDTFEPALSQRQFRMHLV
                     ETTYSLTFPHFMPSLLAQAPGVSLNCQTWRLDTMDRLLRCDIDLAIGCREWDERSPMH
                     VSHIPDDLCHVELVQDYPVCLMRRDHPALTQEWNLDTFLSYRHLQVAFGGLEHWLLDD
                     VLQLEGRQRDIAVNMTDFQSALTLCEHSDLILCAPSRYAFAVMKSFELQSLPSPIKLI
                     PGAYLLMWHKHFEHDLSHKWLRELIISQVLPSITPRV"
     misc_feature    244167..245066
                     /locus_tag="Sbal_0214"
                     /note="DNA-binding transcriptional regulator YidZ;
                     Provisional; Region: PRK10216"
                     /db_xref="CDD:182312"
     misc_feature    244182..244358
                     /locus_tag="Sbal_0214"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    244449..245072
                     /locus_tag="Sbal_0214"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    order(244467..244469,244473..244478,244488..244490,
                     244689..244691,244800..244802,245001..245003)
                     /locus_tag="Sbal_0214"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    order(244470..244472,244479..244484,244491..244496,
                     244503..244508,244512..244517,244524..244529,
                     244533..244547,244551..244553,244767..244769,
                     244851..244865,244872..244877,244884..244889,
                     244896..244898)
                     /locus_tag="Sbal_0214"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            complement(245089..245970)
                     /locus_tag="Sbal_0215"
                     /db_xref="GeneID:4842819"
     CDS             complement(245089..245970)
                     /locus_tag="Sbal_0215"
                     /note="PFAM: Patatin;
                     KEGG: shn:Shewana3_3931 patatin"
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="YP_001048618.1"
                     /db_xref="GI:126172469"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="GeneID:4842819"
                     /translation="MKDVALVLEGGGLRAIYTAGVLDAFLQQSLNFNYVIGVSAGAIY
                     PASYVSRQFGRNLQIQQQYLNDKRYMGLRHWLATGNYVNTDFTYRRMAYELLPFDFDT
                     FLNSHTEFKVGAFNCNTGKTDYFGMADFNDHDKLLDVLIASSSLPFMSKPSVINQHHY
                     LDGGIGEPIPLAQSRKDGYARQVVILTQDQHYQKTAMKMNWLARKAYKRYPAVAHALS
                     ERHRVYNQALTELDQAVTSDDAFVIRPALPLNLSRLDRNIDKVTAVYQQGLADGKTVL
                     PALTAWLAAPKEPKPEA"
     misc_feature    complement(245116..245970)
                     /locus_tag="Sbal_0215"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     COG4667"
                     /db_xref="CDD:227013"
     misc_feature    complement(245155..245955)
                     /locus_tag="Sbal_0215"
                     /note="Hypothetical patatin similar to yjju protein of
                     Escherichia coli; Region: Pat_hypo_Ecoli_yjju_like;
                     cd07208"
                     /db_xref="CDD:132847"
     misc_feature    complement(order(245485..245487,245854..245856,
                     245929..245931,245935..245940))
                     /locus_tag="Sbal_0215"
                     /note="active site"
                     /db_xref="CDD:132847"
     misc_feature    complement(245848..245862)
                     /locus_tag="Sbal_0215"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132847"
     gene            complement(246049..247062)
                     /locus_tag="Sbal_0216"
                     /db_xref="GeneID:4842607"
     CDS             complement(246049..247062)
                     /locus_tag="Sbal_0216"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: son:SO4524 transcriptional regulator, LysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048619.1"
                     /db_xref="GI:126172470"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:4842607"
                     /translation="MNKNMIKGMIVFAAIAEKGSMSAAAQQLNLSSSAVSQQVTKLEM
                     DMGISLFHRNTRNLTLTEAGSLFYENCRKVIAIVESTEQKLNNLKGIPSGELKIAAPI
                     GFGGGLLSEPFNYLLAAHPQISLNLLLQDGPIDIVNEGIDLAICIGPLSDSNLIARHL
                     ADWRMLLCASPDYLPMHKIFKHPAELAAFNRINHPCANSETLTHVRNKECFELTSQRI
                     TVNNMQALIQLTLDGLGFAALPEPEVHKYLESGQLVTLLPEWSLNTYSVYSVTSARDK
                     QPAKVKEALNTLSQYFSQANFNPAYHFKQCVQKDGTKGSVTNILPIKPKQASHHADVD
                     HAS"
     misc_feature    complement(246181..247050)
                     /locus_tag="Sbal_0216"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(246871..247047)
                     /locus_tag="Sbal_0216"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(246217..246783)
                     /locus_tag="Sbal_0216"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(246262..246264,246343..246345,
                     246394..246396,246574..246576,246580..246582,
                     246622..246624,246739..246741,246751..246753))
                     /locus_tag="Sbal_0216"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(246367..246369,246376..246381,
                     246400..246414,246493..246495,246676..246696,
                     246700..246702,246712..246714,246721..246726,
                     246730..246735,246745..246750))
                     /locus_tag="Sbal_0216"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            247187..249187
                     /locus_tag="Sbal_0217"
                     /db_xref="GeneID:4845736"
     CDS             247187..249187
                     /locus_tag="Sbal_0217"
                     /note="IrgA; binds ferric enterobactin; irgA gene
                     expression is repressed by Fur and induced by the
                     divergently transcribed upstream gene irgB; outer membrane
                     protein; involved in iron metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin receptor protein"
                     /protein_id="YP_001048620.1"
                     /db_xref="GI:126172471"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010917"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:4845736"
                     /translation="MLLSRKKYLAQVITALCLLPAVPVTNALADTAPDKEKMMERIVV
                     TASGFEQQIRDAPASISVITREDLDNRFYRDLTDAMLEVPGVVITGGADRQDISLRGM
                     GSQYTLILVDGKRQSSRETRTNSDGPGVEGAWTPPLAAIDRIEIVRGPMSSLYGSDAI
                     GGVINIITRKVPNEWQGEVRLDTTLQEKSTSGNVYQSNFFVNGGLIKDLLGMQLYGQY
                     TQREEDNIYGGYRGRDATNLTARFALTPNENHDIMLEVGVSNQELDSSLGKTVTPLAP
                     GEACGRRGCPQSSTTEYENSTISLSHTGRWDFGTSDSYIKHEVFDNKTRKMKITNTDV
                     QSSLITTLGQSHTATFGAAFNHQDLTDETGNQVSNLTDISRRQWSVFSEDEWRIVDNF
                     ALTMGLRLDDDENFGHHVSPRVYGVWGLTDSTTLKGGVSTGFRAPSLRQTVPDWGQVS
                     RGGNMYGNPDLQPETSVNYELGVYSDLTESITASAGVFYNEFKDKITRVACPATQCTD
                     GPNQFGSDPTTYVNIDDAVTQGIELSIDYRIRSNLSFTGNYTYTDSEQKTGAYKGSPL
                     NQLPKHLIQASFNYEPIDNLSTWLRVNYRGEESQPTTGPSSSSFIAPSYTLLDLGANY
                     QLNDSLKFSAGIYNAFDKDITQEEYGYLEDGRRYWLGMTYSF"
     misc_feature    247199..249184
                     /locus_tag="Sbal_0217"
                     /note="enterobactin receptor protein; Provisional; Region:
                     PRK13483"
                     /db_xref="CDD:184080"
     misc_feature    247361..249184
                     /locus_tag="Sbal_0217"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(247361..247390,247418..247447,247475..247492,
                     247511..247534,247598..247630,247664..247690)
                     /locus_tag="Sbal_0217"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(248141..248143,248222..248224)
                     /locus_tag="Sbal_0217"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(249259..249519)
                     /locus_tag="Sbal_0218"
                     /db_xref="GeneID:4845856"
     CDS             complement(249259..249519)
                     /locus_tag="Sbal_0218"
                     /note="KEGG: shn:Shewana3_3927 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048621.1"
                     /db_xref="GI:126172472"
                     /db_xref="GeneID:4845856"
                     /translation="MGFNEQEKHALLALKGVGPTVIKRFEEIGISSLQQLAQHEVDDI
                     ANLVASMLRTTCWKNSPQARNAIGAAIELARAHPPAKNSHSY"
     misc_feature    complement(<249379..249489)
                     /locus_tag="Sbal_0218"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     gene            complement(249651..250988)
                     /locus_tag="Sbal_0219"
                     /db_xref="GeneID:4844803"
     CDS             complement(249651..250988)
                     /locus_tag="Sbal_0219"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_001048622.1"
                     /db_xref="GI:126172473"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /db_xref="GeneID:4844803"
                     /translation="MSSVIQTLSGAIATPYQANITVPNWMLGSMERVMQYYVDKNLRL
                     DTLSAEMMPAPVEGKKYMLYAHIPFCHTLCSYCTFHRFMFKEDKARAYFISLRKEMEM
                     VKALGYDFESMYIGGGTTTVLEDELARTIEHAKTLFPSIKEVSCESDPQHLDSPGFKQ
                     LKGLVDRMSIGVQSFNDDILKMTDRLDKFGTGQQTFDKIMGAKELFPIINVDLIFGFR
                     GQTDEVIQHDLDMASRLDPRQITTYPLMITHQTRKSVKGKLAAPQADMANQYRQILNS
                     LNGQYNQLSAWAFGKTDDEGFDEYVIDYDEYLGVGSGSFSFLNDTLYVNTFSLRKYQE
                     RIAAGHMGVEQQKNYSKKDVMQYRFLLGMFSGRLSRKYFRDTFGVNLDTALFKEMTSM
                     KLIGAIKNDPRDPDNLIVTDNGKMMGLLMMKEFYSGMDNVRAQLRKPLKPCDM"
     misc_feature    complement(249654..250979)
                     /locus_tag="Sbal_0219"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK08629"
                     /db_xref="CDD:181509"
     misc_feature    complement(<250332..250781)
                     /locus_tag="Sbal_0219"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(250338..250340,250476..250478,
                     250542..250550,250629..250634,250638..250640,
                     250755..250763,250767..250769,250773..250775,
                     250779..250781))
                     /locus_tag="Sbal_0219"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            251367..252278
                     /locus_tag="Sbal_0220"
                     /db_xref="GeneID:4845765"
     CDS             251367..252278
                     /locus_tag="Sbal_0220"
                     /note="PFAM: Bile acid:sodium symporter;
                     KEGG: son:SO4519 sodium-dependent transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="YP_001048623.1"
                     /db_xref="GI:126172474"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="GeneID:4845765"
                     /translation="MLVNVNRFFPLLALIGAVTAYLMPSWFTELKSAIVPLLVIIMLS
                     MGLTLDLQDFANAFKQKRAVLTGLILQFSVMPLSALLISQLLGLDRELTIGMVLVGSV
                     AGGTASNVVCYLAKGDVALSITMTALSTLAGVVLTPLIIKLLIGEMIDIPFVDMLLSL
                     VKIVLFPVSAGVIINHFFKSLVAKVAPALPLISILAIVMAITIIVALNTNQFDKVGPI
                     ILLAVFLHNGLGLALGYFCCRLLGFNHTVCKTISIEVGLQNSGLATALCIKFFSPISA
                     IPSAIFSIWHNLSGAILAGYWARESQD"
     misc_feature    251385..252275
                     /locus_tag="Sbal_0220"
                     /note="Predicted Na+-dependent transporter [General
                     function prediction only]; Region: COG0385"
                     /db_xref="CDD:223462"
     gene            complement(252351..253742)
                     /locus_tag="Sbal_0221"
                     /db_xref="GeneID:4845731"
     CDS             complement(252351..253742)
                     /locus_tag="Sbal_0221"
                     /note="PFAM: Sel1 domain protein repeat-containing
                     protein;
                     KEGG: hch:HCH_06539 FOG: TPR repeat, SEL1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein"
                     /protein_id="YP_001048624.1"
                     /db_xref="GI:126172475"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="GeneID:4845731"
                     /translation="MKIFTIATLLLLLTVSFAATAEKSTLEQLFEQQQYDAFLQQAQQ
                     QAAENNADALFLLGKAYHLGRGVTQDNATASQYYEQARALGSARASHNLGSMALDNDR
                     KTQAIPLLEEALARGLKLPTLYNLGRAHSPADPSSRFYLAKAIAAAQRAGSYFGQAFE
                     LQPDNLYLDNASREYLRAYLIAMQSVGSERESLDLPQLRQQAIKWLELGMAADNGTAW
                     TNYGALLLNENDYSGAKAAFLQGAKRQVAIANYHLGSMEERGLGAETDKVQALAYYEK
                     AALAGMEQAKAPAYELLKAQLEYEDDLTKLEQGVARFNALKQQDQYAPISLDSVINRL
                     AWGTFLAQQRQQTISLPTAAKTQLSLQACGLGYNQLHGSTYNIGENSHWRMAAYLTLA
                     DKIALPLEGRVDEHGCASLTIAMTDQLYRLLQQGAVFGLRFPNYTLPLALSRQENILQ
                     LTLMPVETPLPVN"
     misc_feature    complement(253485..253592)
                     /locus_tag="Sbal_0221"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(<252867..253160)
                     /locus_tag="Sbal_0221"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(252900..253004)
                     /locus_tag="Sbal_0221"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            complement(254292..255182)
                     /locus_tag="Sbal_0222"
                     /db_xref="GeneID:4845857"
     CDS             complement(254292..255182)
                     /locus_tag="Sbal_0222"
                     /note="KEGG: abo:ABO_1732 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048625.1"
                     /db_xref="GI:126172476"
                     /db_xref="GeneID:4845857"
                     /translation="MKTASQTMMSFTLASSALLASYAAQANPVETSREYKLLLDPSHF
                     NYATQSTTANSYLTDAKQAISNAISRNITGSWALTKARQVAFYDTPTSCQLKQLGYIF
                     RDRTSDDKSEVTLKFRSPDRFIADFEDLSSPDNQADTKLEADISTDINNGIRIVYSHS
                     TTTPNTRTLNDMADVNSHFSGFADAYGLSNNLTLAKVGGLTINEYVFEGSEIDLGSID
                     ASLELTLWYTSSPSASQQPVIAEVSFKYKDPNSNYTAKVVQRAKLAFDAMAQLSAWNS
                     TSSLTKTAFIYAAAPNFCSQ"
     gene            complement(255315..256856)
                     /locus_tag="Sbal_0223"
                     /db_xref="GeneID:4844071"
     CDS             complement(255315..256856)
                     /locus_tag="Sbal_0223"
                     /note="KEGG: abo:ABO_1733 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048626.1"
                     /db_xref="GI:126172477"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="GeneID:4844071"
                     /translation="MKNVLVTSGLCLSVLLLSACNSDDKDINSLTTQTTLVGGDSHCW
                     MGGTRTDSGLDSNDNGKLDSNEVVDSSYACNTDLFTDKAVHLPFTVLRDDLDNGAMPG
                     TKFEIRNGGYGSDAAPNPNNPIQFYALTDRGPNADYSGSLGKGKMFPTPDYTPRIGLF
                     ELQTNGTITKIKDILFKRPDGSLITGLPNSSSLGGTGEIPYDAAGEVIRQDMSQPYNA
                     QTNPIKLDDYGLDSEGLAAMDDGSFWVSDEYGPHIVHYSAEGVEIARINPFADDARNL
                     YSLPAEFAHRRANRGMEGLTITPDQSTLVGIMQSTISNPDKSVNNNTLTRIVTINLAT
                     GAIGQYLYQQEIAQNSNSAIVALSNSQFLVLERDAKFFNIDTDVMKHVYKIDISGATD
                     LETVTAQADIAQDAALGLTIKGKTLEQVALSDGWEVLAANGIIPATKSLVLDMAAKTQ
                     YPHDKMEGLWLIDNKRLGVLNDDDFATWSNNNTLEQKYLDSAQSDIDGNTLYIVDDLP
                     LSADK"
     misc_feature    complement(<255753..256529)
                     /locus_tag="Sbal_0223"
                     /note="SdiA-regulated; Region: SdiA-regulated; cl19046"
                     /db_xref="CDD:267399"
     gene            complement(257317..257805)
                     /locus_tag="Sbal_0224"
                     /db_xref="GeneID:4845608"
     CDS             complement(257317..257805)
                     /locus_tag="Sbal_0224"
                     /note="CycJ; periplasmic heme chaperone that binds heme
                     transiently via a histidine residue and delivers it to
                     newly synthesized and exported c-type cytochromes;
                     requires the ATP hydrolysis activity of the CcmA protein
                     in order to transfer the heme to the apocytochrome; part
                     of the cytochrome c maturation system; periplasmic protein
                     anchored to the inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c-type biogenesis protein CcmE"
                     /protein_id="YP_001048627.1"
                     /db_xref="GI:126172478"
                     /db_xref="InterPro:IPR004329"
                     /db_xref="GeneID:4845608"
                     /translation="MNPRRKKRLTLAVALIGGVAAITSLLLYALNSNLNLFYTPSEIV
                     HGKTDTGVKPEIGQRIRVGGMVTVGSMVRDPKSLHVQFAVHDSLGGEVLVTYDDLLPD
                     LFREGQGIVAQGVLSADGKLEATEVLAKHDENYMPPEVAEAMGQKHEKLDYSQQKAPD
                     TK"
     misc_feature    complement(257335..257805)
                     /locus_tag="Sbal_0224"
                     /note="cytochrome c-type biogenesis protein CcmE;
                     Reviewed; Region: PRK13165"
                     /db_xref="CDD:183874"
     gene            complement(257802..258002)
                     /locus_tag="Sbal_0225"
                     /db_xref="GeneID:4845148"
     CDS             complement(257802..258002)
                     /locus_tag="Sbal_0225"
                     /note="PFAM: Heme exporter protein D (CcmD);
                     KEGG: shn:Shewana3_0228 heme exporter protein D (CcmD)"
                     /codon_start=1
                     /transl_table=11
                     /product="Heme exporter protein CcmD"
                     /protein_id="YP_001048628.1"
                     /db_xref="GI:126172479"
                     /db_xref="InterPro:IPR007078"
                     /db_xref="GeneID:4845148"
                     /translation="MQFDSISDFFNMGGYAFYVWLSYGVTFCCLSTLIITSARQKRKV
                     LIEIAKKMDREERLKETRSTKS"
     misc_feature    complement(257826..258002)
                     /locus_tag="Sbal_0225"
                     /note="Heme exporter protein D [Intracellular trafficking
                     and secretion]; Region: CcmD; COG3114"
                     /db_xref="CDD:225656"
     gene            complement(258002..258748)
                     /locus_tag="Sbal_0226"
                     /db_xref="GeneID:4845509"
     CDS             complement(258002..258748)
                     /locus_tag="Sbal_0226"
                     /note="TIGRFAM: heme exporter protein CcmC;
                     PFAM: cytochrome c assembly protein;
                     KEGG: son:SO0261 heme exporter protein CcmC"
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmC"
                     /protein_id="YP_001048629.1"
                     /db_xref="GI:126172480"
                     /db_xref="InterPro:IPR002541"
                     /db_xref="InterPro:IPR003557"
                     /db_xref="GeneID:4845509"
                     /translation="MWKWLHPYADPERAYKLSGTLFPWFAILAGLFIAVGTTWGLAFA
                     PTDYQQGDSYRIIFIHVPAASMSMAAYMGMATAAFIGLVWQIKLADWAAASIAPIGAV
                     ITFIALFTGAAWGKPMWGAWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARAAG
                     ILAIVGVINIPIIKYSVEWWSSLHQPSTIRITEKSTMSTEMLYPLLINMLGFGLMIGA
                     ITIVRFRAEILARNGMRPWVRELAKAEEVK"
     misc_feature    complement(258065..258616)
                     /locus_tag="Sbal_0226"
                     /note="heme exporter protein CcmC; Region: ccmC;
                     TIGR01191"
                     /db_xref="CDD:233306"
     gene            complement(258750..259436)
                     /locus_tag="Sbal_0227"
                     /db_xref="GeneID:4845574"
     CDS             complement(258750..259436)
                     /locus_tag="Sbal_0227"
                     /note="TIGRFAM: heme exporter protein CcmB;
                     PFAM: cytochrome c-type biogenesis protein CcmB;
                     KEGG: son:SO0262 heme exporter protein CcmB"
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmB"
                     /protein_id="YP_001048630.1"
                     /db_xref="GI:126172481"
                     /db_xref="InterPro:IPR003544"
                     /db_xref="GeneID:4845574"
                     /translation="MKRGISFTQAFFTLLQRDLKIAIRHRGDIFNPLLFFIMVVTLFP
                     LGIGPEPQMLARVAPGIIWVAALLASMLSLERLFKADFSDGSLEQMLLSPQPLAILVL
                     AKVLAHWILTGVPLIIIAPLLAVLLNLDGNSYGALISTLALGTPVLSLLGAIGVALTV
                     GLRKGGVLLSLLILPLYIPVLIFATSAIDAAGMNLPYDGQLAIIGAMLVGSLTLAPFA
                     IGASLRVSTN"
     misc_feature    complement(258765..259397)
                     /locus_tag="Sbal_0227"
                     /note="heme exporter protein CcmB; Region: ccmB;
                     TIGR01190"
                     /db_xref="CDD:200083"
     gene            complement(259448..260098)
                     /locus_tag="Sbal_0228"
                     /db_xref="GeneID:4845683"
     CDS             complement(259448..260098)
                     /locus_tag="Sbal_0228"
                     /note="ATP-binding protein; required for proper cytochrome
                     c maturation"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein CcmA"
                     /protein_id="YP_001048631.1"
                     /db_xref="GI:126172482"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005895"
                     /db_xref="GeneID:4845683"
                     /translation="MTNITKETTLVSASKLTCIREERILFDELSFDINAGDIVQIEGP
                     NGAGKTSLLRILAGLSRPYAGQTFYRNEDINRCRDEYNEDLLYLGHLAGVKCELTAEE
                     NLNFNLRISGYDDFDTSAILAKVNLTGFEEALAGHLSAGQHRRTALSRLWHSNCKIWI
                     LDEPFTAIDKKGVEELEQLFIQHADNGGCVILTTHQDMGIIKDDRLRKIRLDYRFI"
     misc_feature    complement(259460..260071)
                     /locus_tag="Sbal_0228"
                     /note="cytochrome c biogenesis protein CcmA; Provisional;
                     Region: PRK13538"
                     /db_xref="CDD:184125"
     misc_feature    complement(259466..260065)
                     /locus_tag="Sbal_0228"
                     /note="heme ABC exporter, ATP-binding protein CcmA;
                     Region: ccmA; TIGR01189"
                     /db_xref="CDD:233305"
     misc_feature    complement(259949..259972)
                     /locus_tag="Sbal_0228"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(259514..259516,259610..259615,
                     259829..259831,259946..259954,259958..259963))
                     /locus_tag="Sbal_0228"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(259829..259840)
                     /locus_tag="Sbal_0228"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(259658..259687)
                     /locus_tag="Sbal_0228"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(259610..259627)
                     /locus_tag="Sbal_0228"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(259592..259603)
                     /locus_tag="Sbal_0228"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(259508..259528)
                     /locus_tag="Sbal_0228"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            260417..260716
                     /locus_tag="Sbal_0229"
                     /db_xref="GeneID:4842228"
     CDS             260417..260716
                     /locus_tag="Sbal_0229"
                     /note="PFAM: cytochrome c, class I;
                     KEGG: shn:Shewana3_0232 cytochrome c, class I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_001048632.1"
                     /db_xref="GI:126172483"
                     /db_xref="InterPro:IPR002323"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4842228"
                     /translation="MKKLLAMTAVAALTMSVNVSAQEAEAIFNKACTVCHSMGVAGAP
                     KVHNAAEWEPRLAKGIDALLHSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKAQ"
     misc_feature    260417..260713
                     /locus_tag="Sbal_0229"
                     /note="Cytochrome c5 [Energy production and conversion];
                     Region: CycB; COG3245"
                     /db_xref="CDD:225784"
     gene            complement(260780..262033)
                     /locus_tag="Sbal_0230"
                     /db_xref="GeneID:4844471"
     CDS             complement(260780..262033)
                     /locus_tag="Sbal_0230"
                     /note="SMART: Tetratricopeptide domain protein;
                     KEGG: she:Shewmr4_0233 TPR repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048633.1"
                     /db_xref="GI:126172484"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:4844471"
                     /translation="MTTFWIFIALVMLVGLMLIWIPHFRQQKLLKTEEAGVRKQTNLE
                     LFNERLGVLEKELSEELLDQAEFDALKKELEISLLQDIKEASDDSLVNQIKPKTILWP
                     SIMSVCLIVISGYLYQHLGAFENIETAQQPANPHAGMDTAQIMAQRVQMMEAQVKAEP
                     ENSQVWFSLGHAYVSANQYDKGIAAFDKVMDLVGKHAELLGPKATAMYYKAGQQMTPQ
                     IKAIIDESLAMDAQDPSTLLLVGMDAFFTADYKQAIASWQTILDSDRADVDRAALMNA
                     IETANLRMQSETTGMPNDDTHKQVKASAAKSVNVTISISAELAAKASPEDTIFIFARA
                     TEGPKVPLAATKVSAKSFPVTVTLDDSSGMGGDKKLSDATNVEVIAVLSKHGNIKPQA
                     GDLQGKISTVAVGDTANLVLDTQVQ"
     misc_feature    complement(261665..262027)
                     /locus_tag="Sbal_0230"
                     /note="cytochrome c-type biogenesis protein CcmI; Region:
                     cytochro_ccmI; TIGR03142"
                     /db_xref="CDD:163153"
     misc_feature    complement(261203..262024)
                     /locus_tag="Sbal_0230"
                     /note="Cytochrome c biogenesis factor [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG4235"
                     /db_xref="CDD:226687"
     misc_feature    complement(261395..261598)
                     /locus_tag="Sbal_0230"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(261422..261424,261467..261469,
                     261476..261478,261488..261490,261524..261526,
                     261569..261571,261578..261580,261590..261592))
                     /locus_tag="Sbal_0230"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(261401..261406,261413..261418,
                     261428..261433,261509..261514,261521..261526,
                     261530..261535))
                     /locus_tag="Sbal_0230"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            262434..264413
                     /locus_tag="Sbal_0231"
                     /db_xref="GeneID:4845076"
     CDS             262434..264413
                     /locus_tag="Sbal_0231"
                     /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
                     PFAM: cytochrome c assembly protein;
                     KEGG: shm:Shewmr7_0229 cytochrome c-type biogenesis
                     protein CcmF"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c-type biogenesis protein CcmF"
                     /protein_id="YP_001048634.1"
                     /db_xref="GI:126172485"
                     /db_xref="InterPro:IPR002541"
                     /db_xref="InterPro:IPR003567"
                     /db_xref="InterPro:IPR003568"
                     /db_xref="InterPro:IPR003570"
                     /db_xref="GeneID:4845076"
                     /translation="MIPELGHFALIIGVAFAFLLISVPLIGVARKDQYLVRYAWPLTY
                     GMFFFITVSVVVLAYSFAVDDFSVAYVAHHSNSQLPIFFKISAVWGGHEGSLLFWVFA
                     LSTWAAAVALFSKGLEEVFTARVLAVLALIVIGFSLFMLLTSSPFERLFPIPAEGRDL
                     NPMLQDVGLIFHPPMLYLGYVGFSVSFAFAIAALMSGRLDSAWARWTRPWTLAAWIFL
                     TGGIALGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALVHSLIVTEKRGAFRNWTV
                     LLSIFAFSLSLLGTFIVRSGVLTSVHSFAADPSRGMFILLLLGLAIGGSLTLFAFRAS
                     EMSSPARFELKSKETMLLVCNVLLTVAAGTVLLGTLYPLLIDALGMGKISVGPPYFNA
                     VFVPIVLVLFGFMGIGPIIRWKKSKAGELRRQLLIPAMVAAAIGIVTPFIVDGVFNTW
                     VAFGIAAASWIILATARAAYNMVKSKEGDISISRMGRSQLGMIFAHLGIAVSVIGATM
                     VSNYSIEKSVRMGPGISQELAGYTFKYLETKNVVGPNYTAVQGQIEVYKGDELLTLLK
                     PDRRQYNVRTMDMTEAGIDWGLFRDLYVTMGDPITSTEFAVRLNYKPFVRWLWFGAIF
                     MMIGGFFAASDKRYRVKVTAAVAPSAEKAKLATAQ"
     misc_feature    262434..264332
                     /locus_tag="Sbal_0231"
                     /note="Cytochrome C assembly protein; Region:
                     Cytochrom_C_asm; cl00504"
                     /db_xref="CDD:260465"
     gene            264425..264979
                     /locus_tag="Sbal_0232"
                     /db_xref="GeneID:4842057"
     CDS             264425..264979
                     /locus_tag="Sbal_0232"
                     /note="TIGRFAM: periplasmic protein thiol--disulphide
                     oxidoreductase DsbE;
                     PFAM: alkyl hydroperoxide reductase/ Thiol specific
                     antioxidant/ Mal allergen; Redoxin domain protein;
                     KEGG: son:SO0267 thiol:disulfide interchange protein DsbE"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic protein thiol--disulfide
                     oxidoreductase DsbE"
                     /protein_id="YP_001048635.1"
                     /db_xref="GI:126172486"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR004799"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR011594"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:4842057"
                     /translation="MKKLVLFIPLVIFLAMGVFLYKGLFLNPQQLDSALEGKPIPAFQ
                     LERLETPAEIITNEQLKGKVSLLNVWATWCPSCKYEHPFLVMLKRKNLLPIYGINYRD
                     ERAPALEELKRQGDPYNVNIYDKDGRLGLDLGVYGAPESFVVDHNGIIRFRYAGPIDL
                     RVWSETLYPMIQQLQAEAAKDGAS"
     misc_feature    264536..264913
                     /locus_tag="Sbal_0232"
                     /note="TlpA-like family, DsbE (also known as CcmG and
                     CycY) subfamily; DsbE is a membrane-anchored, periplasmic
                     TRX-like reductase containing a CXXC motif that
                     specifically donates reducing equivalents to apocytochrome
                     c via CcmH, another cytochrome c...; Region:
                     TlpA_like_DsbE; cd03010"
                     /db_xref="CDD:239308"
     misc_feature    order(264644..264646,264653..264655)
                     /locus_tag="Sbal_0232"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239308"
     misc_feature    264728..264796
                     /locus_tag="Sbal_0232"
                     /note="central insert; other site"
                     /db_xref="CDD:239308"
     gene            264976..265455
                     /locus_tag="Sbal_0233"
                     /db_xref="GeneID:4843442"
     CDS             264976..265455
                     /locus_tag="Sbal_0233"
                     /note="PFAM: cytochrome C biogenesis protein;
                     KEGG: shn:Shewana3_0236 cytochrome c biogenesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="YP_001048636.1"
                     /db_xref="GI:126172487"
                     /db_xref="InterPro:IPR005616"
                     /db_xref="GeneID:4843442"
                     /translation="MRTLTKIIGGLVLLFSMTTAVMATPVDTYEFKTPENQKRGLSLA
                     HELRCPQCQNQNLIDSNSPVARDLRLEVFKMVDEGKGDDEIIEFMTSRYGEFVLYNPK
                     METKTYILWLGPIGLLLMGLVIGFIFIRKQRISGNVPNEISEEDQRELDTLLKRNTK"
     misc_feature    265006..265440
                     /locus_tag="Sbal_0233"
                     /note="Cytochrome C biogenesis protein; Region: CcmH;
                     pfam03918"
                     /db_xref="CDD:252245"
     gene            265452..266039
                     /locus_tag="Sbal_0234"
                     /db_xref="GeneID:4844143"
     CDS             265452..266039
                     /locus_tag="Sbal_0234"
                     /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
                     antioxidant/ Mal allergen; Redoxin domain protein;
                     KEGG: shn:Shewana3_0237 redoxin domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="YP_001048637.1"
                     /db_xref="GI:126172488"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR011594"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:4844143"
                     /translation="MKHKVIKALLLSSLFSLLAGGVAHAYPGMQQATKPMESTVDLIN
                     VLPKTFPIEPVAFNDVDGKAIDFSQFKGKIIMVNMWATWCPPCVRELPAIERLATKFK
                     AEDFVLLPISIDAEGKQQVQPFLNSLGMPNFNSYYDQSQSLGDVFPLDTIPATFILDQ
                     QGQLIAFVRSYVDWDDAKAVSLIQGFIDKGSKKPN"
     misc_feature    265611..265955
                     /locus_tag="Sbal_0234"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    order(265701..265703,265710..265712)
                     /locus_tag="Sbal_0234"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            266577..268113
                     /locus_tag="Sbal_R0004"
                     /db_xref="GeneID:4845651"
     rRNA            266577..268113
                     /locus_tag="Sbal_R0004"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4845651"
     gene            268482..271384
                     /locus_tag="Sbal_R0005"
                     /db_xref="GeneID:4842354"
     rRNA            268482..271384
                     /locus_tag="Sbal_R0005"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4842354"
     gene            271525..271639
                     /locus_tag="Sbal_R0006"
                     /db_xref="GeneID:4842355"
     rRNA            271525..271639
                     /locus_tag="Sbal_R0006"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:4842355"
     gene            271675..271751
                     /locus_tag="Sbal_R0007"
                     /note="tRNA-Asp1"
                     /db_xref="GeneID:4842356"
     tRNA            271675..271751
                     /locus_tag="Sbal_R0007"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:4842356"
     gene            272263..272775
                     /locus_tag="Sbal_0235"
                     /db_xref="GeneID:4843443"
     CDS             272263..272775
                     /locus_tag="Sbal_0235"
                     /note="KEGG: shm:Shewmr7_3783 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048638.1"
                     /db_xref="GI:126172489"
                     /db_xref="GeneID:4843443"
                     /translation="MLYDLTVVQFSKMLKNLSVILEKGECFANLKKVDMAVLLNSRLA
                     PDQFNLIRQVQIACDTAKIGVARLTDNLDTVPKHDDSETTLADLQARISSVLDYLATF
                     KADDFANAATIHVSQPRWEGKYLTGYEFAIEHAIPNIYFHVTTAYAILRHNGVEIGKK
                     DYLGAMPYKS"
     misc_feature    272266..272754
                     /locus_tag="Sbal_0235"
                     /note="Domain of unknown function (DUF1993); Region:
                     DUF1993; pfam09351"
                     /db_xref="CDD:255308"
     gene            273187..273384
                     /locus_tag="Sbal_0236"
                     /db_xref="GeneID:4844124"
     CDS             273187..273384
                     /locus_tag="Sbal_0236"
                     /note="KEGG: son:SO4490 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048639.1"
                     /db_xref="GI:126172490"
                     /db_xref="GeneID:4844124"
                     /translation="MSIESQAVESPTDATTTKSKKAKKAAITSGLRLKDKLTQDTRRR
                     IEILHEQRQLSNRFGVDIEID"
     gene            complement(273490..273957)
                     /locus_tag="Sbal_0237"
                     /db_xref="GeneID:4843465"
     CDS             complement(273490..273957)
                     /locus_tag="Sbal_0237"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: son:SO4489 acetyltransferase, GNAT family"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_001048640.1"
                     /db_xref="GI:126172491"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:4843465"
                     /translation="MKVIDLKSAPQHIPQLAQWHHQEWAHLSSADATVTTLIEQMSEY
                     LSDAAIPKMFICEEANQVMGSSSLTAADMDTRTDLSPWLANVYVNAHYRNKGLGKLLV
                     NAVVDYAKALGLQKIYLFTADKADFYQTLGWSKISREDYMGEMVTIMEYEFKK"
     misc_feature    complement(273559..273921)
                     /locus_tag="Sbal_0237"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(273601..273801)
                     /locus_tag="Sbal_0237"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(273661..273666,273694..273702))
                     /locus_tag="Sbal_0237"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(274088..275404)
                     /locus_tag="Sbal_0238"
                     /db_xref="GeneID:4843085"
     CDS             complement(274088..275404)
                     /locus_tag="Sbal_0238"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein;
                     KEGG: son:SO4488 sensor histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_001048641.1"
                     /db_xref="GI:126172492"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4843085"
                     /translation="MYSLKGYLTRNLLITLTFAMVLLLYFLYQGIQILTQDFVASRLQ
                     HDADSLISALNNHPDGTWAITTDRLPNVYHRVNSGHYFAIQIGEQTLCSRSLFDHNVN
                     MPKLTAGEHHQATDFVGKEHWLMFSQAVIKDDQLVTLWVTEDISELEQTQVQFLAFAS
                     AAVLLTIVILLMSQYQLLKRGFKPLEQMPEAIRQMRTQGQEINPDQMPSEIIPLIEEI
                     DRLVNQLGQRVQRSRNALGNLAHEMKRPLQGLQSYLESLPPEQRSEGSKVLANLHHII
                     ERELKRTKIVGMSTPGRYTVLDDDLAPLIQVMQRIYPDRIINSHYASGLVMPFDRDDL
                     LELLGNLLDNACKHSRKNIEIRIVHQTAPTAGYGIIVSDDGEGVSDAALSIIIERGIR
                     LDESIQGHGLGLSICKDIVDSYQGELSFSHAQQGGLEASVFLPIPS"
     misc_feature    complement(274091..274990)
                     /locus_tag="Sbal_0238"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(<274559..274699)
                     /locus_tag="Sbal_0238"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(274568..274570,274577..274579,
                     274589..274591,274646..274648,274655..274657,
                     274667..274669,274676..274678,274688..274690))
                     /locus_tag="Sbal_0238"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(274682..274684)
                     /locus_tag="Sbal_0238"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(274103..274372)
                     /locus_tag="Sbal_0238"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(274115..274117,274121..274126,
                     274139..274141,274145..274147,274193..274204,
                     274271..274276,274280..274282,274286..274288,
                     274292..274294,274364..274366))
                     /locus_tag="Sbal_0238"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(274196..274198,274202..274204,
                     274274..274276,274280..274282))
                     /locus_tag="Sbal_0238"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(275410..276069)
                     /locus_tag="Sbal_0239"
                     /db_xref="GeneID:4844784"
     CDS             complement(275410..276069)
                     /locus_tag="Sbal_0239"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     KEGG: shn:Shewana3_0241 two component transcriptional
                     regulator, winged helix family"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001048642.1"
                     /db_xref="GI:126172493"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:4844784"
                     /translation="MRLLLIEDDTDLVARLIPALNKAGYTVEHADNGIDGAFLGEEEN
                     FEAVILDLGLPGKPGLQVLGQWRQKGLAMPVLILTARDAWHERVDGLKAGADDYLGKP
                     FHIEELLARLEVLIRRHFGRADNVLQHAGVSLDVDKQAVTNVDGEVIELTKIEYRLLH
                     YLMVNPSKIVSKSELSERIYEEDQIKDSNVIEVYVNRLRQRLGKDYIETRRGQGYRLK
                     E"
     misc_feature    complement(275413..276069)
                     /locus_tag="Sbal_0239"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(275722..276060)
                     /locus_tag="Sbal_0239"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(275764..275769,275776..275778,
                     275833..275835,275893..275895,275917..275919,
                     276046..276051))
                     /locus_tag="Sbal_0239"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(275917..275919)
                     /locus_tag="Sbal_0239"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(275893..275901,275905..275910))
                     /locus_tag="Sbal_0239"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(275761..275769)
                     /locus_tag="Sbal_0239"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(275419..275691)
                     /locus_tag="Sbal_0239"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(275428..275430,275443..275445,
                     275464..275469,275491..275493,275500..275502,
                     275554..275559,275614..275616))
                     /locus_tag="Sbal_0239"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(276069..276335)
                     /locus_tag="Sbal_0240"
                     /db_xref="GeneID:4841500"
     CDS             complement(276069..276335)
                     /locus_tag="Sbal_0240"
                     /note="PFAM: Propeptide, PepSY amd peptidase M4;
                     KEGG: shn:Shewana3_0242 propeptide, PepSY amd peptidase
                     M4"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="YP_001048643.1"
                     /db_xref="GI:126172494"
                     /db_xref="InterPro:IPR005075"
                     /db_xref="GeneID:4841500"
                     /translation="MISSPSCDAHDDDLSNKVVEWVKEGKVLPFDTIMQRYESRLKGR
                     LLDLEVEQKHGRIIYELEILRDDGIVYEIKIDAKTGEWLKEKVD"
     misc_feature    complement(276078..276251)
                     /locus_tag="Sbal_0240"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY; pfam03413"
                     /db_xref="CDD:251934"
     gene            complement(276328..276891)
                     /locus_tag="Sbal_0241"
                     /db_xref="GeneID:4844544"
     CDS             complement(276328..276891)
                     /locus_tag="Sbal_0241"
                     /note="KEGG: shn:Shewana3_0243 diheme cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="diheme cytochrome c"
                     /protein_id="YP_001048644.1"
                     /db_xref="GI:126172495"
                     /db_xref="GeneID:4844544"
                     /translation="MTKQAHPISWFLGSSLTAAALAIGVIGVSLTLTGTGYADDGRGL
                     SRAIPQNAEYTAECGSCHMAYPANLLPADKWRAITANLENHFGDNASLDPQVTARIEE
                     YLVQHAAQNGKVMKNSTPLLAGAGPQKITEQAFFIRKHDEIPRRMVQDNPKVGSFSQC
                     SNCHNLAEKGIFDEDTVNIPGFGRWDD"
     misc_feature    complement(276376..276732)
                     /locus_tag="Sbal_0241"
                     /note="Dihaem cytochrome c; Region: DHC; pfam09626"
                     /db_xref="CDD:255460"
     gene            complement(276981..277427)
                     /locus_tag="Sbal_0242"
                     /db_xref="GeneID:4845381"
     CDS             complement(276981..277427)
                     /locus_tag="Sbal_0242"
                     /note="PFAM: cytochrome c, monohaem;
                     KEGG: shn:Shewana3_0244 cytochrome c-type protein Shp"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048645.1"
                     /db_xref="GI:126172496"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4845381"
                     /translation="MNRLTRHTNKSRLAIVAISTLLLTSLSVSAANSKVQSLPLSAER
                     IGTQLQSYQAQGAGPFTAAAGQKLWLQDMDGRSCASCHTAKVTDMGMHQNTRKSIDPM
                     APSITADRLTDSAKIEKWFTRNCNWTFKRDCTPQEKGDALLWLSLQ"
     misc_feature    complement(276993..277274)
                     /locus_tag="Sbal_0242"
                     /note="Domain of unknown function (DUF1924); Region:
                     DUF1924; pfam09086"
                     /db_xref="CDD:255173"
     gene            complement(277481..278068)
                     /locus_tag="Sbal_0243"
                     /db_xref="GeneID:4841994"
     CDS             complement(277481..278068)
                     /locus_tag="Sbal_0243"
                     /note="PFAM: cytochrome B561;
                     KEGG: she:Shewmr4_0244 cytochrome b561"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="YP_001048646.1"
                     /db_xref="GI:126172497"
                     /db_xref="InterPro:IPR000516"
                     /db_xref="InterPro:IPR011577"
                     /db_xref="GeneID:4841994"
                     /translation="MSSNTLQTIKVWDLLIRIFHWSLVGFFTLAYLTEGEDEWMTIHS
                     YAGYSILILLVFRLLWGVIGTHNARFSNFITRPKEVLVYLKGLITGKAKDYIGHNPAG
                     AMMIVALIASIAITGFSGMALYATDGHGPLATSFFATWPEGAIKEVHEFFANFTVFLV
                     VIHVGGVIVSSLLHKENLVRAMVTGKKQRPVEQED"
     misc_feature    complement(277502..278041)
                     /locus_tag="Sbal_0243"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            278289..278744
                     /locus_tag="Sbal_0244"
                     /db_xref="GeneID:4841699"
     CDS             278289..278744
                     /locus_tag="Sbal_0244"
                     /note="KEGG: shn:Shewana3_0246 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048647.1"
                     /db_xref="GI:126172498"
                     /db_xref="GeneID:4841699"
                     /translation="MSTAVIRAFISRNPSRKSFFIYAVLLFLTEVLIALYAPAGFIRG
                     FVGDVLVVILLFCMVRAVVSPVEKAAAKNTGDGIKRLFQTPWLAFAVLLFAFAIEFGQ
                     YWGLVDKLGLGGNRLARIVIGSHFDPLDLVAYFVGYLILLGCYWKSRQP"
     misc_feature    278406..278705
                     /locus_tag="Sbal_0244"
                     /note="Protein of unknown function (DUF2809); Region:
                     DUF2809; pfam10990"
                     /db_xref="CDD:256230"
     gene            278812..279324
                     /locus_tag="Sbal_0245"
                     /db_xref="GeneID:4843310"
     CDS             278812..279324
                     /locus_tag="Sbal_0245"
                     /note="KEGG: son:SO4481 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048648.1"
                     /db_xref="GI:126172499"
                     /db_xref="GeneID:4843310"
                     /translation="MQPITAFSLLTARTDGLELNPLKMPLYFNGQHTHTFIAGLVIEG
                     QYRCVLPNKTSGYLVITSFDCPFEESTEFSLLDEAFKLIATTSLAQMYDSFLLHSHWP
                     IADNRLRLHYYGQFVLDLVISAGSSWLTARPKLKLIEVVNPQSDPQTAAAMAELAQRL
                     AAIEKSLMWD"
     gene            complement(279310..280233)
                     /locus_tag="Sbal_0246"
                     /db_xref="GeneID:4843311"
     CDS             complement(279310..280233)
                     /locus_tag="Sbal_0246"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: shn:Shewana3_0248 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048649.1"
                     /db_xref="GI:126172500"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:4843311"
                     /translation="MQDRLQAMQIFMRVAELQSFTQASASLGLSKTHVSNVVAQFETF
                     LGARLLQRTTRTVRLTQDGQSCYERCKSLLAEFQELESLFQLQAEQVSGRLRVDMSTG
                     IARNLVLPKLAEFIEQYPHIELELSSTDRKVDVIAEGFDCVIRVGSVQQEGLIAKKMG
                     HFKMLNCVSPAYIAKYGKPESLEDLTLHNHKLVHYVSQLGGTDSGFEYQDPHTHQANL
                     TIQLPKLITVNNADAYSSACLAGLGIIQVPSIGVAKYLHTGELVEILQNYPAPPMPVS
                     LLYPHRRHLSKRLQVFMAWLNQQMTPFLVPH"
     misc_feature    complement(279331..280224)
                     /locus_tag="Sbal_0246"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(280042..280221)
                     /locus_tag="Sbal_0246"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(279346..279957)
                     /locus_tag="Sbal_0246"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_3; cd08472"
                     /db_xref="CDD:176161"
     misc_feature    complement(order(279409..279411,279490..279492,
                     279541..279543,279748..279750,279754..279756,
                     279796..279798,279913..279915,279925..279927))
                     /locus_tag="Sbal_0246"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176161"
     misc_feature    complement(order(279514..279516,279523..279528,
                     279547..279561,279661..279663,279850..279870,
                     279874..279876,279886..279888,279895..279900,
                     279904..279909,279919..279924))
                     /locus_tag="Sbal_0246"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176161"
     gene            280372..281133
                     /locus_tag="Sbal_0247"
                     /db_xref="GeneID:4845048"
     CDS             280372..281133
                     /locus_tag="Sbal_0247"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: shm:Shewmr7_3773 short-chain dehydrogenase/reductase
                     SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_001048650.1"
                     /db_xref="GI:126172501"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:4845048"
                     /translation="MNTTPIALITGASRGLGKNTAQKLAAQGIDIILTYQTNAAAAAE
                     VVAEIEWLGRKAVALPLDVSDSGSFAEFAIQVSTVLAQTWQRESFNYLINNAGIGIHV
                     PMAETSIEQFDTLMNIHVKGPFFLTQTLLPQLMDGGSIVNISTGLTRFAIPGFGAYAT
                     MKGAVETMTKYWAKELGSRGIRVNVLAPGAIETDFGGGAVRDNEQMNQFLAQQTALGR
                     VGLPDDIGGAISALLSPAAAWINAQRIEASGGMFL"
     misc_feature    280387..281124
                     /locus_tag="Sbal_0247"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    280387..281121
                     /locus_tag="Sbal_0247"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(280402..280404,280408..280413,280417..280419,
                     280474..280482,280654..280662,280798..280806,
                     280843..280845,280855..280857,280933..280944)
                     /locus_tag="Sbal_0247"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(280726..280728,280804..280806,280843..280845,
                     280855..280857)
                     /locus_tag="Sbal_0247"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(281372..282892)
                     /locus_tag="Sbal_0248"
                     /db_xref="GeneID:4845807"
     CDS             complement(281372..282892)
                     /locus_tag="Sbal_0248"
                     /EC_number="1.2.1.3"
                     /note="PFAM: aldehyde dehydrogenase;
                     KEGG: son:SO4480 aldehyde dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="YP_001048651.1"
                     /db_xref="GI:126172502"
                     /db_xref="InterPro:IPR002086"
                     /db_xref="GeneID:4845807"
                     /translation="MIYAQPGTAGAIVNFKEKYANFIGGKWVAPVNGKYFDNRSPVNG
                     QNFCQIPRSDAQDIELALDAAHAAKEAWGKTSVTERSNLLLRIADRVEQNLEYLAVAE
                     TWENGKAVRETLNADLPLFVDHFRYFAGCIRAQEGSAADIDGNTVSYHFPEPLGVVGQ
                     IIPWNFPLLMAAWKIAPALAAGNCVVLKPAEQTPVSILVLLELIEDLLPAGILNVVNG
                     FGAEAGQALATSKRIAKLAFTGSTEIGYHILKCAAESLIPSTVELGGKSPNVFFADVM
                     DHEDEYLNKAVEGMLLAFFNQGEVCTCPSRVLVQESIFDRFIEKVLARAQTIKQGDPL
                     DTDTQVGAQASKEQFDKILSYLAIGKAEGAEVLLGGTLCQLDGGQSEGYYISPTIMKG
                     HNKMRIFQEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNTAQRMGRGIQ
                     AGRVWINCYHAYPAHAAFGGYKKSGIGRETHKMMLNHYQNTKNLLVSYDVNPLGFF"
     misc_feature    complement(281399..282838)
                     /locus_tag="Sbal_0248"
                     /note="Ralstonia eutrophus NAD+-dependent acetaldehyde
                     dehydrogenase II and Staphylococcus aureus AldA1
                     (SACOL0154)-like; Region: ALDH_ACDHII_AcoD-like; cd07559"
                     /db_xref="CDD:143471"
     misc_feature    complement(order(281489..281491,281603..281605,
                     281681..281683,281687..281689,281990..281992,
                     282101..282109,282149..282154,282161..282163,
                     282170..282181,282320..282325,282329..282331,
                     282374..282376,282398..282412))
                     /locus_tag="Sbal_0248"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143471"
     misc_feature    complement(order(281990..281992,281999..282001,
                     282107..282109,282398..282400))
                     /locus_tag="Sbal_0248"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143471"
     gene            283274..285232
                     /locus_tag="Sbal_0249"
                     /db_xref="GeneID:4842200"
     CDS             283274..285232
                     /locus_tag="Sbal_0249"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type; GAF
                     domain protein;
                     SMART: AAA ATPase;
                     KEGG: shm:Shewmr7_3771 GAF modulated sigma54 specific
                     transcriptional regulator, fis family"
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family GAF modulated sigma54 specific
                     transcriptional regulator"
                     /protein_id="YP_001048652.1"
                     /db_xref="GI:126172503"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4842200"
                     /translation="MAVKPHLPSTQAWLADSWQRSIGAGLSEFQLPQELRLDASELKQ
                     KHEQYQMLIALVQSHALPLFNQLMAHSNSRLLLSDAEGYVLRHWGVSRYSTKLADVAL
                     DIGVNWLEQHKGTNAIGTALTAKQAVSVVGEQHFIRQNRFMSCTACPIFSPQGEMLGV
                     INITSEQQRHTQQTLMLVSSLAQQVETALLCHLPDSRYRIDLAAQPNLLNSGWQGIVI
                     ADSDGRIVGCNPMAKQLLSHAKVGDSVEQYLGDNWSRAGGFNQHLDLHLQTQPLNIPS
                     IKSRVATSNKSLNQLGVRFRDPQLERAWQHANKVITKQIPLLVLGETGVGKEQFVKKL
                     HAQSARRTEHLVAVNCAALPAELVESELFGYQAGAFTGANRTGFIGKIRQAHGGFLFL
                     DEIGEMPLAAQSRLLRVLQEREVVPVGSNQSFKVDIQIIAATHMDLEQQVAQGLFRQD
                     LFYRLNGLQVRLPALRERQDIERIIHKLHRKHRIAPQEICPELLGLLMQHDWPGNLRE
                     LDNLMQVACLMAEGDDTLTWQHLPDYLAQKLACEPLKVDPLNAQLLNTQLLNEEQPLG
                     EEVKTGQNSASHPLAGKVVSGKVTSGNIAVQPTANAVQSDSLHEAIYSNVLQAYQACG
                     GNVSQCAKRLGISRNALYRRLKQMGLKG"
     misc_feature    283295..285223
                     /locus_tag="Sbal_0249"
                     /note="Transcriptional activator of acetoin/glycerol
                     metabolism [Secondary metabolites biosynthesis, transport,
                     and catabolism / Transcription]; Region: AcoR; COG3284"
                     /db_xref="CDD:225822"
     misc_feature    283469..283840
                     /locus_tag="Sbal_0249"
                     /note="GAF domain; Region: GAF; pfam01590"
                     /db_xref="CDD:250726"
     misc_feature    284219..284641
                     /locus_tag="Sbal_0249"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    284234..284257
                     /locus_tag="Sbal_0249"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(284237..284260,284450..284452,284576..284578)
                     /locus_tag="Sbal_0249"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    284438..284455
                     /locus_tag="Sbal_0249"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    284633..284635
                     /locus_tag="Sbal_0249"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    <285122..285217
                     /locus_tag="Sbal_0249"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            285583..286563
                     /locus_tag="Sbal_0250"
                     /db_xref="GeneID:4844776"
     CDS             285583..286563
                     /locus_tag="Sbal_0250"
                     /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein;
                     KEGG: she:Shewmr4_2154 alcohol dehydrogenase, zinc-binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_001048653.1"
                     /db_xref="GI:126172504"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:4844776"
                     /translation="MFDALLLTQEDKRTFAQVSQITEADLPEGEVLVEVAYSSLNYKD
                     GLAVTGAGKIIRQFPMVPGIDFAGVVCESTDARYQVGDQVILTGWGVGENHWGGMAQK
                     ARVKADWLVPMPQGCDAAKAMMIGTAGLTAMLCVQALQQAGITPQSGDILVTGASGGV
                     GSVAVTLLANAGYRVVACSGRVEQNAPLLRELGAAEVIDRSELEQDAKPLEAQRWAGV
                     VDTVGNKILAKALAQMQYGGAAAICGLAGGFALPTTVMPFILRGVSLLGIDSVSCPFE
                     KRKAAWEAVIKALPAHFYQQACQQISLAEVPDFANQIIQGQVTGRVLVKL"
     misc_feature    285586..286554
                     /locus_tag="Sbal_0250"
                     /note="Yhdh putative quinone oxidoreductases; Region:
                     MDR_yhdh; cd08288"
                     /db_xref="CDD:176248"
     misc_feature    285592..286560
                     /locus_tag="Sbal_0250"
                     /note="putative quinone oxidoreductase, YhdH/YhfP family;
                     Region: oxido_YhdH; TIGR02823"
                     /db_xref="CDD:234026"
     misc_feature    order(285703..285708,285961..285966,285973..285975,
                     286045..286047,286051..286062,286117..286125,
                     286180..286182,286243..286248,286309..286323,
                     286384..286395,286519..286521,286528..286530,
                     286534..286536)
                     /locus_tag="Sbal_0250"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176248"
     misc_feature    order(286207..286209,286288..286290,286306..286317,
                     286333..286335,286339..286350,286354..286362,
                     286366..286389,286396..286401)
                     /locus_tag="Sbal_0250"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176248"
     gene            286883..287368
                     /locus_tag="Sbal_0251"
                     /db_xref="GeneID:4842811"
     CDS             286883..287368
                     /locus_tag="Sbal_0251"
                     /note="KEGG: shm:Shewmr7_2230 flavocytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="flavocytochrome c"
                     /protein_id="YP_001048654.1"
                     /db_xref="GI:126172505"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:4842811"
                     /translation="MSNANLLGRRNFIKGLGAATGVAMVSPVMAVSERADGIKWDKEI
                     EILIVGSGFAGLAAAIEATRKGAKDIHIFEQMSYFGGNSAINGGLFAAPGTPMQKKEG
                     VEDSVEKMVADQIASGRGIADESLLRHVASHAVFFKIVVTLCLKIKLHLLRLLLVPYL
                     G"
     misc_feature    287024..>287134
                     /locus_tag="Sbal_0251"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     gene            complement(287322..288371)
                     /locus_tag="Sbal_0252"
                     /db_xref="GeneID:4845082"
     CDS             complement(287322..288371)
                     /locus_tag="Sbal_0252"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: sdn:Sden_2168 integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001048655.1"
                     /db_xref="GI:126172506"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4845082"
                     /translation="MPERIALIALIQEAYTQGARLYKACAETGLSKRTYRRWYREGQV
                     QADLRPTAARPEPANKLEEHERQQILSVCNQAEYASLPPSQIVPTLLDNGIYIASESS
                     FYRVLNAHGQLNHRGRTQATVNRSKPLSYRADGPNQVWSWDITYLASTVKGQFYYLYL
                     FEDIYSRKIVGYEVHEQENGEYAAALIQRSLLREQCFNTPLVLHSDNGAPMKSLTMKA
                     KLEELGITASLSRPRVSNDNPFSESLFKTLKYRPQWPASGFSCLATAREWVEKFVSWY
                     NDEHKHSQLNFVSPGQRHALQDGAILAKRKKVLEAAKERKPMRWSTEIRNCEAVGAVT
                     LNPDKAPVEGVINAA"
     misc_feature    complement(287496..288287)
                     /locus_tag="Sbal_0252"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    complement(288051..288272)
                     /locus_tag="Sbal_0252"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    complement(287619..287978)
                     /locus_tag="Sbal_0252"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(287502..287705)
                     /locus_tag="Sbal_0252"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(288377..288877)
                     /locus_tag="Sbal_0253"
                     /db_xref="GeneID:4844392"
     CDS             complement(288377..288877)
                     /locus_tag="Sbal_0253"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: sdn:Sden_2169 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001048656.1"
                     /db_xref="GI:126172507"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:4844392"
                     /translation="MARYSPERKEAILKKLLPPHNLTVAEVAREEGIAVQTLYHWRDI
                     ARKEGRPVPGKTLTADDWSAEAKFAVLIETAPLSEAEISQYCREKGLYREQVQQWKLE
                     CLSGFQTSEVQTKTIKQQAKADKAEIKSLQRELRYKEKALAEAAALLVLRKKLNVLWG
                     DDSEES"
     misc_feature    complement(288701..288871)
                     /locus_tag="Sbal_0253"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            288974..290077
                     /locus_tag="Sbal_0254"
                     /db_xref="GeneID:4844393"
     CDS             288974..290077
                     /locus_tag="Sbal_0254"
                     /note="TIGRFAM: flavocytochrome c;
                     PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein;
                     KEGG: shm:Shewmr7_2230 flavocytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="flavocytochrome c"
                     /protein_id="YP_001048657.1"
                     /db_xref="GI:126172508"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="GeneID:4844393"
                     /translation="MTLDAGSEYHPYLQQLGGHSVARTYQTSVSCGAGITQPLLKECY
                     RIGVQTHNRSKFEGFLLGEKGNVVGVKMRENYHFGEDQPGKVLNIRAKRGVIMATGGF
                     AQNIDLRMAQDPTLTSEVGCTNIPGATGEGMLEMFRLGAVPVHLAHIQSGPWASPDEG
                     GFGYVSNYSIYNFPHSIAVNCLTGKRFMNEIADRKTRADAELACRDAKGEPLPPILIT
                     SYKDSKQHPNTAKVIKYNVGWKFDTLETLAKHFDVPLKALEAQIKEYNGYVKTGDDKQ
                     FGKNMSKAKDKYLEAPFTVVRLWPKVHYCQGGVQVTTKAEVKDSLTGMPILGLYAAGE
                     VCGGIHGVSRLGSCSIPECMVMGMTAARSIMNA"
     misc_feature    <289010..290059
                     /locus_tag="Sbal_0254"
                     /note="flavocytochrome c; Region: flavo_cyto_c; TIGR01813"
                     /db_xref="CDD:233583"
     misc_feature    <289871..290071
                     /locus_tag="Sbal_0254"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     gene            290154..290459
                     /locus_tag="Sbal_0255"
                     /db_xref="GeneID:4842439"
     CDS             290154..290459
                     /locus_tag="Sbal_0255"
                     /note="KEGG: shm:Shewmr7_2229 tetraheme cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraheme cytochrome c"
                     /protein_id="YP_001048658.1"
                     /db_xref="GI:126172509"
                     /db_xref="InterPro:IPR011031"
                     /db_xref="GeneID:4842439"
                     /translation="MLSAQAVELRDYHKAVIGNDCKACHDNGIKQFPSDQACLKCHNI
                     EDLALKTARNDEDKWQNPHNNLHYGKELPCQECHGEHKAKQPLCSDCHTFKYDKHKE"
     misc_feature    290184..290432
                     /locus_tag="Sbal_0255"
                     /note="Heme-binding domain of the class III cytochrome C
                     family and related proteins; Region: Cytochrom_C3;
                     cd08168"
                     /db_xref="CDD:173979"
     misc_feature    order(290190..290192,290214..290216,290223..290231,
                     290265..290267,290340..290342,290373..290375,
                     290382..290387,290415..290417,290424..290429)
                     /locus_tag="Sbal_0255"
                     /note="heme-binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:173979"
     gene            290835..292079
                     /locus_tag="Sbal_0256"
                     /db_xref="GeneID:4843825"
     CDS             290835..292079
                     /locus_tag="Sbal_0256"
                     /note="KEGG: shm:Shewmr7_2228 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048659.1"
                     /db_xref="GI:126172510"
                     /db_xref="GeneID:4843825"
                     /translation="MKKTIVALSLLSANGAMAADLPNFLDQSDIDNAQFKCLGEPIKY
                     SKADQKYVDTLWDETLSYLKAYAIALTNGENSHCLNSDEAMIDSTLGGQKMCIMDRRD
                     MKLMVKNIYQVINNADKAKQCFGAREEVNWIYNPGGELTQNSPVAQHFKRTTFGEFFK
                     TKVTNKEVKKLGKIFTENFYKMVTGGEVKMPSAFPYDISANALPNLWAAAGWFPMYAE
                     ESKRNDKNFDNIRGGYAYAEIFGHWGLLRIDEINGEKVGAEVGMTVQSVNTLYPYHNH
                     AISEIYYNMRVPACTNQFKSFAVRADSPLVKTVKQDTTMRRVQFDAAKHNGHTMWLAG
                     SYDQDPLMYFHQNTIHAFDIDGSCEAKPEERAIVSVWARSNAHDKRNDYGTTLLCESA
                     QNPGTPANKDEVIQCDLTHLKW"
     gene            292121..293296
                     /locus_tag="Sbal_0257"
                     /db_xref="GeneID:4842079"
     CDS             292121..293296
                     /locus_tag="Sbal_0257"
                     /note="KEGG: shm:Shewmr7_2227 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048660.1"
                     /db_xref="GI:126172511"
                     /db_xref="GeneID:4842079"
                     /translation="MPWTLGARQLKLKGEMMKKLNLSFVAALISMALAAGMVQAQEQQ
                     DGINVAGTVRVNYAYKDYSESSKDKGGDFAFDMAAIKFNGKLGEWGLASEYRFYDGWQ
                     ALRYGYGFYELNPEWQLQFGVNQVPFGNPGFISNSFWFGVPYYLGFEDDYDLGIKAIY
                     SSGAWGTEMAFYKNAEYGAGRSDRYSTDLYSGLVNGTEYHNEETNQLNLRQTYEISYE
                     GGETRFGGSVEYGQIYNSKTGNNGDRYALAIHMDSNYQGWALQLQVMQYEYDAADAID
                     NNKIAVAAYNWQYEIASKAQAYSINLAKNIVTDWGSLKFYNDFGIVTPDVADKGYDTS
                     YQNVTGCAISAGPTYTMIDFIMGKNMYASTRDNGHVGLPEMGDSWDKRVNINFGYYF"
     gene            complement(293385..294251)
                     /locus_tag="Sbal_0258"
                     /db_xref="GeneID:4845735"
     CDS             complement(293385..294251)
                     /locus_tag="Sbal_0258"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: shm:Shewmr7_2226 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048661.1"
                     /db_xref="GI:126172512"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:4845735"
                     /translation="MLKIELLESFIAVAECGNMSKAADKVCRTQSTLSLQIKKLEEVV
                     GQSLLLRDNKGTTLTESGSTLLNYAYKMMQLNSQAIHDLKDCQNREIIRLGVPTDYIK
                     FYLNSCLLEFIREFTCIELVIDTDVSGNLFKRLQQGEFDLIVATHWQAPVNGELLFSR
                     RFHWAAAKNGQAHKRSTVPMALYPENCPIRAQVFANHQLSMRPINVLLSTPSPQALCM
                     AVENDLAIAPIAEFRTNEHMQILDPHEHGLPPLPIFNESLYLNPETQTEATMQLITLI
                     KANVEHLSDTID"
     misc_feature    complement(293403..294251)
                     /locus_tag="Sbal_0258"
                     /note="chromosome replication initiation inhibitor
                     protein; Provisional; Region: PRK13348"
                     /db_xref="CDD:237357"
     misc_feature    complement(294066..294242)
                     /locus_tag="Sbal_0258"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(<293556..293993)
                     /locus_tag="Sbal_0258"
                     /note="LysR substrate binding domain; Region:
                     LysR_substrate; pfam03466"
                     /db_xref="CDD:251977"
     misc_feature    complement(order(293586..293591,293595..293600,
                     293616..293633,293871..293891,293901..293903,
                     293910..293915,293919..293924))
                     /locus_tag="Sbal_0258"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            294374..295027
                     /locus_tag="Sbal_0259"
                     /db_xref="GeneID:4842458"
     CDS             294374..295027
                     /locus_tag="Sbal_0259"
                     /note="KEGG: shm:Shewmr7_2225 putative transcriptional
                     regulator, TetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001048662.1"
                     /db_xref="GI:126172513"
                     /db_xref="GeneID:4842458"
                     /translation="MSSWEQRSHYLIEVAQRSLIGHKTFDLCRSHLVAASQISKGTIY
                     NHFTTEADLVVAVACAEYEEWLAAAKRDMQRYPDPLTRFLYHHCYRLHQMLSQQRYVI
                     ERVMPNQALLLQATDSYRQRFEKISTEYNHWNRLTISEIGDIPGFNRAELVKDYLRGA
                     MINSDDANRQADDVQLYCQFSYALSQLMGHSDKRIPTKPAFVHWLSHLPSTSAISAV"
     misc_feature    294464..>294772
                     /locus_tag="Sbal_0259"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    <294467..294544
                     /locus_tag="Sbal_0259"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; cl19382"
                     /db_xref="CDD:267735"
     gene            complement(295011..296387)
                     /locus_tag="Sbal_0260"
                     /db_xref="GeneID:4842724"
     CDS             complement(295011..296387)
                     /locus_tag="Sbal_0260"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase, HAMP region domain
                     protein; histidine kinase A domain protein domain protein;
                     KEGG: son:SO4478 sensor protein CpxA"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_001048663.1"
                     /db_xref="GI:126172514"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4842724"
                     /translation="MASITAVSTVPNRLFIKLLLGFWLCSSLIIALVGLLPLLQQSHD
                     RAPLPPHLEKVLSTIAQRIQENPALLESDFLRRWERHRDMEGKPLRVYLVNSQGQVVN
                     THRVSRGVRSFMLMADEEKQPISHQFKDELVFGPFQFNLGAETYSLYGRLPDNHPRPW
                     FFFFAENKLLTLSLAIFLSGLLCGLLAWHLGKALNSLKKSANALAEGDLSNRVDKSTT
                     QRNDEIGQLATAFNSMADSIEAMVNNQQRLMGDISHELRTPLTRLQLSLALARKKGQQ
                     TAETERIGYEAEQLEKLISELLELSRVKLSTNETKVHLGLAESLSQVLDDAEFEAEQQ
                     GKTITIDIDEEIELAHFPKSLSRAIENLLRNAIRYAASDIHLQASATADQVQITIKDD
                     GPGIDAAELDAIFKPFYRPDSARQRESGGWGLGLAITEAAITAHKGKIKAENRKPTGL
                     EVTITLPK"
     misc_feature    complement(295017..296354)
                     /locus_tag="Sbal_0260"
                     /note="two-component sensor protein; Provisional; Region:
                     cpxA; PRK09470"
                     /db_xref="CDD:236532"
     misc_feature    complement(295668..295814)
                     /locus_tag="Sbal_0260"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(295674..295679,295686..295691,
                     295695..295700,295707..295712,295716..295721,
                     295776..295778,295782..295787,295794..295799,
                     295803..295808))
                     /locus_tag="Sbal_0260"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(295482..295655)
                     /locus_tag="Sbal_0260"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(295497..295499,295509..295511,
                     295518..295520,295530..295532,295539..295541,
                     295590..295592,295599..295601,295611..295613,
                     295620..295622,295632..295634,295644..295646))
                     /locus_tag="Sbal_0260"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(295626..295628)
                     /locus_tag="Sbal_0260"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(295020..295325)
                     /locus_tag="Sbal_0260"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(295032..295034,295038..295043,
                     295056..295058,295062..295064,295110..295121,
                     295200..295205,295209..295211,295215..295217,
                     295221..295223,295284..295286,295293..295295,
                     295305..295307))
                     /locus_tag="Sbal_0260"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(295293..295295)
                     /locus_tag="Sbal_0260"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(295113..295115,295119..295121,
                     295203..295205,295209..295211))
                     /locus_tag="Sbal_0260"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(296375..297061)
                     /locus_tag="Sbal_0261"
                     /db_xref="GeneID:4842108"
     CDS             complement(296375..297061)
                     /locus_tag="Sbal_0261"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     KEGG: shn:Shewana3_0253 two component transcriptional
                     regulator, winged helix family"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001048664.1"
                     /db_xref="GI:126172515"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:4842108"
                     /translation="MSRILLIDDDLGLSELLGQLLELEGFQLTLAYDGKQGLDLALSA
                     DYDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTARGDEIDRVVGLEIGADDYLPKP
                     FNDRELIARIRAIIRRSNLTTQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
                     TLLHTLALHAGELMNKEELNEKVLGKKLMPFDRSLDMHLSNLRKKLPERGDGRPRVKT
                     IRGKGYIWLP"
     misc_feature    complement(296387..297061)
                     /locus_tag="Sbal_0261"
                     /note="DNA-binding transcriptional regulator CpxR;
                     Provisional; Region: PRK10955"
                     /db_xref="CDD:182864"
     misc_feature    complement(296738..297049)
                     /locus_tag="Sbal_0261"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(296756..296761,296768..296770,
                     296825..296827,296882..296884,296906..296908,
                     297035..297040))
                     /locus_tag="Sbal_0261"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(296906..296908)
                     /locus_tag="Sbal_0261"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(296882..296890,296894..296899))
                     /locus_tag="Sbal_0261"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(296753..296761)
                     /locus_tag="Sbal_0261"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(296384..296665)
                     /locus_tag="Sbal_0261"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(296393..296395,296408..296410,
                     296444..296449,296471..296473,296480..296482,
                     296534..296539,296594..296596))
                     /locus_tag="Sbal_0261"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            297442..297966
                     /locus_tag="Sbal_0262"
                     /db_xref="GeneID:4842109"
     CDS             297442..297966
                     /locus_tag="Sbal_0262"
                     /note="PFAM: protein of unknown function, Spy-related;
                     KEGG: she:Shewmr4_0253 protein of unknown function,
                     Spy-related"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048665.1"
                     /db_xref="GI:126172516"
                     /db_xref="InterPro:IPR012899"
                     /db_xref="GeneID:4842109"
                     /translation="MKTLSPLKASLFAILASSAVFATTVNAEPMDGGCDFSRSEFHKG
                     DRMMGDRMEHGGRHMDQGGMHRMFEGLDLTDAQKADIKKLFADQKAARADSRPTKEQR
                     LAHRTEMQALMTAPNFDEVQAKALMSAQQEQRQAQAIERMKLHNQIYNLLTLEQQAKF
                     KARFEAQAGKEPRG"
     misc_feature    297649..297936
                     /locus_tag="Sbal_0262"
                     /note="CpxP component of the bacterial Cpx-two-component
                     system and related proteins; Region: CpxP_like; cd09916"
                     /db_xref="CDD:197366"
     misc_feature    order(297757..297759,297769..297771,297778..297783,
                     297793..297795,297799..297801,297811..297813,
                     297820..297822,297832..297834,297844..297846,
                     297856..297858,297865..297870,297877..297879,
                     297886..297888,297919..297924,297931..297933)
                     /locus_tag="Sbal_0262"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:197366"
     gene            298018..298908
                     /locus_tag="Sbal_0263"
                     /db_xref="GeneID:4842111"
     CDS             298018..298908
                     /locus_tag="Sbal_0263"
                     /note="TIGRFAM: cation diffusion facilitator family
                     transporter;
                     PFAM: cation efflux protein;
                     KEGG: she:Shewmr4_0254 cation diffusion facilitator family
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="YP_001048666.1"
                     /db_xref="GI:126172517"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="GeneID:4842111"
                     /translation="MTQTSQYDFWVKLASRASVATALILILIKMFAWLYSGSASMLAS
                     LTDSFADALASIINFIAIRYALVPPDHDHRYGHGKAEPLASLAQSAFIMGSAFLLLFY
                     GGERLLTPVPVENATIGVVVSVIAIIMTLALVTLQKRALAATKSTVVEADSLHYKSDL
                     FLNGAVLLALVLSQYGWWWADGLFAVMIAFYIGHQAFGLGYRSIQALLDRELDEETRQ
                     QITQIAMEDPRVQGLHDLRTRQAGKTVFIQFHLELDGNLSLNEAHSIADTTGIKVKAA
                     FEDAEVIIHQDPVKSEVNET"
     misc_feature    298018..298884
                     /locus_tag="Sbal_0263"
                     /note="Cation efflux family; Region: Cation_efflux;
                     cl00316"
                     /db_xref="CDD:260348"
     gene            298923..299375
                     /locus_tag="Sbal_0264"
                     /db_xref="GeneID:4842919"
     CDS             298923..299375
                     /locus_tag="Sbal_0264"
                     /note="KEGG: she:Shewmr4_0255 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048667.1"
                     /db_xref="GI:126172518"
                     /db_xref="GeneID:4842919"
                     /translation="MAWMQKQGHRWNHSTRLICRYQRLSTRFELIVESEIRDVSVPAD
                     AEITVSTQAQSSRVNQADSTVTPVIVGAWSQLVLRKHLYYLPQKIDFEISNQTYRVHI
                     WPLFLWRTRITCVVTGRVVVSECLDVRRRRSLIRWLYASFIGLLRVLS"
     gene            299580..300141
                     /locus_tag="Sbal_0265"
                     /pseudo
                     /db_xref="GeneID:4841694"
     gene            complement(300279..301691)
                     /locus_tag="Sbal_0266"
                     /db_xref="GeneID:4843444"
     CDS             complement(300279..301691)
                     /locus_tag="Sbal_0266"
                     /note="KEGG: she:Shewmr4_0257 nitrogen metabolism
                     transcriptional regulator, NtrC, fis family;
                     TIGRFAM: nitrogen regulation protein NR(I);
                     PFAM: response regulator receiver; sigma-54 factor,
                     interaction domain-containing protein; helix-turn-helix,
                     Fis-type; ATPase associated with various cellular
                     activities, AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen metabolism transcriptional regulator,
                     NtrC, Fis family"
                     /protein_id="YP_001048668.1"
                     /db_xref="GI:126172519"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010114"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:4843444"
                     /translation="MRISEQVWILDDDSSIRWVLEKALQGAKLSTASFAAAESLWQAL
                     EISQPHVIVSDIRMPGTDGLSLLERLQVHYPHIPVIIMTAHSDLDSAVSAYQAGAFEY
                     LPKPFDIDEAISLVERALTHATEQSPAPAQEAQVKTPEIIGEAPAMQEVFRAIGRLSR
                     SSISVLINGQSGTGKELVAGALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAF
                     TGAANVRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHNAVQVDVR
                     IIAATHQDLELLVQKGGFREDLFHRLNVIRVHLPPLSQRREDIPQLATHFLASAAKEI
                     GVETKIMTKETAVKLSQLPWPGNVRQLENTCRWLTVMASGQEILPQDLPPELLKDPVS
                     VTHTAKGSQDWQSALTEWIDQKLSEGNSDLLTEVQPAFERILLETALRHTQGHKQEAA
                     KRLGWGRNTLTRKLKELSMD"
     misc_feature    complement(300291..301673)
                     /locus_tag="Sbal_0266"
                     /note="nitrogen regulation protein NR(I); Region: ntrC;
                     TIGR01818"
                     /db_xref="CDD:233585"
     misc_feature    complement(301332..301667)
                     /locus_tag="Sbal_0266"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(301374..301379,301386..301388,
                     301443..301445,301503..301505,301527..301529,
                     301656..301661))
                     /locus_tag="Sbal_0266"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(301527..301529)
                     /locus_tag="Sbal_0266"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(301503..301511,301515..301520))
                     /locus_tag="Sbal_0266"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(301371..301379)
                     /locus_tag="Sbal_0266"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(300759..301268)
                     /locus_tag="Sbal_0266"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(301164..301187)
                     /locus_tag="Sbal_0266"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(300846..300848,300972..300974,
                     301161..301184))
                     /locus_tag="Sbal_0266"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(300969..300986)
                     /locus_tag="Sbal_0266"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(300789..300791)
                     /locus_tag="Sbal_0266"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(300291..300410)
                     /locus_tag="Sbal_0266"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(301730..302776)
                     /locus_tag="Sbal_0267"
                     /db_xref="GeneID:4841477"
     CDS             complement(301730..302776)
                     /locus_tag="Sbal_0267"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase A domain protein domain
                     protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     KEGG: shn:Shewana3_0259 signal transduction histidine
                     kinase, nitrogen specific, NtrB"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase, nitrogen
                     specific, NtrB"
                     /protein_id="YP_001048669.1"
                     /db_xref="GI:126172520"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4841477"
                     /translation="MDKETLLNHLVTAVLVIDKDLKPCYANAAAEQLLGVGSHRLVEQ
                     ALPEHYQILGVEAQLLRDAVAAGQGLTVNTAALVTLDGQHHTVDLTLIPLDDEAELSL
                     LELRQVDQQRRIHQQLSQDAQQQAAQFLVRNLAHEIKNPLGGLRGAAQLLSRELDDPA
                     LKEFTTLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHQVVQKVYKLVEMALPANIQLK
                     RDYDPSIPDIEMDPDQMQQAVLNILQNAVQALEHTGGEILLRTRTQHQVTIGSQRHKL
                     VLTLSIIDNGPGIPPELMDTLFYPMVTGREQGSGLGLSIAHNIARLHSGRIDCLSSAG
                     HTEFIISLPILGAK"
     misc_feature    complement(301745..302773)
                     /locus_tag="Sbal_0267"
                     /note="nitrogen regulation protein NR(II); Provisional;
                     Region: glnL; PRK11073"
                     /db_xref="CDD:182947"
     misc_feature    complement(302480..302749)
                     /locus_tag="Sbal_0267"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(302531..302533,302546..302548,
                     302627..302632,302669..302671,302687..302689,
                     302699..302701))
                     /locus_tag="Sbal_0267"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(302504..302506,302510..302512,
                     302597..302602,302609..302611,302639..302641))
                     /locus_tag="Sbal_0267"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(302228..302389)
                     /locus_tag="Sbal_0267"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(302231..302233,302243..302245,
                     302252..302254,302264..302266,302273..302275,
                     302285..302287,302333..302335,302342..302344,
                     302354..302356,302363..302365,302375..302377,
                     302387..302389))
                     /locus_tag="Sbal_0267"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(302369..302371)
                     /locus_tag="Sbal_0267"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(301751..302074)
                     /locus_tag="Sbal_0267"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(301763..301765,301769..301771,
                     301784..301786,301790..301792,301838..301849,
                     301910..301915,301919..301921,301925..301927,
                     301931..301933,302033..302035,302042..302044,
                     302054..302056))
                     /locus_tag="Sbal_0267"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(302042..302044)
                     /locus_tag="Sbal_0267"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(301841..301843,301847..301849,
                     301913..301915,301919..301921))
                     /locus_tag="Sbal_0267"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(302930..303436)
                     /locus_tag="Sbal_0268"
                     /db_xref="GeneID:4842620"
     CDS             complement(302930..303436)
                     /locus_tag="Sbal_0268"
                     /note="KEGG: son:SO4470 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048670.1"
                     /db_xref="GI:126172521"
                     /db_xref="GeneID:4842620"
                     /translation="MRSLTLIGLVLFSMLAQATVYKWVDKDGKVHYSDEPQPNAQVVE
                     LKEKTLNQIALPLPKTDSNNANQAIESIQYQVNITSPAEEETVRDNNGDFDVVATITP
                     ELKSQYLMALKLDGNPVGQPQIGGTFKLKNIDRGEHTLVVDALTQNGKVFASSSPRKI
                     FLHQAAKR"
     misc_feature    complement(303245..303421)
                     /locus_tag="Sbal_0268"
                     /note="Domain of unknown function (DUF4124); Region:
                     DUF4124; pfam13511"
                     /db_xref="CDD:257831"
     gene            complement(303630..304256)
                     /locus_tag="Sbal_0269"
                     /db_xref="GeneID:4844193"
     CDS             complement(303630..304256)
                     /locus_tag="Sbal_0269"
                     /note="PFAM: Glutathione S-transferase, N-terminal domain;
                     KEGG: sdn:Sden_1385 glutathione S-transferase-like
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase domain-containing
                     protein"
                     /protein_id="YP_001048671.1"
                     /db_xref="GI:126172522"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="GeneID:4844193"
                     /translation="MITLHHLNKSRSKRIIWLLEELGQPYQIKSYQRDSQTFLAPPEL
                     KQIHPLGKSPVIEMDGQVIAESGAITEYLIEKYAADTLAPARDSADYVDYLQWLHFAE
                     SSAMLPLLLRMFVQKDGCKTNFLEGYAAIEVSKISHYFNDMLAGKTYLVTDKLTGADI
                     MMSFVVELLANSGDLEKFEHIQRYATQLSQHAAWVKASEIEKQLDASV"
     misc_feature    complement(303639..304256)
                     /locus_tag="Sbal_0269"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    complement(304023..304253)
                     /locus_tag="Sbal_0269"
                     /note="GST_N family, Saccharomyces cerevisiae GTT1-like
                     subfamily; composed of predominantly uncharacterized
                     proteins with similarity to the S. cerevisiae GST protein,
                     GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are
                     cytosolic dimeric proteins involved...; Region:
                     GST_N_GTT1_like; cd03046"
                     /db_xref="CDD:239344"
     misc_feature    complement(order(304044..304049,304056..304058,
                     304194..304199,304206..304211,304215..304220,
                     304224..304226))
                     /locus_tag="Sbal_0269"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    complement(order(304059..304064,304095..304103,
                     304224..304226))
                     /locus_tag="Sbal_0269"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    complement(order(304044..304046,304053..304058,
                     304062..304067,304101..304103))
                     /locus_tag="Sbal_0269"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239344"
     misc_feature    complement(303684..304007)
                     /locus_tag="Sbal_0269"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    complement(order(303753..303755,303765..303767,
                     303774..303779,303786..303788,303951..303953,
                     303972..303974))
                     /locus_tag="Sbal_0269"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(303840..303842,303948..303950,
                     303957..303962,303969..303974))
                     /locus_tag="Sbal_0269"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    complement(order(303753..303755,303762..303764,
                     303936..303941,303951..303953))
                     /locus_tag="Sbal_0269"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            complement(304392..305090)
                     /locus_tag="Sbal_0270"
                     /db_xref="GeneID:4841816"
     CDS             complement(304392..305090)
                     /locus_tag="Sbal_0270"
                     /note="PFAM: ThiJ/PfpI domain protein;
                     KEGG: sfr:Sfri_0805 ThiJ/PfpI domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiJ/PfpI domain-containing protein"
                     /protein_id="YP_001048672.1"
                     /db_xref="GI:126172523"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="GeneID:4841816"
                     /translation="MKMKMNILMVLTSHDKLGDTGLKTGFWLEEFASPFYEFKDKGFD
                     ITLASPLGGQPPLDPKSDEPDFQTEATARFSKDPEAQALLANTTRLSEINAADYDAVF
                     YPGGHGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAALLHPKASDGKPLVSGKRV
                     TGFSNSEEEAVQLTHIVPFLVEDMLQKNGGTYVKGDDWTSFVVADGHLITGQNPGSSE
                     AVAQAIVAQLNARG"
     misc_feature    complement(304398..305084)
                     /locus_tag="Sbal_0270"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(304407..305072)
                     /locus_tag="Sbal_0270"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in proteins similar to Escherichia coli Hsp31
                     protein; Region: GATase1_Hsp31_like; cd03141"
                     /db_xref="CDD:153235"
     misc_feature    complement(order(304587..304589,304677..304682))
                     /locus_tag="Sbal_0270"
                     /note="potential catalytic triad [active]"
                     /db_xref="CDD:153235"
     misc_feature    complement(304680..304682)
                     /locus_tag="Sbal_0270"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153235"
     gene            complement(305162..306319)
                     /locus_tag="Sbal_0271"
                     /db_xref="GeneID:4841817"
     CDS             complement(305162..306319)
                     /locus_tag="Sbal_0271"
                     /note="PFAM: iron-containing alcohol dehydrogenase;
                     KEGG: shn:Shewana3_0261 iron-containing alcohol
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="YP_001048673.1"
                     /db_xref="GI:126172524"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="GeneID:4841817"
                     /translation="MLNFNYYNPTRIRFGKDTIAEIDTLVPSDAKVMILFGGSSARKT
                     GTLDEVKQSLGNRFIVEFDGIEPNPTYETLMKAVAQVREQKIDFLLAVGGGSVIDGTK
                     FVAAAAVFEGEPWDILTSWGAKVTQAMPFGSVLTLPATGSEMNNASVVTRKSLQAKLP
                     FRNDLVYPQFSILDPTKTFTLPERQVANGVVDAFVHITEQYLTYPVNAAVQDRFAEGL
                     LQTLIELGPQVLVQPEDYDIRANLMWVATMALNGTIGVGVPHDWATHMIGHELTALYD
                     IDHARTLAIVLPALLQCTKEAKREKLLQYADRVWHINTGTDDERIDAAIAKTKAFFEA
                     MGIPTHLSAYDLDASHVDTVVKQLELHGMVALGEHGNINPAMSRDILTLAL"
     misc_feature    complement(305177..306313)
                     /locus_tag="Sbal_0271"
                     /note="Butanol dehydrogenase catalyzes the conversion of
                     butyraldehyde to butanol with the cofactor NAD(P)H being
                     oxidized in the process; Region: BDH; cd08187"
                     /db_xref="CDD:173946"
     misc_feature    complement(order(305588..305590,305597..305602,
                     305648..305650,305660..305662,306275..306280,
                     306284..306289,306293..306295))
                     /locus_tag="Sbal_0271"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173946"
     misc_feature    complement(order(305483..305485,305525..305527,
                     305732..305734,305744..305746,305777..305782,
                     305789..305791,305846..305848,305873..305875,
                     305879..305881,305885..305887,305894..305896,
                     305900..305902,305909..305914,306023..306025,
                     306032..306040,306116..306121,306200..306208))
                     /locus_tag="Sbal_0271"
                     /note="active site"
                     /db_xref="CDD:173946"
     misc_feature    complement(order(305483..305485,305525..305527,
                     305732..305734,305744..305746))
                     /locus_tag="Sbal_0271"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173946"
     gene            complement(306503..307099)
                     /locus_tag="Sbal_0272"
                     /db_xref="GeneID:4841501"
     CDS             complement(306503..307099)
                     /locus_tag="Sbal_0272"
                     /note="PFAM: regulatory protein, TetR;
                     KEGG: shm:Shewmr7_3760 transcriptional regulator, TetR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001048674.1"
                     /db_xref="GI:126172525"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:4841501"
                     /translation="MKIETQSTRQHILDIGYKLIVRKGFSSVGLSLLLQAAEVPKGSF
                     YHYFKSKEQFGEALITDYFEKYQLDLDALFNDSTLTGYQRLMQYWQQWLHVQADGCVD
                     QKCLVVKLSAEVADLSEAMRVALLKGSAGIIDRLTTCVQVGINDSSIAEQDPQSTAEM
                     LYHMWLGASLMNKLGHSPAALERALVTTKAILTPKTAL"
     misc_feature    complement(306587..307099)
                     /locus_tag="Sbal_0272"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(306926..307066)
                     /locus_tag="Sbal_0272"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(307387..307698)
                     /locus_tag="Sbal_0273"
                     /db_xref="GeneID:4844353"
     CDS             complement(307387..307698)
                     /locus_tag="Sbal_0273"
                     /note="PFAM: protein of unknown function DUF1255;
                     KEGG: shm:Shewmr7_3759 protein of unknown function
                     DUF1255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048675.1"
                     /db_xref="GI:126172526"
                     /db_xref="InterPro:IPR009664"
                     /db_xref="GeneID:4844353"
                     /translation="MSLLEQVSVSKKANIYFDGRVASRSVFFADGSKQTLGVVQPGEY
                     EFSTSQGEIMEVISGRFEVLLPETTTWQEFSEGTQFELAANVSFKIRNTAIAEYCCSY
                     L"
     misc_feature    complement(307390..307668)
                     /locus_tag="Sbal_0273"
                     /note="Protein of unknown function (DUF1255); Region:
                     DUF1255; pfam06865"
                     /db_xref="CDD:253951"
     gene            308057..310012
                     /locus_tag="Sbal_0274"
                     /db_xref="GeneID:4842751"
     CDS             308057..310012
                     /locus_tag="Sbal_0274"
                     /note="PFAM: chemotaxis sensory transducer;
                     KEGG: shn:Shewana3_0264 methyl-accepting chemotaxis
                     sensory transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_001048676.1"
                     /db_xref="GI:126172527"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:4842751"
                     /translation="MGFTRKIQLISLLIVLLPLIFATAIVTYIARDELFAEAQSRLVA
                     VREIKQRQIVGMFQDFSDNLQAVSAVIASQKSLDTISDLDETLKLLNKSLGFYDLFII
                     RDDGTVFYTAAKESDFGTNLRTGPYHDSGLAQLFNKALGSTGTVLLQDFSAYAPSNGQ
                     PAAFIGQSIQFNQQRLVVAAQVSIDRINRVMQIREGMGQSGETYLIGPNNRMRSDSFL
                     DPNNRTVTASFAGTVAQNGVDTLAVKEALAGKTGVMQVNDYNHNPVLSAYSPVVELGL
                     RWGLMAEIDVSEIAAPAYRMLFIGLFVCVAALVLAFAAAKLVTGFVLKPLGGEPEDMC
                     NLTSMIASGDLTHNLPHVQTDNHLMSWLARMQTKLKEIISQLVGVGHELESAAEQNSA
                     AMTQADCSIQMQAKETDMLATAVEEMSYAAAEISTNTLKSSDEVSACTHSSEILSQNL
                     ASTRKSLKVTLSSFATIHQQVGSLEADSQKIGSVLAVINAIAEQTNLLSLNAAIEAAR
                     AGEHGRGFAVVADEVRQLAVKVQLATQDIGQVLKGIQQQSGVLALHSVTCTTEASKTA
                     EDADGMQAAVDDIALRLETLKALMIQTATAAEEQTTVSATIAQGIAGLSVAAEENSAA
                     ISQVAASTRSLLGLANQLGLTTAQFKV"
     misc_feature    309227..310006
                     /locus_tag="Sbal_0274"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    309302..309943
                     /locus_tag="Sbal_0274"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    order(309326..309331,309350..309355,309362..309364,
                     309371..309376,309380..309385,309392..309394,
                     309401..309403,309413..309415,309422..309424,
                     309431..309436,309443..309448,309455..309457,
                     309467..309469,309473..309478,309485..309487,
                     309494..309499,309506..309511,309518..309520,
                     309527..309529,309536..309541,309548..309550,
                     309560..309562,309569..309571,309590..309592,
                     309602..309604,309611..309613,309620..309625,
                     309632..309634,309641..309646,309653..309658,
                     309662..309667,309674..309679,309749..309754,
                     309770..309772,309779..309784,309791..309793,
                     309800..309805,309809..309814,309821..309826,
                     309833..309835,309842..309847,309854..309856,
                     309863..309868,309872..309877,309884..309889,
                     309893..309898,309905..309907,309914..309919,
                     309926..309928,309935..309940)
                     /locus_tag="Sbal_0274"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    309536..309637
                     /locus_tag="Sbal_0274"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(310152..312266)
                     /locus_tag="Sbal_0275"
                     /db_xref="GeneID:4843853"
     CDS             complement(310152..312266)
                     /locus_tag="Sbal_0275"
                     /note="PFAM: protein of unknown function DUF323;
                     Methyltransferase type 11; Methyltransferase type 12;
                     KEGG: shm:Shewmr7_3757 protein of unknown function DUF323"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048677.1"
                     /db_xref="GI:126172528"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:4843853"
                     /translation="MDKPITQPPQTLKLIGETEAGKRLELKQYFNQTWALYESLFDLI
                     QEDSAYYLKAEPLRHPLIFYFGHTATFYINKLKLGKFLDERVNDNFESMFAIGVDEMS
                     WDDLNEQHYPWPNVPEVRSYRQQVNAVVNRVIDEMPLALPITQNSPAWIILMGIEHER
                     IHLETSSVIIRQLPLEHVAPNSLWAACQDFTAAEANSLLAVKGQKVTLGKTEQDQTYG
                     WDNEYGHKIFNVVDFKASKFLVSNQEYLAFVEAGGYRSPQFWNEEGQAWLAYTQAQMP
                     RFWRLKQDKWWQRNLAEEIPLPLNWPVEVNQLEAKAFCNWKTEQNQSNIRLLTEAEWY
                     ILRENVPADAPDWHEVPGNITLAYYASSCPVNRFEHNGFFDIVGNVWQWTETAIDGFN
                     GFAVHPLYDDFSTPTFDGKHNLIKGGSWISTGNEAIASSRYAFRRHFYQHAGFRYVES
                     TQNPAQMAEVNVYETDELISQYLEFHYGAEYFGVANFCVNGVQQALSEIQLTHTAKAL
                     DIGCSVGRASFELAKVFDHVDGIDFSARFIQQAYALTEQGEKRYTIRTEGDLQEFKSA
                     SLAKLGYELEAKKVNFMQGDACNLKPLYTGYDLVYASNLIDRLNDPKHFLTSIAQRIN
                     QGGYLVIASPYTWLEDYTPKDKWLGGVKVKGENFTTLDGLTETLIGQFELVAVKEIPF
                     VIRETKRKFQHSVSEMTIWRKR"
     misc_feature    complement(310923..312239)
                     /locus_tag="Sbal_0275"
                     /note="5-histidylcysteine sulfoxide synthase; Region:
                     ovoA_Nterm; TIGR04344"
                     /db_xref="CDD:234555"
     misc_feature    complement(311772..312182)
                     /locus_tag="Sbal_0275"
                     /note="DinB superfamily; Region: DinB_2; pfam12867"
                     /db_xref="CDD:257360"
     misc_feature    complement(310923..311627)
                     /locus_tag="Sbal_0275"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     misc_feature    complement(310374..310751)
                     /locus_tag="Sbal_0275"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(310458..310460,310506..310514,
                     310668..310673,310719..310739))
                     /locus_tag="Sbal_0275"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            312629..313024
                     /locus_tag="Sbal_0276"
                     /db_xref="GeneID:4845854"
     CDS             312629..313024
                     /locus_tag="Sbal_0276"
                     /note="KEGG: shm:Shewmr7_3756 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048678.1"
                     /db_xref="GI:126172529"
                     /db_xref="GeneID:4845854"
                     /translation="MTINALWIPAWYELDQSIVVGVTEEFVFHKTVANEALTFYSGAK
                     GSDAAKATGTISAIKHNVLGDIESVDAQGLDYTLVLQDGRRLLVNAEENPGLIYEWVD
                     DSWQPSDMVITDWTLAVQFASLSPLTPIK"
     gene            complement(313065..313262)
                     /locus_tag="Sbal_0277"
                     /db_xref="GeneID:4842596"
     CDS             complement(313065..313262)
                     /locus_tag="Sbal_0277"
                     /note="KEGG: son:SO4461 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048679.1"
                     /db_xref="GI:126172530"
                     /db_xref="GeneID:4842596"
                     /translation="MESNAMLMERWDTAEEKAEQLRRYQLCLDEFNELDFHDVYVAEI
                     KKEYQQLAELVKVQSTSDPER"
     gene            313607..314458
                     /locus_tag="Sbal_0278"
                     /db_xref="GeneID:4842922"
     CDS             313607..314458
                     /locus_tag="Sbal_0278"
                     /note="PFAM: PfkB domain protein;
                     KEGG: son:SO4458 carbohydrate kinase, PfkB family"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase-like domain-containing protein"
                     /protein_id="YP_001048680.1"
                     /db_xref="GI:126172531"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:4842922"
                     /translation="MANILLVANLNCDRILLLDKPLKTGGRFHYQDGGQRLGGGGANT
                     GLGLVWAGHSVALVSQVGRDDMGDWLIAEASTQGLDCRLVQRRAGNTCEMLLVMTPDG
                     ERTIIRPQRPIFELSVPPKWQPWDALYFNTSAEGSVSWAKTALEHCLVVAQLAKDDRQ
                     RPCHILLASMSDIQGRCDGASWEYGKSIGGEGLRYFIVTDGINGAKVYTHDQVQDVAA
                     IPATVVDTTGAGDAYAAGLIHSLCTGQSITEAMAEGAVWAAFAVATDSSIPGEALKQY
                     LEAKQIA"
     misc_feature    313613..314410
                     /locus_tag="Sbal_0278"
                     /note="ribokinase/pfkB superfamily: Kinases that accept a
                     wide variety of substrates, including carbohydrates and
                     aromatic small molecules, all are phosphorylated at a
                     hydroxyl group. The superfamily includes ribokinase,
                     fructokinase, ketohexokinase; Region:
                     ribokinase_pfkB_like; cl00192"
                     /db_xref="CDD:260247"
     misc_feature    order(313733..313735,314288..314290,314297..314299)
                     /locus_tag="Sbal_0278"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238177"
     misc_feature    order(314111..314113,314201..314203,314282..314284,
                     314291..314296,314303..314305)
                     /locus_tag="Sbal_0278"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238177"
     gene            314776..316236
                     /locus_tag="Sbal_0279"
                     /db_xref="GeneID:4842923"
     CDS             314776..316236
                     /locus_tag="Sbal_0279"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein;
                     KEGG: she:Shewmr4_0268 diguanylate cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_001048681.1"
                     /db_xref="GI:126172532"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="GeneID:4842923"
                     /translation="MGNNAWNDKNKFIWLLSVLLLVAFLVTSGISYKVAHDSLSQQIE
                     SNTLPLTSDNIYSEIQQDLLRPIFISSLMAQDTFVRDWTLSHEQEPEKLIRYLKEIQE
                     KYDTVTSFFVSEKSRHYYHSTGILKQIQDVEPDDAWYFRVRSLPESEHYEVNIDADTA
                     DRSKTTVFVNYKVFDFEGKFIGVTGVGLAVEKVKSLIELYQKRYNRRVFFTDRQGNVT
                     LHGDEYDGADSLQTSPGLENLATRILTSPSAAFSYQRNGKTVYLNSRLVPEFKWYLIV
                     EQEDAPQERELLNTFWGNLGLSLMVTLGILFISNMTLGRYQRKLEVMASTDKLTGAAN
                     RQVFDEYFRQALDKAKLAQSPISILLLDIDHFKKVNDSYGHGIGDLVLKTMTNMLRGA
                     LQQQDILCRWGGEEFLILLPGMDLTRAAELAEQIRELIFQREIKVNGLHISITASIGV
                     AEHQAQEPAEDLIKRADLALYQAKEAGRNQVVLNHS"
     misc_feature    315751..316221
                     /locus_tag="Sbal_0279"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(315859..315861,315988..315990)
                     /locus_tag="Sbal_0279"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(315874..315876,315883..315888,315898..315900,
                     315910..315912,315976..315978,315982..315993)
                     /locus_tag="Sbal_0279"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(315964..315966,316048..316050)
                     /locus_tag="Sbal_0279"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            316372..317061
                     /locus_tag="Sbal_0280"
                     /db_xref="GeneID:4843066"
     CDS             316372..317061
                     /locus_tag="Sbal_0280"
                     /note="PFAM: 3-alpha; MOSC domain containing protein;
                     KEGG: she:Shewmr4_0269 MOSC domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MOSC domain-containing protein"
                     /protein_id="YP_001048682.1"
                     /db_xref="GI:126172533"
                     /db_xref="InterPro:IPR005163"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="GeneID:4843066"
                     /translation="MSKLLINKLSGLYLGTYLQEMAGVATGIDGKQAAQQLLVHVSHV
                     EGDAQADPKHHGGLDRVLHHFPREHYGQYRRWDLITQLEDAPSMGENISTVGLNETQV
                     NIGDILQIGAVTVQVTQPRSPCFKLNLQFGHKEFALAMQQSQLCGWFYRVLTPGIIQL
                     NDKIELIERRTDISVAEAMALYFSPTFNASGYDRLACCEGLAQSWVNSLQRRLASQTV
                     EDWQMRLYQSY"
     misc_feature    316393..317016
                     /locus_tag="Sbal_0280"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2258"
                     /db_xref="CDD:225167"
     misc_feature    316504..316869
                     /locus_tag="Sbal_0280"
                     /note="MOSC domain; Region: MOSC; pfam03473"
                     /db_xref="CDD:251984"
     misc_feature    316885..317025
                     /locus_tag="Sbal_0280"
                     /note="3-alpha domain; Region: 3-alpha; pfam03475"
                     /db_xref="CDD:251985"
     gene            317371..317727
                     /locus_tag="Sbal_0281"
                     /db_xref="GeneID:4844664"
     CDS             317371..317727
                     /locus_tag="Sbal_0281"
                     /note="KEGG: shn:Shewana3_0271 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048683.1"
                     /db_xref="GI:126172534"
                     /db_xref="GeneID:4844664"
                     /translation="MIEPVTKSDKDFGLLVYASSFVGYLVPLGSILGPLIIWLMKREE
                     SAFVDQCGRSCLNFKLSLLIYVIISGVLALVGIGFIFLAILGIFDLVCTVLAIIKASE
                     GKVYKYPLTIKFIAMD"
     misc_feature    317395..317715
                     /locus_tag="Sbal_0281"
                     /note="Tic20-like protein; Region: Tic20; pfam09685"
                     /db_xref="CDD:255484"
     gene            complement(317803..319728)
                     /locus_tag="Sbal_0282"
                     /db_xref="GeneID:4844387"
     CDS             complement(317803..319728)
                     /locus_tag="Sbal_0282"
                     /note="PFAM: histidine kinase, HAMP region domain protein;
                     chemotaxis sensory transducer;
                     KEGG: shm:Shewmr7_3750 methyl-accepting chemotaxis sensory
                     transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_001048684.1"
                     /db_xref="GI:126172535"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:4844387"
                     /translation="MIFMIFNNLTIKQKILLTVTFAVLLSTILVGVLSQRSAKNVVQQ
                     RMLGSELPSLMMQIRNKIDLDISTLMNAAEQLASSRMLLQWLEDGRPQAQETQVVAQL
                     KDITRQYKLAQASYADRQTAAYYTQDGFLRVLTPAQDGWFFGYRDSGQERMLNVFTEA
                     NGEVKLFINYQQPNGRGLVGLAKSLDDMVRLLSSFKIEETGFVYLVDAKGEVKLHPDT
                     SQIGKSNLSNLYKDANSSALLNRGDFNLINTKINGENMLVASSYIASMDWYLVAQVPE
                     AEVFALLTEAAYQILIWTLLIAAGFIVLAIVVAGSVSRPIAQVAAMFRDIGEGEGDLR
                     QRLPVNGEDEIAQLAKGFNSFISKIQDSVIEVAQTSEQLGFSAKDVSNQAQQTLEDSH
                     EQKDRTMMVVTAINEMGATVNEIASNAAQAAVAARDADTEASSGQVVVTRARDTINQL
                     SKDVGQVGEVIESLATHTKSIGGILDVIRAISEQTNLLALNAAIEAARAGEAGRGFAV
                     VADEVRNLASRTAASTNEVQGMIDKLQSEASRAVNAMAQSRTRSHEGVVAVDEASKSL
                     IGISDRIGLISDMNIQVAAATEEQSTVVEDINRNVTEINDITQRTANTAQAAAQASLA
                     LNQLSHRLDTLVAKFKV"
     misc_feature    complement(319054..>319221)
                     /locus_tag="Sbal_0282"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    complement(318646..318795)
                     /locus_tag="Sbal_0282"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(318652..318657,318664..318669,
                     318673..318678,318685..318690,318694..318699,
                     318751..318753,318757..318762,318769..318774,
                     318778..318783,318790..318795))
                     /locus_tag="Sbal_0282"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(317809..318594)
                     /locus_tag="Sbal_0282"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(317914..318513)
                     /locus_tag="Sbal_0282"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(317917..317922,317929..317931,
                     317938..317943,317950..317952,317959..317964,
                     317968..317973,317980..317985,317989..317994,
                     318001..318003,318010..318015,318022..318024,
                     318031..318036,318043..318048,318052..318057,
                     318064..318066,318073..318078,318085..318087,
                     318094..318099,318136..318141,318148..318153,
                     318157..318162,318169..318174,318181..318183,
                     318190..318195,318202..318204,318211..318213,
                     318223..318225,318244..318246,318253..318255,
                     318265..318267,318274..318279,318286..318288,
                     318295..318297,318304..318309,318316..318321,
                     318328..318330,318337..318342,318346..318348,
                     318358..318363,318367..318372,318379..318381,
                     318388..318393,318400..318405,318412..318414,
                     318421..318426,318433..318435,318442..318447,
                     318451..318456,318463..318465,318472..318477,
                     318484..318489))
                     /locus_tag="Sbal_0282"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(318178..318279)
                     /locus_tag="Sbal_0282"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(320077..321726)
                     /locus_tag="Sbal_0283"
                     /db_xref="GeneID:4845103"
     CDS             complement(320077..321726)
                     /locus_tag="Sbal_0283"
                     /EC_number="1.5.5.1"
                     /note="PFAM: FAD dependent oxidoreductase; electron
                     transfer flavoprotein-ubiquinone oxidoreductase;
                     KEGG: shn:Shewana3_0273 electron transfer
                     flavoprotein-ubiquinone oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="electron-transferring-flavoprotein
                     dehydrogenase"
                     /protein_id="YP_001048685.1"
                     /db_xref="GI:126172536"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4845103"
                     /translation="MERESMEFDVVIVGAGPAGLATACRLMQISQDSGKEITVCVVEK
                     GSEVGAHILSGAVFEPKVLDELFSDWREKDAPVKTAVTHDEIYLLSSATDGRVMPNAF
                     VPKTMHNDGNFIISVGNLSRWLANRAEELGVEIFPGFAASELLFNVDNSVKGILIGDM
                     GVGADGEPKDSFMPGMELHAKYTVFSEGCRGHLGKQLIEKYHLDNGKTPQHYGLGFKE
                     IWKVPAEQHEQGKVVHTGGWPLTEGASGGGFLYHMEDNQIAVGLIIDLNYKNPHLSPF
                     DEFQRYKTHPVIAKYLTGGERLSYGARAITKGGLNSLPKMSFPGGLIIGCNAGTLNFA
                     KIKGTHTAMKSGIVAAETLGKAMMAGVEGGKDLDCYQTHIEESWLHEELHKSRNFGPA
                     MHKFGTYLGGAFNYIDQNWFGGKFPITLRDEHPDYAQMASVSAYSKIDYPKPDGKLSF
                     DKLSSVYLSSTYHEEDQPCHLRLKDSSIPLGINLTQFNEPAQRYCPAGVYEIVEEAGQ
                     PKFVINAQNCIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
     misc_feature    complement(320338..321714)
                     /locus_tag="Sbal_0283"
                     /note="Dehydrogenases (flavoproteins) [Energy production
                     and conversion]; Region: FixC; COG0644"
                     /db_xref="CDD:223717"
     misc_feature    complement(320548..321708)
                     /locus_tag="Sbal_0283"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(320212..320538)
                     /locus_tag="Sbal_0283"
                     /note="Electron transfer flavoprotein-ubiquinone
                     oxidoreductase; Region: ETF_QO; pfam05187"
                     /db_xref="CDD:218485"
     misc_feature    complement(320155..320253)
                     /locus_tag="Sbal_0283"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     gene            322062..323075
                     /gene="moaA"
                     /locus_tag="Sbal_0284"
                     /db_xref="GeneID:4844780"
     CDS             322062..323075
                     /gene="moaA"
                     /locus_tag="Sbal_0284"
                     /note="together with moaC, is involved in the conversion
                     of a guanosine derivative (GXP) into molybdopterin
                     precursor Z"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="YP_001048686.1"
                     /db_xref="GI:126172537"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010505"
                     /db_xref="InterPro:IPR013483"
                     /db_xref="GeneID:4844780"
                     /translation="MLSPPTLGKVIMSQLQDSFGRKFHYLRMSVTDVCNFKCSYCLPD
                     GYHPDGKPKFLSLNEIANLVSAFSQVGTQKIRITGGEPTLRKDFTDIIRVVADNPRIH
                     TIATTTNGYRLEKHAKEWFDAGLRRINVSVDSLDPKMFYQITGENKFDEVMRGIDAAL
                     SAGFERVKINAVLLKGLNDKDLPRFLHWIKNTPIDLRFIELMETGLGREYFEAHHLAG
                     ADIKAQLLADGWQLDTPSADDGPAQNFSRSDYQGRIGLIMPYATNFCASCNRLRVSAK
                     GKLHLCLFTESGVDLRDLLQHSSQQAELIERLHGQLAQKKATHYLHQGITGVTQHLAS
                     IGG"
     misc_feature    322083..323072
                     /gene="moaA"
                     /locus_tag="Sbal_0284"
                     /note="molybdenum cofactor biosynthesis protein A;
                     Reviewed; Region: moaA; PRK00164"
                     /db_xref="CDD:234672"
     misc_feature    322143..322724
                     /gene="moaA"
                     /locus_tag="Sbal_0284"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(322161..322163,322167..322169,322173..322175,
                     322179..322187,322293..322295,322299..322304,
                     322380..322388,322452..322454,322575..322577,
                     322659..322664)
                     /gene="moaA"
                     /locus_tag="Sbal_0284"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    322641..323021
                     /gene="moaA"
                     /locus_tag="Sbal_0284"
                     /note="Molybdenum Cofactor Synthesis C; Region:
                     Mob_synth_C; pfam06463"
                     /db_xref="CDD:115139"
     gene            323172..323648
                     /gene="moaC"
                     /locus_tag="Sbal_0285"
                     /db_xref="GeneID:4842031"
     CDS             323172..323648
                     /gene="moaC"
                     /locus_tag="Sbal_0285"
                     /note="MoaC; along with MoaA is involved in conversion of
                     a guanosine derivative into molybdopterin precursor Z;
                     involved in molybdenum cofactor biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaC"
                     /protein_id="YP_001048687.1"
                     /db_xref="GI:126172538"
                     /db_xref="InterPro:IPR002820"
                     /db_xref="GeneID:4842031"
                     /translation="MSNVFTHINADGNAHMVDVTEKAVTEREARAEAFIEMASTTLEM
                     IMSGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVDLEAQPEHNRVRITS
                     LCKLSGKTGVEMEALTAASVAALTIYDMCKAVQKDMVISQVRLLEKRGGKSGHFKV"
     misc_feature    323217..323636
                     /gene="moaC"
                     /locus_tag="Sbal_0285"
                     /note="MoaC family, prokaryotic and eukaryotic. Members of
                     this family are involved in molybdenum cofactor (Moco)
                     biosynthesis, an essential cofactor of a diverse group of
                     redox enzymes. MoaC, a small hexameric protein, converts,
                     together with MoaA, a guanosine...; Region: MoaC_PE;
                     cd01420"
                     /db_xref="CDD:238708"
     misc_feature    order(323217..323228,323331..323408,323415..323435,
                     323589..323624)
                     /gene="moaC"
                     /locus_tag="Sbal_0285"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238708"
     misc_feature    order(323325..323333,323379..323393,323574..323582)
                     /gene="moaC"
                     /locus_tag="Sbal_0285"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238708"
     misc_feature    order(323325..323327,323373..323375,323394..323396,
                     323400..323405,323499..323501,323508..323516,
                     323523..323525,323556..323558,323565..323567)
                     /gene="moaC"
                     /locus_tag="Sbal_0285"
                     /note="putative active site [active]"
                     /db_xref="CDD:238708"
     gene            323765..324016
                     /locus_tag="Sbal_0286"
                     /db_xref="GeneID:4845570"
     CDS             323765..324016
                     /locus_tag="Sbal_0286"
                     /note="TIGRFAM: molybdopterin converting factor, subunit
                     1;
                     PFAM: thiamineS protein;
                     KEGG: son:SO4450 molybdenum cofactor biosynthesis protein
                     D"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin converting factor subunit 1"
                     /protein_id="YP_001048688.1"
                     /db_xref="GI:126172539"
                     /db_xref="InterPro:IPR003749"
                     /db_xref="InterPro:IPR010034"
                     /db_xref="GeneID:4845570"
                     /translation="MINVLFFAQVRELLGTAKLSLEASEQTQTAEALRATLAATDDKW
                     AKVLTSDKLLVAVNQTISQWDTPVNDGDEVAFFPPVTGG"
     misc_feature    323768..324013
                     /locus_tag="Sbal_0286"
                     /note="Ubiquitin domain of MoaD-like proteins; Region:
                     MoaD; cd00754"
                     /db_xref="CDD:176354"
     misc_feature    order(323783..323791,323795..323800,323936..323938,
                     323981..323983,323996..324004,324011..324013)
                     /locus_tag="Sbal_0286"
                     /note="MoaE interaction surface [polypeptide binding];
                     other site"
                     /db_xref="CDD:176354"
     misc_feature    order(323783..323788,323795..323800,323996..323998,
                     324002..324004,324011..324013)
                     /locus_tag="Sbal_0286"
                     /note="MoeB interaction surface [polypeptide binding];
                     other site"
                     /db_xref="CDD:176354"
     misc_feature    324011..324013
                     /locus_tag="Sbal_0286"
                     /note="thiocarboxylated glycine; other site"
                     /db_xref="CDD:176354"
     gene            324018..324485
                     /locus_tag="Sbal_0287"
                     /db_xref="GeneID:4845571"
     CDS             324018..324485
                     /locus_tag="Sbal_0287"
                     /note="PFAM: molybdopterin biosynthesis MoaE;
                     KEGG: she:Shewmr4_0276 molybdopterin biosynthesis MoaE"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoaE"
                     /protein_id="YP_001048689.1"
                     /db_xref="GI:126172540"
                     /db_xref="InterPro:IPR003448"
                     /db_xref="GeneID:4845571"
                     /translation="MRLLPAVRVQEVDFSVTDEYRQLAQDDSDGAVVTFVGKVRDFND
                     GAAVTDLTLEHYPGMTEAVLEQIVVEARSRWPLNKVTVIHRVGTMALGEQIVFIGVTS
                     AHRKAAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAKLWQHKD"
     misc_feature    324057..324431
                     /locus_tag="Sbal_0287"
                     /note="MoaE family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (Moco), an
                     essential cofactor for a diverse group of redox enzymes.
                     Moco biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoaE;
                     cd00756"
                     /db_xref="CDD:238385"
     misc_feature    order(324075..324077,324090..324092,324105..324107,
                     324111..324125,324129..324131,324135..324137,
                     324297..324299,324324..324326,324330..324332,
                     324354..324356,324366..324368)
                     /locus_tag="Sbal_0287"
                     /note="MoaE homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238385"
     misc_feature    order(324177..324179,324183..324185,324192..324194,
                     324201..324203,324213..324215,324267..324269,
                     324375..324380,324384..324386,324390..324398,
                     324426..324428)
                     /locus_tag="Sbal_0287"
                     /note="MoaD interaction [polypeptide binding]; other site"
                     /db_xref="CDD:238385"
     misc_feature    order(324375..324377,324396..324398)
                     /locus_tag="Sbal_0287"
                     /note="active site residues [active]"
                     /db_xref="CDD:238385"
     gene            324563..325363
                     /locus_tag="Sbal_0288"
                     /db_xref="GeneID:4845424"
     CDS             324563..325363
                     /locus_tag="Sbal_0288"
                     /note="TIGRFAM: molybdenum ABC transporter, periplasmic
                     molybdate-binding protein;
                     KEGG: she:Shewmr4_0277 molybdenum ABC transporter,
                     periplasmic molybdate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter periplasmic
                     molybdate-binding protein"
                     /protein_id="YP_001048690.1"
                     /db_xref="GI:126172541"
                     /db_xref="InterPro:IPR005950"
                     /db_xref="InterPro:IPR011587"
                     /db_xref="GeneID:4845424"
                     /translation="MQSLTRFFHALGFALLFCLAVVPSTSRAADNAPIPAIAAAANIK
                     FALDDIVKNFTAETGLKVRVSYGSSGNFVAQIQHGAPFEMLQSADERYIAELNKVGFT
                     QGEGVQYAVGRLALVAPKNSPLALDIELNGLKALLTAGQLERFAIANPDHAPYGERAR
                     ELLKKLGLWDELQTKLILGENASQAAQFAISGSTQGGIIPLSLAIAPQFQALGHYLAL
                     PSDLHGPLNQRMALMPKASSTAERFYQYLQSDAARAVFTQYGFGLPVS"
     misc_feature    324692..325345
                     /locus_tag="Sbal_0288"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_11; pfam13531"
                     /db_xref="CDD:257850"
     gene            325372..326052
                     /locus_tag="Sbal_0289"
                     /db_xref="GeneID:4844019"
     CDS             325372..326052
                     /locus_tag="Sbal_0289"
                     /note="TIGRFAM: molybdate ABC transporter, inner membrane
                     subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: shm:Shewmr7_3743 molybdate ABC transporter, inner
                     membrane subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_001048691.1"
                     /db_xref="GI:126172542"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR011867"
                     /db_xref="GeneID:4844019"
                     /translation="MDWQALWLSVKLSSITVLVLIPLAILAGRALAYRQFVGKSWVEA
                     LIMVPLVLPPTVIGYYLLVGLGSQSWLGQWIEQLTGQQLVFHFSGLVIASVFVNIPFA
                     VQPIQRAFEAVPNDVRDAAACCGMSRLKILLKIELPMVWPGVLTALVLCFSHVLGEFG
                     VVLMMGGNIAGETKTISISIYDSVQAFDFNAAGTMSLVLLLFAVTALALTTSLSRRLG
                     GQRGANHR"
     misc_feature    <325378..326028
                     /locus_tag="Sbal_0289"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    325387..325983
                     /locus_tag="Sbal_0289"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(325435..325440,325447..325452,325465..325467,
                     325495..325506,325510..325539,325546..325551,
                     325555..325557,325654..325659,325666..325668,
                     325672..325674,325681..325686,325690..325692,
                     325702..325707,325714..325716,325765..325767,
                     325807..325812,325819..325821,325840..325851,
                     325858..325863,325900..325905,325933..325938,
                     325945..325950,325954..325959,325966..325971,
                     325978..325983)
                     /locus_tag="Sbal_0289"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(325513..325557,325840..325857)
                     /locus_tag="Sbal_0289"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(325555..325557,325639..325641,325858..325860,
                     325894..325896,325903..325905,325933..325935)
                     /locus_tag="Sbal_0289"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(325717..325755,325771..325776,325786..325788)
                     /locus_tag="Sbal_0289"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            326033..327136
                     /locus_tag="Sbal_0290"
                     /db_xref="GeneID:4842558"
     CDS             326033..327136
                     /locus_tag="Sbal_0290"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: shn:Shewana3_0280 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001048692.1"
                     /db_xref="GI:126172543"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4842558"
                     /translation="MAQIIADLQCQIQNHKHIKLNADFRCKAGEVLAVVGPSGGGKTT
                     LLRMIAGLNHPDTGQIYFGERPWFDDKALIALSPQQRHIGYMPQHFGLFPNLTALENV
                     VAGLDHIPKSERIVRAKDWLERVNLQGLPDRLPAHLSGGQRQRVALARALAREPSVLL
                     LDEPFSAVDRETRERLYLELARLKEQLLCPVIMVTHDLNEALLLADSMILISQGKMLQ
                     QGAPFEVLSRPRNEAVARQMGLRNIFDGEVVFQDSTKDLTWLKFGEQLIACDYGKDRA
                     VGSKVRWVIPNQGIRFNSISNGRLCRSFNKLDVTIDAMLVMGESVRLICYVTGTQLQL
                     NTEVSLHFAQKLALTKGMQTTVALKSEQIHILE"
     misc_feature    326078..326692
                     /locus_tag="Sbal_0290"
                     /note="ATP-binding cassette domain of the carbohydrate and
                     solute transporters-like; Region: ABC_Carb_Solutes_like;
                     cd03259"
                     /db_xref="CDD:213226"
     misc_feature    326093..327133
                     /locus_tag="Sbal_0290"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    326138..326161
                     /locus_tag="Sbal_0290"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    order(326147..326152,326156..326164,326294..326296,
                     326516..326521,326618..326620)
                     /locus_tag="Sbal_0290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213226"
     misc_feature    326285..326296
                     /locus_tag="Sbal_0290"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213226"
     misc_feature    326444..326473
                     /locus_tag="Sbal_0290"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213226"
     misc_feature    326504..326521
                     /locus_tag="Sbal_0290"
                     /note="Walker B; other site"
                     /db_xref="CDD:213226"
     misc_feature    326528..326539
                     /locus_tag="Sbal_0290"
                     /note="D-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    326606..326626
                     /locus_tag="Sbal_0290"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213226"
     gene            complement(327151..327312)
                     /locus_tag="Sbal_0291"
                     /db_xref="GeneID:4842618"
     CDS             complement(327151..327312)
                     /locus_tag="Sbal_0291"
                     /note="KEGG: son:SO4430 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048693.1"
                     /db_xref="GI:126172544"
                     /db_xref="GeneID:4842618"
                     /translation="MKPVTRWISLSLLLVAAFSAYAYGSSTSALVFIILGMLLEGTFW
                     IGLLGKKRH"
     gene            327806..328327
                     /locus_tag="Sbal_0292"
                     /db_xref="GeneID:4843056"
     CDS             327806..328327
                     /locus_tag="Sbal_0292"
                     /note="KEGG: shn:Shewana3_0281 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048694.1"
                     /db_xref="GI:126172545"
                     /db_xref="GeneID:4843056"
                     /translation="MRLWLLGFMLVSGVATATQSMYSMFAGGDYVPPLSVMQQIEKGF
                     SGVIAEFNMEEQEGELVYQFELINPLANSITRFEYRARDGKLLKQKASKVSADDLGEV
                     EATRLIAAKDQTFSGLIAKATKDHKAFLTEAKLDHDLGISYLELKLLDDTGKFKLAFD
                     VENLRPLPLLKWD"
     gene            328388..329065
                     /locus_tag="Sbal_0293"
                     /db_xref="GeneID:4845611"
     CDS             328388..329065
                     /locus_tag="Sbal_0293"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     KEGG: shn:Shewana3_0282 two component transcriptional
                     regulator, winged helix family"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001048695.1"
                     /db_xref="GI:126172546"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:4845611"
                     /translation="MKILLVEDDATTIDYIVKGFLEQGHNIETASDGHQGLSLATSSQ
                     YDLVILDRMLPQLDGLKLLAALRATGNQTPVLILSALAHVDERVKGLRAGGDDYMTKP
                     FAFSELLVRAEKLMHRGQSVPVTTDLVVGGLKMELLTRNVTLDGQELMLQPKEFQLLK
                     YLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAG
                     YRLRQRH"
     misc_feature    328388..329062
                     /locus_tag="Sbal_0293"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    328397..328735
                     /locus_tag="Sbal_0293"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(328406..328411,328538..328540,328562..328564,
                     328622..328624,328679..328681,328688..328693)
                     /locus_tag="Sbal_0293"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    328538..328540
                     /locus_tag="Sbal_0293"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(328547..328552,328556..328564)
                     /locus_tag="Sbal_0293"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    328688..328696
                     /locus_tag="Sbal_0293"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    328769..329050
                     /locus_tag="Sbal_0293"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(328841..328843,328898..328903,328955..328957,
                     328964..328966,328988..328993,329024..329026,
                     329039..329041)
                     /locus_tag="Sbal_0293"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            329115..330371
                     /locus_tag="Sbal_0294"
                     /db_xref="GeneID:4842444"
     CDS             329115..330371
                     /locus_tag="Sbal_0294"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase, HAMP region domain
                     protein; histidine kinase A domain protein domain protein;
                     KEGG: son:SO4427 sensor histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_001048696.1"
                     /db_xref="GI:126172547"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4842444"
                     /translation="MTVIIGALLFALYRQLIIEQQYQVTQYLESETQRYQQLALTVDR
                     RSFAAQIRAADPQTALIAWRNSYDMVGALSFMPEGMPMLPQTRDFPILTGGPDKLHIL
                     TGGLVMTRYGPVLIATRTDNLATLIDKFISAAATAVMLTIVLTLALGYLFSKAILRRL
                     VQYNRLSEQIERGHYDTRLPLSWRQDEFDMLALQFNNVLDILENNLMAVRGATDNIAH
                     DLRTPLSHIRIGLEELASKPSDEISEGCAILTEELDHCLATFDAMLSLTRIEEGQQTL
                     DLQELSLAQLCTDLLDMADAVAESNEQTLSLSLLADHKVFGDKYLLFQALYNLVDNAM
                     KYSGQGARIEIIQSGPQIQIRDNGPGIPDDSKERVFERLVRLDPSRHLQGTGLGLSMV
                     KAILSRHNAKINLTDNHPGLVVTIKF"
     misc_feature    329454..330368
                     /locus_tag="Sbal_0294"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    329580..329723
                     /locus_tag="Sbal_0294"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(329580..329585,329592..329597,329601..329606,
                     329613..329618,329622..329624,329673..329678,
                     329682..329687,329694..329699,329703..329708,
                     329715..329720)
                     /locus_tag="Sbal_0294"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    329757..329918
                     /locus_tag="Sbal_0294"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(329760..329762,329772..329774,329781..329783,
                     329793..329795,329802..329804,329847..329849,
                     329859..329861,329868..329870,329880..329882,
                     329889..329891,329901..329903)
                     /locus_tag="Sbal_0294"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    329766..329768
                     /locus_tag="Sbal_0294"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    330078..330368
                     /locus_tag="Sbal_0294"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(330096..330098,330108..330110,330117..330119,
                     330174..330176,330180..330182,330186..330188,
                     330192..330197,330270..330281,330327..330329,
                     330333..330335,330345..330350,330354..330356)
                     /locus_tag="Sbal_0294"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    330108..330110
                     /locus_tag="Sbal_0294"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(330186..330188,330192..330194,330270..330272,
                     330276..330278)
                     /locus_tag="Sbal_0294"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            330405..331097
                     /locus_tag="Sbal_0295"
                     /db_xref="GeneID:4842445"
     CDS             330405..331097
                     /locus_tag="Sbal_0295"
                     /note="TIGRFAM: pseudouridine synthase Rlu family protein,
                     TIGR01621;
                     PFAM: pseudouridine synthase;
                     KEGG: shn:Shewana3_0284 pseudouridine synthase Rlu family
                     protein, TIGR01621"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase Rlu family protein"
                     /protein_id="YP_001048697.1"
                     /db_xref="GI:126172548"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006508"
                     /db_xref="GeneID:4842445"
                     /translation="MYRIIADEADFIVISKSAKVHFHSQDGTAGVVAQAEQDLGIKLF
                     AVHRLDTPTSGLLILAKSAVAAKQFTELFTAHKVQKYYLALAKGKPKKKQGWVIGDMA
                     KSRRSMFKLLRTKENPAITQFFSLSVSEGLRLYLLKPHSGKTHQLRVALASLGVPILG
                     DDLYGGMAADRCYLHAYCLHFRYGDEATGWRDYAYRDVPTQGEHFAAEGVIEALVEWF
                     EPNTLAWPAKGD"
     misc_feature    <330423..330950
                     /locus_tag="Sbal_0295"
                     /note="Pseudouridylate synthases, 23S RNA-specific
                     [Translation, ribosomal structure and biogenesis]; Region:
                     RluA; COG0564"
                     /db_xref="CDD:223638"
     misc_feature    330435..330947
                     /locus_tag="Sbal_0295"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    order(330543..330554,330846..330848)
                     /locus_tag="Sbal_0295"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            complement(331125..332294)
                     /locus_tag="Sbal_0296"
                     /db_xref="GeneID:4845160"
     CDS             complement(331125..332294)
                     /locus_tag="Sbal_0296"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein;
                     KEGG: son:SO4425 GGDEF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_001048698.1"
                     /db_xref="GI:126172549"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="GeneID:4845160"
                     /translation="MIFDPQALLLIKFICLLASTAAVAWGLIAKPLQIATQASMRFSL
                     ANLFVLLGIILNSQRSEASSYLFWFCSDMAILFGFILLRWGTKALFRLSPSVKSDLFL
                     LAITASVMLSVPPNFSSERTLAVVFSACAALIFTMLTRDNYQAIKRDTGNRVAIAMVM
                     PLVAMVGIFIIRIFIALLSPEESPMFIAMHTHEAIPVLWFYVFLTLLINIVMIGNAMT
                     RLVSKIRMLAERDQLTGLWNRRAMHKFLNNIHQRWLRDNVPYSMILLDLDHFKEINDQ
                     YGHDAGDLALLTAARLFGSVLRENDALCRHGGEEFLVILPATDAPAARAVAEKLHQVL
                     KDNSFIWQGVTIKIHASLGYATIYQGCQPDKLLIQADQAMYRAKSEGRDRICQAC"
     misc_feature    complement(331137..331607)
                     /locus_tag="Sbal_0296"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(331368..331370,331497..331499))
                     /locus_tag="Sbal_0296"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(331365..331376,331380..331382,
                     331446..331448,331458..331460,331470..331475,
                     331482..331484))
                     /locus_tag="Sbal_0296"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(331308..331310,331392..331394))
                     /locus_tag="Sbal_0296"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            332558..332725
                     /locus_tag="Sbal_0297"
                     /db_xref="GeneID:4843057"
     CDS             332558..332725
                     /locus_tag="Sbal_0297"
                     /note="PFAM: protein of unknown function UPF0057;
                     KEGG: shn:Shewana3_0285 protein of unknown function
                     UPF0057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048699.1"
                     /db_xref="GI:126172550"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="GeneID:4843057"
                     /translation="MDTNKLLLVIIAILLPPVAVFLKAGAGKDLLINIVLCLLFWFPG
                     LLHALWVVTKA"
     misc_feature    <332603..332719
                     /locus_tag="Sbal_0297"
                     /note="Proteolipid membrane potential modulator; Region:
                     Pmp3; pfam01679"
                     /db_xref="CDD:250793"
     gene            complement(332798..334975)
                     /locus_tag="Sbal_0298"
                     /db_xref="GeneID:4843854"
     CDS             complement(332798..334975)
                     /locus_tag="Sbal_0298"
                     /note="PFAM: TonB-dependent receptor; TonB-dependent
                     receptor, plug;
                     KEGG: she:Shewmr4_0286 TonB-dependent receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_001048700.1"
                     /db_xref="GI:126172551"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:4843854"
                     /translation="MTFKTSFVALAVFAALSQSAAAQDAPDSSSNNKNKDIEKITVTA
                     SRMDKSPSSIPNTVTIIDRAQLEEQFRTTKDLSTIIGNLAPSFSPSRQKMSNTGETLR
                     GRPPLIMIDGVPQSNPLRSGGRSGQTIDPAMIERIEIIHGANAMHGLGAQGGIINYIT
                     KKPTGDSEQVASFDVTVPDSMKSNGLSFGASYAFSGESEFIDMIGSVSYRNNGVYYDA
                     NHNVVGVDTTQGESMDSQSTDFFIKLGHNFDESRLELMVNHYTADNNGDWMPVAGDKP
                     NGVPTGAVKETQPWEAANNQVTTTSLTYTHANIGGQQLNLQLFNQDFKAVYGGGCFDS
                     FYDPSFEGSDQVIQCGVGSKGESLYYEQSRNASVKWGLKSSLIAKDIAGSGIDAAYGV
                     DLFRDTTEQDLVKTGFSWVPESTYDNVAPYLQLDYDLIENLTLSTGVRYEHAELSVDD
                     YKTLWGAGNKQIAGGSATFDETLFNVGISYKITPDIRVYTSYNQGFGMPDIGRILRDG
                     KSFPGDNPNIDDSLALTPIVTDNVEVGADYQGKYLSAKFAYYRSATDFGSRLALNGDG
                     FYDVKREKSMIEGIEANVTAYLTSNDDLGMNIAIQQGEYDSNGDNKVDTDLDGANISP
                     NRINLFWTHNFDNDMSTRVQANYYMDRDFKNAAGNKYAEFDGYTTVDASFSMPLYTGT
                     LSLGLQNLFNKDYFNYYSQTMGTNDRYFKGMGRTATIGYTLPF"
     misc_feature    complement(332801..334864)
                     /locus_tag="Sbal_0298"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    complement(332801..334807)
                     /locus_tag="Sbal_0298"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(334496..334522,334553..334585,
                     334631..334654,334664..334681,334712..334741,
                     334778..334807))
                     /locus_tag="Sbal_0298"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(333893..333895,333980..333982))
                     /locus_tag="Sbal_0298"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            335369..335605
                     /locus_tag="Sbal_0299"
                     /db_xref="GeneID:4842522"
     CDS             335369..335605
                     /locus_tag="Sbal_0299"
                     /note="KEGG: shm:Shewmr7_3732 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048701.1"
                     /db_xref="GI:126172552"
                     /db_xref="GeneID:4842522"
                     /translation="MSGVQVEGYNRAPLSRIRIGALMNRKKKINQTLKSKAKKANAKL
                     QSSNKPKYIAKADREASAAVADTESYTVDSVIVV"
     misc_feature    335435..335566
                     /locus_tag="Sbal_0299"
                     /note="Protein of unknown function (DUF2986); Region:
                     DUF2986; pfam11661"
                     /db_xref="CDD:256543"
     gene            complement(335664..336176)
                     /locus_tag="Sbal_0300"
                     /db_xref="GeneID:4841511"
     CDS             complement(335664..336176)
                     /locus_tag="Sbal_0300"
                     /note="PFAM: peptidase M23B;
                     KEGG: son:SO4420 peptidase, M23/M37 family"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23B"
                     /protein_id="YP_001048702.1"
                     /db_xref="GI:126172553"
                     /db_xref="InterPro:IPR002886"
                     /db_xref="GeneID:4841511"
                     /translation="MKLTYVGLALSLLLLGGYLIPESPVIPVKGASSKDWNSQTFWYE
                     PWGPSGVHKGIDIFAAKNTAMIAPTPMLIFYRGDFFKGGNVVVGLGPKWQIHYFAHLA
                     QIESATGLIAYQGETLGTVGDTGNAQGKPPHLHYSILSLLPKPWLIDTSTQGYKKAFY
                     QNPISYLEAR"
     misc_feature    complement(335763..>336107)
                     /locus_tag="Sbal_0300"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(335763..336029)
                     /locus_tag="Sbal_0300"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(336216..336818)
                     /locus_tag="Sbal_0301"
                     /db_xref="GeneID:4843415"
     CDS             complement(336216..336818)
                     /locus_tag="Sbal_0301"
                     /note="KEGG: shn:Shewana3_0289 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048703.1"
                     /db_xref="GI:126172554"
                     /db_xref="GeneID:4843415"
                     /translation="MVALMSVLTWLKKHLHSAFHGNSTLERQADLAAIFHPAQMPDID
                     LPTNQAYPLVTPILQADIYAYQVHGLLTLEGKQTLDTLIGNAGFAVLPEHAASFNGLL
                     THRSRATSLQLNQYADFAGICVSLISNDKALLEQLIAFKSTLPHPWESFPDVDPDTLG
                     SLQGNIDFWCNYFWRPYWLSLSAAERLQYPVNWQEFSDFH"
     gene            complement(337294..338637)
                     /locus_tag="Sbal_0302"
                     /db_xref="GeneID:4845144"
     CDS             complement(337294..338637)
                     /locus_tag="Sbal_0302"
                     /note="functions in anaerobic transport of
                     C4-dicarboxylate compounds such as fumarate; similar to
                     DcuA; DcuA and DcuB function as independent and mutually
                     redundant C4-dicarboxylate (aspartate, malate, fumarate
                     and succinate) transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter"
                     /protein_id="YP_001048704.1"
                     /db_xref="GI:126172555"
                     /db_xref="InterPro:IPR004668"
                     /db_xref="GeneID:4845144"
                     /translation="MILMEFIVVLSCLLLGTRYGGMGLGLISGIGLFLLIFVFGLAPG
                     QPPVQVMLTILAVIGCAAVLQTAGGLDVMMQFAERLLRRHPQYITILAPLTTWTLTFL
                     CGTGHVVYTMFPIISDIALKKNIRPERPMAVASVASQMAICASPVSVAVVSMVSILAS
                     QQGVGRAYNLLEILMVSVPASLCGVMAAALWSLRRGKDLDKDEEFQERIQDPVQRAFI
                     YDKSETLLNQRFPKEAYWATGIFFAAIAAVVLLGSFSELRPAFEVKGKTTLLSMNLVI
                     QMMMLIAGAFILMTCKVKPTNISNGPVFKAGMVAIFSVFGVAWMSDTFFISHMDVLKE
                     NLSHVVQSQPWTYALVLFLISKLVNSQAAALTAIAPMGLALGVDPKLLIAFLPASYGY
                     FVLPTYPSDLACIGFDRSGTTKIGKFIINHSFIIPGFIGVGTASTVGYLLATALL"
     misc_feature    complement(337297..338637)
                     /locus_tag="Sbal_0302"
                     /note="anaerobic C4-dicarboxylate transporter; Reviewed;
                     Region: PRK12489"
                     /db_xref="CDD:237115"
     gene            338903..340081
                     /locus_tag="Sbal_0303"
                     /db_xref="GeneID:4845145"
     CDS             338903..340081
                     /locus_tag="Sbal_0303"
                     /note="KEGG: son:SO4414 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048705.1"
                     /db_xref="GI:126172556"
                     /db_xref="GeneID:4845145"
                     /translation="MKPATFNTEAFDDWIRSRFVELNSELEQLYYQQTDRANVLDIGA
                     EAKLALESEGRELITALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPSRETTS
                     PLAEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPAEKLFVDYNTKGI
                     LAYKRAADALLKIQPLGISHPICHDLLRVAKQALQDVIESNTQLFNRLDTDRFFYCVR
                     PYYKPYRVGSVIYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQ
                     ILRECMRRPNLMDDFLQAKDSANQTWYQENLRLFIEVCELHGETAIQHHNELVTKYIA
                     EPSTSMEQQHLAKVTASGPPLHVLLGSLERLRDRRAAAQRSDIRTRYYEIKKLKESLR
                     "
     misc_feature    338915..340075
                     /locus_tag="Sbal_0303"
                     /note="Domain of unknown function (DUF1864); Region:
                     DUF1864; pfam08933"
                     /db_xref="CDD:255115"
     gene            340086..341207
                     /locus_tag="Sbal_0304"
                     /db_xref="GeneID:4844026"
     CDS             340086..341207
                     /locus_tag="Sbal_0304"
                     /note="PFAM: aminotransferase, class V;
                     KEGG: shn:Shewana3_0295 aminotransferase, class V"
                     /codon_start=1
                     /transl_table=11
                     /product="class V aminotransferase"
                     /protein_id="YP_001048706.1"
                     /db_xref="GI:126172557"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="GeneID:4844026"
                     /translation="MFEDFKKDFYLAGPGYLLNHSVGRPLKSTEQVFKEAFFAPWQES
                     GREPWGQWLSVIDDFTFALSKLFNGHQKDFCPQVNLSSALTKIVMSLDRLNREHAVVL
                     MSEIDFPSMGFALKKALPASCEVRFIPKGLDVTDPNVWDAHISRDVDLVFVSHAYSNT
                     GQQAPLANIFTIARERGCLSLVDVAQSAGIIPLDLARLQPDFLIGSSVKWLCGGPGAA
                     YLWVNPAILESCQPKDVGWFSHENPFEFDIHDFRYQHSAMRFWGGTPSIAPYAIAAHS
                     IHYLAGLGIPLLRKCNQQLIDAVAQELEHEFVSPRDVEKRSGTLILQFGEQQHQIMTA
                     FANANISVDARSMGIRISPHIYNNMADIKLLLDVIKANR"
     misc_feature    340089..341198
                     /locus_tag="Sbal_0304"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    order(340548..340550,340632..340634,340641..340643,
                     340701..340703,340710..340712)
                     /locus_tag="Sbal_0304"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    340710..340712
                     /locus_tag="Sbal_0304"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(341270..342466)
                     /locus_tag="Sbal_0305"
                     /db_xref="GeneID:4841601"
     CDS             complement(341270..342466)
                     /locus_tag="Sbal_0305"
                     /note="PFAM: sodium:dicarboxylate symporter;
                     KEGG: shm:Shewmr7_3722 sodium:dicarboxylate symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="YP_001048707.1"
                     /db_xref="GI:126172558"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="GeneID:4841601"
                     /translation="MWQKIKPYKDSIVLLTALLLGGVLGVGLPELALKLKPLGQIFLN
                     LLFMIIVPLVAISVTSSIARMTDLKKLGALLVSIMAVSIVMAIIPAVGIIGLALFFDP
                     AQGVTLDLNQTISDTAGTMDFVGLLTTNDFSGLLSKSNILALIIMSVIAGIAIGQSGE
                     DGRKVSALLDSFNTVIMKIVSIIMVAAPVGLGAYFASTMASQDPQLVITFARAVGLFM
                     VACFIYLTVGSTFYAWLGGGTQGVKQFWRFALEPAVTALGTTSSLATLPVTLRTALKM
                     GIKPEIADISLPLLVNLNKGGASIITALKIVFIYSLLRLDFTVDVFMVTILISVLSAF
                     IIGGVPGGAFLGEIFIVTTLGLPMETIPILVVIGAITDAPSTVINVVHDLNACQIIER
                     LNRKRL"
     misc_feature    complement(341288..342382)
                     /locus_tag="Sbal_0305"
                     /note="Sodium:dicarboxylate symporter family; Region: SDF;
                     pfam00375"
                     /db_xref="CDD:249810"
     gene            complement(342727..344136)
                     /gene="glnA"
                     /locus_tag="Sbal_0306"
                     /db_xref="GeneID:4843061"
     CDS             complement(342727..344136)
                     /gene="glnA"
                     /locus_tag="Sbal_0306"
                     /EC_number="6.3.1.2"
                     /note="forms a homododecamer; forms glutamine from ammonia
                     and glutamate with the conversion of ATP to ADP and
                     phosphate; also functions in the assimilation of ammonia;
                     highly regulated protein controlled by the
                     addition/removal of adenylyl groups by adenylyltransferase
                     from specific tyrosine residues; addition of adenylyl
                     groups results in inactivation of the enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_001048708.1"
                     /db_xref="GI:126172559"
                     /db_xref="InterPro:IPR001637"
                     /db_xref="InterPro:IPR004809"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="GeneID:4843061"
                     /translation="MSVESVLKQLEELEVKFVDLRFTDTKGKEQHVSIPSHQVDADFF
                     EDGKMFDGSSIAGWKGINESDMVLMPDPTTFVLDPFTEETTALIRCDILEPGTMTGYD
                     RDPRSIAKKAEAYLISTGIADTVLIGPEPEFFLFDDVRFGTDMSGCFVKIDAKEAAWN
                     SGTSYEGGNTGHRPFTKGGYFPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAG
                     QNEIATRFNTLTKKADEIQILKYVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLA
                     KDGVNLFAGDKYAGLSETALYYIGGIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLA
                     YSARNRSASIRIPVVPSPKGRRIEARFPDPHANPYLGFAALLMAGLDGIQNKIHPGEA
                     MDKDLYDLPPEEAAEIPQVATSLENALENLQADHEFLTKGGVFSEDFIQSYIVLKTAE
                     AERVARTTHPLEFEMYYSL"
     misc_feature    complement(342730..344136)
                     /gene="glnA"
                     /locus_tag="Sbal_0306"
                     /note="glutamine synthetase; Provisional; Region: glnA;
                     PRK09469"
                     /db_xref="CDD:181884"
     misc_feature    complement(343852..344097)
                     /gene="glnA"
                     /locus_tag="Sbal_0306"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    complement(343000..343833)
                     /gene="glnA"
                     /locus_tag="Sbal_0306"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            345142..346971
                     /locus_tag="Sbal_0307"
                     /db_xref="GeneID:4843309"
     CDS             345142..346971
                     /locus_tag="Sbal_0307"
                     /note="TIGRFAM: small GTP-binding protein; GTP-binding
                     protein TypA;
                     PFAM: elongation factor G domain protein; protein
                     synthesis factor, GTP-binding; elongation factor Tu,
                     domain 2 protein;
                     KEGG: sdn:Sden_3455 GTP-binding protein TypA"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein TypA"
                     /protein_id="YP_001048709.1"
                     /db_xref="GI:126172560"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006298"
                     /db_xref="GeneID:4843309"
                     /translation="MVRGLSVLENLRNIAIIAHVDHGKTTLVDKLLSQSGTLATRGEA
                     TERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVL
                     LLVDAVDGPMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGAT
                     DEQLDFPIVYASALNGFATLDPDVASDDMTPLFQTIVEKVSFPDADAEGSFQMQISQI
                     DYNSYVGVIGIGRIKRGSVKTNQQVTIIGADGKTRNGKMGQVLGYMGLDRTEVEIANA
                     GDIVAITGLGELKISDTICAVGAVEAMPALTVDEPTLTMTFQVNTSPFAGKEGKYVTS
                     RNILERLQTELVHNVALRVEETESPDRFRVSGRGELHLSILIENMRREGYELAVSRPE
                     VILKTIDGELCEPYETLTVDVEEEDQGTVIEKLGTRKAEMKDMQLDGKGRVRIDFIIP
                     SRGLIGFQTEFLTATSGTGLIYHSFDHYGPHKGGDIGQRANGVLISNATGKALTFALF
                     GLQDRGRLFIGHAAEVYEGQVVGIHARSNDLTVNCLKGKQLTNMRASGTDEAQVLTTP
                     ITMTLEQALEFIDDDELVEVTPKNIRVRKRHLTENDRKRFNRA"
     misc_feature    345166..346968
                     /locus_tag="Sbal_0307"
                     /note="Predicted membrane GTPase involved in stress
                     response [Signal transduction mechanisms]; Region: TypA;
                     COG1217"
                     /db_xref="CDD:224138"
     misc_feature    345169..345750
                     /locus_tag="Sbal_0307"
                     /note="Tyrosine phosphorylated protein A (TypA)/BipA
                     family belongs to ribosome-binding GTPases; Region:
                     TypA_BipA; cd01891"
                     /db_xref="CDD:206678"
     misc_feature    345193..345216
                     /locus_tag="Sbal_0307"
                     /note="G1 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(345196..345198,345202..345204,345214..345219,
                     345226..345228,345235..345240,345334..345339,
                     345391..345396,345463..345468,345574..345576,
                     345586..345588)
                     /locus_tag="Sbal_0307"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(345202..345219,345541..345546,345550..345552,
                     345655..345663)
                     /locus_tag="Sbal_0307"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206678"
     misc_feature    345301..345336
                     /locus_tag="Sbal_0307"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206678"
     misc_feature    345322..345324
                     /locus_tag="Sbal_0307"
                     /note="G2 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    345379..345390
                     /locus_tag="Sbal_0307"
                     /note="G3 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    345385..345441
                     /locus_tag="Sbal_0307"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206678"
     misc_feature    345541..345552
                     /locus_tag="Sbal_0307"
                     /note="G4 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    345655..345663
                     /locus_tag="Sbal_0307"
                     /note="G5 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    345772..346029
                     /locus_tag="Sbal_0307"
                     /note="BipA_TypA_II: domain II of BipA (also called TypA)
                     having homology to domain II of the elongation factors
                     (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein
                     with global regulatory properties in Escherichia coli.
                     BipA is phosphorylated on a...; Region: BipA_TypA_II;
                     cd03691"
                     /db_xref="CDD:239662"
     misc_feature    346351..346587
                     /locus_tag="Sbal_0307"
                     /note="BipA_TypA_C: a C-terminal portion of BipA or TypA
                     having homology to the C terminal domains of the
                     elongation factors EF-G and EF-2. A member of the ribosome
                     binding GTPase superfamily, BipA is widely distributed in
                     bacteria and plants.  BipA is a highly...; Region:
                     BipA_TypA_C; cd03710"
                     /db_xref="CDD:239681"
     gene            complement(347260..348282)
                     /locus_tag="Sbal_0308"
                     /db_xref="GeneID:4841512"
     CDS             complement(347260..348282)
                     /locus_tag="Sbal_0308"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein;
                     KEGG: son:SO4407 GGDEF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_001048710.1"
                     /db_xref="GI:126172561"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="GeneID:4841512"
                     /translation="MRPNRQQLIRSLFDEYIEMYSSRDNRLTHRFSENFSGYAGSSDL
                     LVNNRKEWMRITRQDFAQVPERIHIEMLDLSLQDLADNLVVVTAFFHIHLPIPNPMLS
                     RETARLVLIFRLEHKDWMIAHSGISIPYGLAHKGEIYPIAQLEERNVELESMIKARTC
                     ELAEANRQLEILSNTDSLTNIGNRRLFDMMLQTEWSRGQRSNSSLALIMLDIDHFKQF
                     NDHYGHLAGDDCLKQLASTLSQSGRRAGELVARYGGEEFVILLPNIDKQTVLDTAQHI
                     HQLIQAIAIPHADTDLGIVPVSAGVAYLQPSNQQNALELVRQADAALYRAKSAGRNCI
                     RVMNEK"
     misc_feature    complement(347890..348258)
                     /locus_tag="Sbal_0308"
                     /note="SnoaL-like domain; Region: SnoaL_3; pfam13474"
                     /db_xref="CDD:257798"
     misc_feature    complement(347278..347763)
                     /locus_tag="Sbal_0308"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(347518..347520,347650..347652))
                     /locus_tag="Sbal_0308"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(347515..347526,347530..347532,
                     347599..347601,347611..347613,347623..347628,
                     347635..347637))
                     /locus_tag="Sbal_0308"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(347458..347460,347542..347544))
                     /locus_tag="Sbal_0308"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(348471..350363)
                     /locus_tag="Sbal_0309"
                     /db_xref="GeneID:4841819"
     CDS             complement(348471..350363)
                     /locus_tag="Sbal_0309"
                     /note="PFAM: sulfatase;
                     KEGG: lbl:LBL_1125 alkaline phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_001048711.1"
                     /db_xref="GI:126172562"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="GeneID:4841819"
                     /translation="MKQSKFRSVLFLYISMLFILNCSRIANYIVYRDYYKETLDLLTV
                     IFTSFRFDIMTTGYVMLIPTLLILVPGSGRIATFIKGMGLKLGLIMLLLSTLALIGDF
                     IYFGVVNRHTFSDLPLLMTETSFVLPFLVKDHLALTILSFAIIILAIIFLIKKYQLFF
                     HNNQKHRTLASQISVFIIAIPVLILFLRGLNLHGKPLGIIDAYKNQSEQQANLILNGI
                     YTGGKGTTQIFKRTDYNFFSSEEIKQHLNKTEDEAYKYPFLSQFPENTPNGRNLVIIL
                     VEALSYAYIDGLSGSDYKVTPFLDELSKKAEVYDNFYAAAQRSNLGVQASLFGLPPLE
                     SVGYIGGGLELSRLTKIGNIAQAHGYQTQMLQSSKRDSIRLDSIANYAGFQQYLGRSD
                     IPITRTDYPDPDGAQFGWDYEMLMKTLELANKKTQPFISFSFTGTTHMPYVETPKHLQ
                     VYPYGQDTFTDFLNTVRYTDEALKAFFAEASKQDWYENTTFMILADHTLFNTKNPGLE
                     SAFHIPLWIYRPGQNITPKRHKILASQLDILPTAFDLLGFNDEFASVGRSLYRERKPY
                     SIVVKGDLLGAFTNSGNFLIAGDKIISESDNADFIESQAPQYAEQLKLEFQLSQQAVL
                     NNTWVK"
     misc_feature    complement(348723..349556)
                     /locus_tag="Sbal_0309"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            complement(350447..351661)
                     /locus_tag="Sbal_0310"
                     /db_xref="GeneID:4843779"
     CDS             complement(350447..351661)
                     /locus_tag="Sbal_0310"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: shm:Shewmr7_3712 4Fe-4S ferredoxin, iron-sulfur
                     binding domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_001048712.1"
                     /db_xref="GI:126172563"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4843779"
                     /translation="MTFIESLTLMLALMYLASLSYWSGQKWGAAATLLLSVGAVAISL
                     YWPLALGLIIALPLALLGHKFAPDSFKGEIKINTLRQGTQHVLALSLLLVAVQYTINT
                     ILLKQGITPWLMRPDVVDAFLPIAGGIELKAIVSLNLWDQTHPAAAVMLAAVLLTGLL
                     CKRAFCGWACPLGLAGEYLYAFRKRFIKSELTPPAWLDWPMRMLKYLLLLGLCYIVIG
                     MPAQSIPNYLEGNYHKIADLKMALFFLTPSLITLLVFALILALAAWRRQGFCRYLCPY
                     GAILGILSFASPLKIRRDSQHCLIEAKGMKCDKCSRACPANIIVHTKTTVRSDECQAC
                     MRCVAACPKSAALGLGLKSGHRLGHKGLLALVLIALFILPLGAYLAGFWHSQTPDNIR
                     MELIQVIDRVGH"
     misc_feature    complement(351098..>351187)
                     /locus_tag="Sbal_0310"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     misc_feature    complement(350780..350923)
                     /locus_tag="Sbal_0310"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     misc_feature    complement(350627..350749)
                     /locus_tag="Sbal_0310"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     misc_feature    complement(350627..>350746)
                     /locus_tag="Sbal_0310"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     gene            352029..353033
                     /locus_tag="Sbal_0311"
                     /db_xref="GeneID:4843780"
     CDS             352029..353033
                     /locus_tag="Sbal_0311"
                     /note="PFAM: 2OG-Fe(II) oxygenase;
                     KEGG: aha:AHA_1948 2OG-Fe(II) oxygenase superfamily
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="YP_001048713.1"
                     /db_xref="GI:126172564"
                     /db_xref="InterPro:IPR002283"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="GeneID:4843780"
                     /translation="MEQLPILNLSDWHAGGQSRHAFITKLADAARRIGFFYLTGHGIE
                     LARQQQVLLLARDFFALPLADKLAVKMTNTPHFRGYTRLQGELTLGKPDLREQFDIMQ
                     EETANPPRSDVPKWSQLQGPNQWPSQLPQMKTILLEWQQDLADTSVALLKALAVALEQ
                     SETAFDATIDAGPYQHMKLIRYPNANGETSGQGVGAHKDPGYLTLVLQDKQSGLEVQT
                     DEGWLSIPPLEGAFVVNIGELLELASNGYLKATYHRVTSPPAGVERYSCAFFMAAQLN
                     ATVPLLPLPEYLARQALGPASDPLNPLFHQVGQNVLKGRLRSHPDVAKAHYASFANAI
                     "
     misc_feature    352029..352994
                     /locus_tag="Sbal_0311"
                     /note="Isopenicillin N synthase and related dioxygenases
                     [General function prediction only]; Region: PcbC; COG3491"
                     /db_xref="CDD:226022"
     misc_feature    352038..352409
                     /locus_tag="Sbal_0311"
                     /note="non-haem dioxygenase in morphine synthesis
                     N-terminal; Region: DIOX_N; pfam14226"
                     /db_xref="CDD:258418"
     misc_feature    352545..352838
                     /locus_tag="Sbal_0311"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy; pfam03171"
                     /db_xref="CDD:251775"
     gene            353052..354212
                     /locus_tag="Sbal_0312"
                     /db_xref="GeneID:4845601"
     CDS             353052..354212
                     /locus_tag="Sbal_0312"
                     /EC_number="4.4.1.11"
                     /note="PFAM: Cys/Met metabolism
                     pyridoxal-phosphate-dependent enzymes;
                     KEGG: aha:AHA_1947 methionine gamma-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine gamma-lyase"
                     /protein_id="YP_001048714.1"
                     /db_xref="GI:126172565"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="GeneID:4845601"
                     /translation="MQFKTKLLHTHHTAENSTGALTTPIYQSSTFAYGSAEDGRARFA
                     GEQPGFIYSRMANPTVQALEHQLSLLEGADEALVVASGMAAISSIFYALASQGDEIAF
                     IDPVYGGTAAFLIQTLTRAGITVRRYQDDDHLLSEISPETKIILFEPITNPTLKVSDY
                     RKVKLAAERVGAITICDNTFLTPYLFKPLEHGIDIVMHSATKYLSGHGDLIAGVVAGR
                     KALMQPIRTIALKHIGAAIGPQEAYLLQRGLRTLALRMDAHLAGAAKVADFLASHPSV
                     AKVYYPGLSQDPGHQVLSETINAFGGMVSIELEGGFSRAAQFLDNLNLFTQAVSLGDL
                     ESLACHPASTTHAAMDVASRLASGVNDNLIRLSIGVEDPQDLIADLEQALAI"
     misc_feature    353106..354206
                     /locus_tag="Sbal_0312"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    order(353130..353141,353145..353150,353205..353207,
                     353211..353213,353289..353294,353298..353303,
                     353370..353372,353385..353387,353394..353396,
                     353652..353654,353676..353678,353682..353684,
                     353730..353732,353763..353765,353769..353774,
                     354009..354011)
                     /locus_tag="Sbal_0312"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    order(353292..353300,353370..353372,353493..353495,
                     353580..353582,353646..353648,353652..353657,
                     353682..353684)
                     /locus_tag="Sbal_0312"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    order(353292..353300,353370..353372,353580..353582,
                     353589..353591,353646..353648,353652..353657)
                     /locus_tag="Sbal_0312"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    353655..353657
                     /locus_tag="Sbal_0312"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            complement(354475..355128)
                     /locus_tag="Sbal_0313"
                     /db_xref="GeneID:4843992"
     CDS             complement(354475..355128)
                     /locus_tag="Sbal_0313"
                     /note="KEGG: shn:Shewana3_0309 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048715.1"
                     /db_xref="GI:126172566"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4843992"
                     /translation="MKRLITSGLIAASLLLSGCQSAYYGAMEKVGYHKRDIMVDRVKD
                     AKESQEDAQKEFSSALEEMQALLNHDGGNLEKAYNKAKDEYESAQSAADNVSNRIKKV
                     EDVAEALFDEWQDEIGEISKASLRRNSEAKLKETRRAYEQLIKSMHRAESKMPPILTA
                     MKDNMLYLKHNLNAQAIGAIKGEFASLQTDISGLIKEMNKSINESNKFIESLEKSKS"
     misc_feature    complement(354490..355089)
                     /locus_tag="Sbal_0313"
                     /note="Protein of unknown function (DUF2959); Region:
                     DUF2959; pfam11172"
                     /db_xref="CDD:151614"
     gene            complement(355158..355379)
                     /locus_tag="Sbal_0314"
                     /db_xref="GeneID:4841458"
     CDS             complement(355158..355379)
                     /locus_tag="Sbal_0314"
                     /note="KEGG: she:Shewmr4_0315 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048716.1"
                     /db_xref="GI:126172567"
                     /db_xref="GeneID:4841458"
                     /translation="MSQQGSAGNVISAIASLFFPGLGQLLQGRIMAALLFFIITVVGY
                     ALWWLIVPAVIGAIFHLWSIIDAARFKAD"
     gene            355461..356432
                     /gene="rbn"
                     /locus_tag="Sbal_0315"
                     /db_xref="GeneID:4845594"
     CDS             355461..356432
                     /gene="rbn"
                     /locus_tag="Sbal_0315"
                     /note="RNase BN; required for 3' maturation of certain
                     phage T4-encoded tRNAs; forms a dimer; specific for
                     immature tRNA substrates containing incorrect residues
                     within the universal CCA sequence; 3' to 5'
                     exoribonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease BN"
                     /protein_id="YP_001048717.1"
                     /db_xref="GI:126172568"
                     /db_xref="InterPro:IPR004664"
                     /db_xref="GeneID:4845594"
                     /translation="MTKKIELAQIRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVT
                     LLSLVPMVAVTMSMLSAFPVFKGIRGQIEGFVYENFLPAAGDTVQVYINEFVGNASKG
                     TAVGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVAFSMYWMVLTLGPVLVGASLV
                     ASSYVISLKVFEAEALSGMLPIFIARLPMLFSVAAFLLLYMVVPNQKVKFLHALLGAI
                     VAALLFELGKKGFALYVTQFPSYEAIYGALATIPIVFVWVYLSWMIVLLGAEITAAMP
                     EYLDYESSSDDETALNAKPLADASQGDSSSVLTSAEVTALKAVAKSE"
     misc_feature    355488..356342
                     /gene="rbn"
                     /locus_tag="Sbal_0315"
                     /note="hypothetical protein; Reviewed; Region: PRK01637"
                     /db_xref="CDD:179313"
     gene            356469..357422
                     /locus_tag="Sbal_0316"
                     /db_xref="GeneID:4845267"
     CDS             356469..357422
                     /locus_tag="Sbal_0316"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: son:SO4400 proline iminopeptidase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold domain-containing
                     protein"
                     /protein_id="YP_001048718.1"
                     /db_xref="GI:126172569"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR002410"
                     /db_xref="GeneID:4845267"
                     /translation="MSESFPPFIRRDWFSVGNGQQLHLAQYGNPQGIPLLYLHGGPGA
                     GCDIGDLALFNGEQYWILLLDQRGSGQSLPFGDLAHNHLNGLICDMEAIRLALGIERW
                     CLAGGSFGATLGLIYSGLFPERVIAQVLWALFIPSKEGIDWLYGADGAAKLQPAAYRL
                     FSGNAPVAPSLAELLDSYHQGLASADENLRHHFARRWVQWELKLAGARLVLPRQLPDP
                     VLALADIELHFARHDYFNAMTVLQRVTPRVKARSVLLQGMQDAICPAALLRDFLAGLE
                     HAITIQSVADGGHMLNSESLFLAVTAEIHAMWSWIHQREIQ"
     misc_feature    356508..357350
                     /locus_tag="Sbal_0316"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    356514..357260
                     /locus_tag="Sbal_0316"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            357419..358024
                     /locus_tag="Sbal_0317"
                     /db_xref="GeneID:4844187"
     CDS             357419..358024
                     /locus_tag="Sbal_0317"
                     /note="KEGG: son:SO4399 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048719.1"
                     /db_xref="GI:126172570"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4844187"
                     /translation="MKTLLISACLLGLTACAATAPSQTSAIDPVVAQEVVSAPVAPKV
                     VQLGGLTNDAAAERLYQALINANYLATKVAPTKVAVQFGDNQFLLEPSINSAGIDRIL
                     MNRFYAVHPQLQASQELPVVIGTLNQKLNFAKFVLLDQGAVIQIQGTVTFADRVEIEE
                     LRRFMLWTNGGLAQVAQSLPDGIDQYIRPIPLMQQMVPVKP"
     gene            358042..358479
                     /locus_tag="Sbal_0318"
                     /db_xref="GeneID:4843033"
     CDS             358042..358479
                     /locus_tag="Sbal_0318"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="YP_001048720.1"
                     /db_xref="GI:126172571"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="GeneID:4843033"
                     /translation="MIALIQRVSRASVVVDNQTIGAIDKGLLVLLGVEQEDTREKMEK
                     LATKVMSYRMFSDENGKMNLNLEQVGGSLLVVSQFTLAADTGRGLRPSFSGAGTPDQA
                     LALYEEFVAFCRAKGVTTETGQFGADMQVSLVNDGPVTFNLQV"
     misc_feature    358042..358476
                     /locus_tag="Sbal_0318"
                     /note="D-Tyrosyl-tRNAtyr deacylases; a class of
                     tRNA-dependent hydrolases which are capable of hydrolyzing
                     the ester bond of D-Tyrosyl-tRNA reducing the level of
                     cellular D-Tyrosine while recycling the peptidyl-tRNA;
                     found in bacteria and in eukaryotes but not...; Region:
                     Dtyr_deacylase; cd00563"
                     /db_xref="CDD:238316"
     misc_feature    order(358060..358062,358270..358284,358318..358320,
                     358462..358464)
                     /locus_tag="Sbal_0318"
                     /note="putative active site [active]"
                     /db_xref="CDD:238316"
     misc_feature    order(358171..358173,358180..358188,358192..358203,
                     358270..358275,358279..358284,358288..358296,
                     358300..358314,358318..358320,358420..358473)
                     /locus_tag="Sbal_0318"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238316"
     misc_feature    order(358183..358185,358198..358200,358300..358302,
                     358309..358311)
                     /locus_tag="Sbal_0318"
                     /note="putative tRNAtyr binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238316"
     gene            358639..359091
                     /locus_tag="Sbal_0319"
                     /db_xref="GeneID:4843034"
     CDS             358639..359091
                     /locus_tag="Sbal_0319"
                     /note="TIGRFAM: thioesterase domain, putative;
                     KEGG: she:Shewmr4_0320 thioesterase domain, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase domain-containing protein"
                     /protein_id="YP_001048721.1"
                     /db_xref="GI:126172572"
                     /db_xref="InterPro:IPR012660"
                     /db_xref="GeneID:4843034"
                     /translation="MDELLTQLLIQLRQTWHSTIPVSEFMQIAPLDYSEGEFRVTAPI
                     APNINLHQTMFAGSIYTLMTLTGWGAVWLNQQLAGVAGDIVLADAHIRYLAPVTCDPV
                     VTVQWPTVDLSPLQRGRRVKVKLAVQLYCDAKLCAVFEGLYVSAPKAS"
     misc_feature    358663..359079
                     /locus_tag="Sbal_0319"
                     /note="Putative thioesterase (yiiD_Cterm); Region:
                     YiiD_Cterm; pfam09500"
                     /db_xref="CDD:255399"
     gene            359251..359847
                     /locus_tag="Sbal_0320"
                     /db_xref="GeneID:4843663"
     CDS             359251..359847
                     /locus_tag="Sbal_0320"
                     /EC_number="3.1.4.14"
                     /note="FMN-dependent; requires NADH; catalyzes the
                     cleavage of azo bond in aromatic azo compounds"
                     /codon_start=1
                     /transl_table=11
                     /product="azoreductase"
                     /protein_id="YP_001048722.1"
                     /db_xref="GI:126172573"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="GeneID:4843663"
                     /translation="MSKVLILKSSILGGYSQSAVLIDHLASHWETQGAAITVRDLGGK
                     DVLPMVDGEIASGLRGGAELSARQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPTQ
                     LKNWIDFIARAGVTFTYTETGPKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLG
                     FIGITNVEVVYAEALNMGPEAHDKGMSEAKHSIEQLKA"
     misc_feature    359251..359844
                     /locus_tag="Sbal_0320"
                     /note="azoreductase; Reviewed; Region: PRK00170"
                     /db_xref="CDD:234675"
     gene            complement(360001..360186)
                     /locus_tag="Sbal_0321"
                     /db_xref="GeneID:4845196"
     CDS             complement(360001..360186)
                     /locus_tag="Sbal_0321"
                     /note="KEGG: son:SO4395 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048723.1"
                     /db_xref="GI:126172574"
                     /db_xref="GeneID:4845196"
                     /translation="MHKTNHAKALQFEATQVNPAEKPHETERPARFSISRNRDQASTK
                     VRYVETSTLTKGCSLCE"
     gene            complement(360262..360585)
                     /locus_tag="Sbal_0322"
                     /db_xref="GeneID:4843587"
     CDS             complement(360262..360585)
                     /locus_tag="Sbal_0322"
                     /note="PFAM: Rhodanese domain protein;
                     KEGG: shn:Shewana3_0318 rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_001048724.1"
                     /db_xref="GI:126172575"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:4843587"
                     /translation="MFQSLLAKLSGSQSGEKCWQLIEQGARVIDVRSPEEFASGHLPQ
                     AINVPLPTLDQWLHQVDNKQHPFVLYCGAGIRAQKGCDILKANGFGCVVNGGSLKDLV
                     CCQPS"
     misc_feature    complement(360298..360525)
                     /locus_tag="Sbal_0322"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    complement(360373..360375)
                     /locus_tag="Sbal_0322"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(360731..361306)
                     /locus_tag="Sbal_0323"
                     /db_xref="GeneID:4844614"
     CDS             complement(360731..361306)
                     /locus_tag="Sbal_0323"
                     /note="PFAM: helix-turn-helix domain protein; Cupin 2,
                     conserved barrel domain protein;
                     KEGG: she:Shewmr4_0324 transcriptional regulator, XRE
                     family with cupin sensor"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001048725.1"
                     /db_xref="GI:126172576"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:4844614"
                     /translation="MQTINSYLATTLKALRNQKGWSLDKAAQETGVSKAMIGQIERGE
                     SSPTIATLWKIASGFNFSLSTFLEPTPQSQGAVFRKPDELRQQPATDGMLVASLFPFE
                     DRFGFEMFELTLLPNYERLSEPHEAGVTEHVIVLSGTMEVLVDGQWQTLKQGEAVRFA
                     ADKPHGYRNLNDQAVVFHDIIHYQRGSESSL"
     misc_feature    complement(360962..361285)
                     /locus_tag="Sbal_0323"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(361109..361273)
                     /locus_tag="Sbal_0323"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(361181..361183,361256..361258,
                     361268..361270))
                     /locus_tag="Sbal_0323"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(361184..361186,361259..361261))
                     /locus_tag="Sbal_0323"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(361178..361183,361193..361195,
                     361202..361204,361235..361240))
                     /locus_tag="Sbal_0323"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(360764..360979)
                     /locus_tag="Sbal_0323"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            361433..362620
                     /locus_tag="Sbal_0324"
                     /db_xref="GeneID:4841359"
     CDS             361433..362620
                     /locus_tag="Sbal_0324"
                     /note="TIGRFAM: benzoate transporter;
                     PFAM: Benzoate membrane transport protein;
                     Xanthine/uracil/vitamin C permease;
                     KEGG: shm:Shewmr7_3699 benzoate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="benzoate transporter"
                     /protein_id="YP_001048726.1"
                     /db_xref="GI:126172577"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR004711"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="GeneID:4841359"
                     /translation="MWREAGSLSKISAGFIAVLVGYSSSAVIIFQAAEAVGATPAQIS
                     SWLWALGVGMGVTSIGLSLYYKNPILTAWSTPGAALMVTSLGGLSINQAIGAFLVSSI
                     LITLCGVAGWMDKLIRIMPQSVASAMLAGILLQFGLGLFQAMQTQLSLILIMLLVFVV
                     VKPFAPRYIILLTLLVGIGMSFQLDLLKLDAVQLQLAMPVWTMPEFSLASVIGVALPL
                     FVVTMASQNMPGVAALHGNGYRPPISPLITSTGLIGVILAPFGGFAFNLSAITAAICM
                     GKEADPNPATRYWAAVWGGVFYFITGLLGATVVGLFSAFPKELVLAIAGLALLGTIAN
                     SLTAALAKTEDREVAVITFLVTASGFSVLGIGSAFWGLLLGFIIHWWNGHRTATVVKR
                     ANT"
     misc_feature    361445..362572
                     /locus_tag="Sbal_0324"
                     /note="Uncharacterized protein involved in benzoate
                     metabolism [Secondary metabolites biosynthesis, transport,
                     and catabolism]; Region: BenE; COG3135"
                     /db_xref="CDD:225677"
     misc_feature    361451..362569
                     /locus_tag="Sbal_0324"
                     /note="Benzoate membrane transport protein; Region: BenE;
                     pfam03594"
                     /db_xref="CDD:112412"
     gene            complement(362673..363164)
                     /locus_tag="Sbal_0325"
                     /db_xref="GeneID:4844289"
     CDS             complement(362673..363164)
                     /locus_tag="Sbal_0325"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: shm:Shewmr7_3696 GCN5-related N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_001048727.1"
                     /db_xref="GI:126172578"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:4844289"
                     /translation="MRLTMKATMKATMKITLDDLKGPEIAALLQEHLNDMRATSPPES
                     VHALDLDGLRQPNIHFWTLWDGNNLAGCGALKWLDAEHAEIKSMRTAAPYKQQGIASK
                     ILQHLINDAKTAGVKRLSLETGSMDFFNPARLLYSKFGFEICDPFDGYQLDPNSVFMT
                     KKI"
     misc_feature    complement(362700..363164)
                     /locus_tag="Sbal_0325"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(362799..362987)
                     /locus_tag="Sbal_0325"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(362862..362867,362895..362903))
                     /locus_tag="Sbal_0325"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(363680..364423)
                     /locus_tag="Sbal_0326"
                     /db_xref="GeneID:4842104"
     CDS             complement(363680..364423)
                     /locus_tag="Sbal_0326"
                     /note="KEGG: shn:Shewana3_0325 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048728.1"
                     /db_xref="GI:126172579"
                     /db_xref="GeneID:4842104"
                     /translation="MKPLFAGMLLSISLLTAPLFAKEYTVETYQEVFKGDNEFKQKQA
                     IESLSLAGLSDPAIYDALEAKLLASLPQATEKNAIDYSAWLVKGLAYSGNDKYSETIN
                     SIVNGNYHKKLKKYASQANENLAQYKKWNTILGDKSQYAADQSQQNNAFANALRSDDL
                     ELMRLAAKRIMDDRQYDDFILAVLSNELKTPRLMADDKLAIDTYANMAKALASSGNAD
                     YRDVIENIATTSSNRKLQKYAASYLKKFY"
     gene            complement(364452..365711)
                     /locus_tag="Sbal_0327"
                     /db_xref="GeneID:4842105"
     CDS             complement(364452..365711)
                     /locus_tag="Sbal_0327"
                     /EC_number="2.3.1.41"
                     /note="FabB; beta-ketoacyl-ACP synthase I, KASI; catalyzes
                     a condensation reaction in fatty acid biosynthesis:
                     addition of an acyl acceptor of two carbons from
                     malonyl-ACP; required for the elongation of short-chain
                     unsaturated acyl-ACP"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl carrier protein) synthase II"
                     /protein_id="YP_001048729.1"
                     /db_xref="GI:126172580"
                     /db_xref="InterPro:IPR000794"
                     /db_xref="GeneID:4842105"
                     /translation="MSEATNQTRLGKRVVITGVGGITALGHDWPTIAASLKAQKNCVV
                     TMNDWDRYDGLNTRLAAPITDFEVPSHYSRKKIRSMGKVSIMATRASELALLDAGLLD
                     DPIVSSGEMGIAYGSSTGSTDPITAFGDMLKTGDMSGITATSYIRMMAHTTAVNVGVF
                     FGLKGRIHTTSSACTSGSQGIGYAYEAIKYGQQTLMLAGGGEELCPTEAVVFDTLFAT
                     STKNSTPELTPRPFDADRDGLVIGEGACTLVLEELEHAKARGAKIYAELVGFGTNSDG
                     QHVTQPNAQTMEIAIRLALKDAQLEPSAIGYVNAHGTATDRGDIAESHATQAVFGADT
                     PISSLKSYTGHTLGACGALEAWVSIEMMNAGWFAPTLNLKNIDPQCADLDYIRNELRP
                     IDTDYVMSNNFAFGGINTSLIFKRWTR"
     misc_feature    complement(364467..365678)
                     /locus_tag="Sbal_0327"
                     /note="3-oxoacyl-(acyl carrier protein) synthase II;
                     Reviewed; Region: PRK09116"
                     /db_xref="CDD:181657"
     misc_feature    complement(364470..365678)
                     /locus_tag="Sbal_0327"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    complement(order(364488..364490,364494..364496,
                     364845..364847,364881..364895,365067..365072,
                     365079..365084,365142..365144,365151..365156,
                     365163..365165,365199..365207,365211..365213,
                     365217..365219,365235..365237,365247..365249,
                     365259..365261,365277..365279,365313..365318,
                     365322..365324,365334..365339,365358..365360))
                     /locus_tag="Sbal_0327"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    complement(order(364677..364679,364779..364781,
                     365190..365192))
                     /locus_tag="Sbal_0327"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            complement(365712..366437)
                     /gene="fabG"
                     /locus_tag="Sbal_0328"
                     /db_xref="GeneID:4843231"
     CDS             complement(365712..366437)
                     /gene="fabG"
                     /locus_tag="Sbal_0328"
                     /EC_number="1.1.1.100"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="YP_001048730.1"
                     /db_xref="GI:126172581"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR011285"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:4843231"
                     /translation="MNNRVLVTGSSRGIGKAIALKLAQAGFDIALHYHSNQTAADDTA
                     TQIRALGVNVSLLKFDVADRATVKAAIEADIEANGAYYGVILNAGINRDTAFPAMTES
                     EWDSVIHTNLDGFYNVIHPCVMPMVQGRKGGRIITLASVSGIAGNRGQVNYSASKAGI
                     IGATKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVEQLVPMRRMGKPNEIAALA
                     AFLMSDDAAYITRQVISVNGGMI"
     misc_feature    complement(365715..366425)
                     /gene="fabG"
                     /locus_tag="Sbal_0328"
                     /note="3-oxoacyl-(acyl-carrier-protein) reductase,
                     putative; Region: fabG_rel; TIGR01831"
                     /db_xref="CDD:130890"
     misc_feature    complement(365718..366425)
                     /gene="fabG"
                     /locus_tag="Sbal_0328"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(365880..365891,365967..365969,
                     365979..365981,366018..366026,366171..366179,
                     366330..366335,366339..366341,366396..366398,
                     366402..366407,366411..366413))
                     /gene="fabG"
                     /locus_tag="Sbal_0328"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(365967..365969,365979..365981,
                     366018..366020,366105..366107))
                     /gene="fabG"
                     /locus_tag="Sbal_0328"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(366625..367161)
                     /locus_tag="Sbal_0329"
                     /db_xref="GeneID:4844688"
     CDS             complement(366625..367161)
                     /locus_tag="Sbal_0329"
                     /note="KEGG: son:SO4381 thioester dehydrase family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thioester dehydrase family protein"
                     /protein_id="YP_001048731.1"
                     /db_xref="GI:126172582"
                     /db_xref="GeneID:4844688"
                     /translation="MMPFIQFNLPFAEQDIADFIPHRAPMILVDKIISYQRDTLVTEV
                     TITTQSPYFDDKHKAVPNYVGIEYMAQSIAALAGVEAKLRNDKIRVGFLLGSRKLALH
                     AKQYELGRTYRTQVNRLYQEESGLAVFDCQIYLLPEAGSDQEKILVATANVNVFQPQD
                     TQAYLDGNQDAGNRSLGH"
     misc_feature    complement(366685..367122)
                     /locus_tag="Sbal_0329"
                     /note="Domain of unknown function, appears to be related
                     to a diverse group of beta-hydroxydecanoyl ACP
                     dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases
                     (FabZ). This group appears to lack the conserved active
                     site histidine of FabA and FabZ; Region: FabA_like;
                     cd01289"
                     /db_xref="CDD:238616"
     misc_feature    complement(order(366877..366888,366937..366942,
                     366949..366954,366961..366963,367102..367110))
                     /locus_tag="Sbal_0329"
                     /note="putative active site 1 [active]"
                     /db_xref="CDD:238616"
     gene            complement(367163..368383)
                     /locus_tag="Sbal_0330"
                     /db_xref="GeneID:4844149"
     CDS             complement(367163..368383)
                     /locus_tag="Sbal_0330"
                     /EC_number="2.3.1.41"
                     /note="FabB; beta-ketoacyl-ACP synthase I, KASI; catalyzes
                     a condensation reaction in fatty acid biosynthesis:
                     addition of an acyl acceptor of two carbons from
                     malonyl-ACP; required for the elongation of short-chain
                     unsaturated acyl-ACP"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="YP_001048732.1"
                     /db_xref="GI:126172583"
                     /db_xref="InterPro:IPR000794"
                     /db_xref="GeneID:4844149"
                     /translation="MVKKRYAMMNRVAITQIGLCTPLGQDPQQVLDRLIAGDTSAMQR
                     SDTLLFEHPTLVAPVTAALPAIPAKLIQFDCRNNQLLLCAAQQITATIEQAKRDLGHA
                     RIGVVLGTSTSGISKGEAALSYRNQHGHFPADYHYFQQELGSTSDFLRQYFELDGPCY
                     TISTACSSSAKVFASAKRLLSANLCDMVIVGGVDSLCQLTVNGFNALESVSKGHCNPF
                     SINRDGINIGEGAALFVLTAGESDVMLAGIGESSDAHHISAPHPEGAGAITAMQAALQ
                     DANIAAQDIGYINLHGTATPKNDAMESRAVVEVFGANTPPCSSTKPLVGHTLGAAGAI
                     EAAFCYLLLSTHNHDQALPPHQWDGQIDPQDPSIALVERHQVAAKGTLNYVMSNSFAF
                     GGSNASLIFCRNEA"
     misc_feature    complement(367172..368359)
                     /locus_tag="Sbal_0330"
                     /note="3-oxoacyl-(acyl carrier protein) synthase I;
                     Reviewed; Region: PRK09185"
                     /db_xref="CDD:236398"
     misc_feature    complement(367181..368356)
                     /locus_tag="Sbal_0330"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    complement(order(367199..367201,367205..367207,
                     367577..367579,367619..367633,367763..367768,
                     367775..367780,367838..367840,367847..367852,
                     367859..367861,367895..367903,367907..367909,
                     367913..367915,367931..367933,367943..367945,
                     367955..367957,367979..367981,368006..368011,
                     368015..368017,368027..368032,368051..368053))
                     /locus_tag="Sbal_0330"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    complement(order(367406..367408,367511..367513,
                     367886..367888))
                     /locus_tag="Sbal_0330"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            complement(368412..369200)
                     /locus_tag="Sbal_0331"
                     /db_xref="GeneID:4842059"
     CDS             complement(368412..369200)
                     /locus_tag="Sbal_0331"
                     /note="KEGG: shn:Shewana3_0330 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048733.1"
                     /db_xref="GI:126172584"
                     /db_xref="GeneID:4842059"
                     /translation="MSLNLNAKWLAITTLLLASLGLTGCSELLLRQTCVGLAKDMRYC
                     LAPLPHNFAPATDKPLTQPRIKPTTEPTTKPAIMASQQTDSNTGVFSPQSFSQKVSIK
                     VGKESHELLTQLELEGERMTLVGLAPLGQALFTLVYDGNTLSSEQSVLLGDNFKAEYL
                     MAMMQLIYWPEQSIRAHLEGGHLVTGLCDTVEGNQSDTLVDTRMNTIPCRQIYSQDTL
                     ISKSALQTHVVQIRYQQNVGDALWQAHISLTMPQAKFELEIEPI"
     misc_feature    complement(368496..369152)
                     /locus_tag="Sbal_0331"
                     /note="Protein of unknown function (DUF3261); Region:
                     DUF3261; pfam11659"
                     /db_xref="CDD:152095"
     gene            complement(369205..370494)
                     /locus_tag="Sbal_0332"
                     /db_xref="GeneID:4843252"
     CDS             complement(369205..370494)
                     /locus_tag="Sbal_0332"
                     /note="PFAM: monooxygenase, FAD-binding; FAD dependent
                     oxidoreductase; tryptophan halogenase;
                     KEGG: shm:Shewmr7_3686 monooxygenase, FAD-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase FAD-binding"
                     /protein_id="YP_001048734.1"
                     /db_xref="GI:126172585"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006905"
                     /db_xref="GeneID:4843252"
                     /translation="MSTQVHDLSAIPNSLDVDVAIIGAGPSGAIAASLLHQQGKRVLV
                     LEKQHFPRFSIGESLLPCCMQFIEEAGMLDALNAAGFQHKNGAAFRRNGTYTTFDFTD
                     KFTPGPGTTFQVQRASFDKLLADTAQSQGVDIRYGETVEAIDLTENPRLTVRNEQGEL
                     YQINAQYVLDASGFGRVLPRLLNLESPSCLPPRSAIFTHVEDNISDASFDRNKILISV
                     HPEHKDIWYWLIPFSNGRCSLGVVAEPQLLERLPGSLEQQLMSIVNEEPGLKALLANA
                     KVVQECATLKGYSANVSRLATDKFALLGNAGEFLDPVFSSGVTIAMQSASMAAKCLTK
                     QLNGETVDWQADYSTPLMQGVNAFRTYVQAWYDGRFQDVIFYEEPNERIKQMICSILA
                     GYAWDTNNPFVKDSERRLNMIVELCRNPAATPAFAEV"
     misc_feature    complement(369241..370449)
                     /locus_tag="Sbal_0332"
                     /note="Dehydrogenases (flavoproteins) [Energy production
                     and conversion]; Region: FixC; COG0644"
                     /db_xref="CDD:223717"
     misc_feature    complement(<369973..370449)
                     /locus_tag="Sbal_0332"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(370518..373040)
                     /locus_tag="Sbal_0333"
                     /db_xref="GeneID:4842221"
     CDS             complement(370518..373040)
                     /locus_tag="Sbal_0333"
                     /note="KEGG: son:SO4377 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048735.1"
                     /db_xref="GI:126172586"
                     /db_xref="GeneID:4842221"
                     /translation="MASNFAARANQALMQSSPKWRLAIWLLLMLSASLWTLQLWQNGA
                     RVQSDILAMLPHLQQDKLTERALNQVEATLADQVYIALVAKDETTAIAAAKLLMQKLE
                     ADLVARGKQGALTDIRSADMQLGEALGQFYFPHRFKLLTEPQAKALANQDIGSLIEAA
                     TAQLYNAFSYANSNLLAQDPLLLFPANLLTLAPSSKVRASQGILLANQGDNVAAVVMA
                     KGRESAFNPNAQLAQMTALTQGLDAVKQSYPDITVLKAGALFHALAATQTAKSEISIL
                     GLASLLGVIALVWLAFRSVMPLLLAIVTISSGLLLAVTFTLSVFGELHLLTLVFGTSL
                     IGIAIDYSFHFYCERLSDSERSAKATVAYIFPTVTLAFITSALAYVGIGLAPFPGMQQ
                     VAIFCAAGLLGAYLTLILAYPLLASSRLPEGSRPLALAGTYLASLTQLSKRFTTPLGM
                     GMFALVILVWCLVGVTKLTVDDDIRHLQQSPASVTEPENQLRQLLSGGTDNQFLLVRA
                     PNEEALLQQLERVSPMLDTAITNQELGNYVSLSRYLPSHQKQDTAYHLQGKIYQTQID
                     TVLTSLGLDENLKPELQAAYLAAKTDYITPAAFFTLGAGKQLAPLWLAPLWLAPNGKA
                     TDYGAINDGDTLNDDGASADQGADYGAIVLLGGIQQIDALKARFAHDGSVQLIDKVAD
                     ISAVMGHYRLLTLKLLALALGIALLLFSLNFGFKKAAVVVAVPALAALLTLATLGLTG
                     SPLSLFHALALILVFGIGIDYSLFFASAQNHGKAVMMAVFMSACSTLLAFGLLAFSQT
                     QAIHYFGLTLSLGIGFTFLLSPLILTTTLALTTNQLLTTKKS"
     misc_feature    complement(370581..373022)
                     /locus_tag="Sbal_0333"
                     /note="Predicted exporter [General function prediction
                     only]; Region: COG4258"
                     /db_xref="CDD:226709"
     misc_feature    complement(371748..>372245)
                     /locus_tag="Sbal_0333"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(373043..373813)
                     /locus_tag="Sbal_0334"
                     /db_xref="GeneID:4845051"
     CDS             complement(373043..373813)
                     /locus_tag="Sbal_0334"
                     /note="KEGG: shm:Shewmr7_3684 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048736.1"
                     /db_xref="GI:126172587"
                     /db_xref="GeneID:4845051"
                     /translation="MNSVLAKSSALTKCALFLCLAFALISLPLKAETLAAPGAYQTLF
                     SQSADTAQLVALSQKLNLGETVRGHFVQSRQLKVLKKPLISQGQFIFDKEQGLIWQQI
                     KPFESLLILKDKQLIQRDSQGRVQISKADASASAAVMGDLLPSLVRAMLGGNISGLSE
                     NFELHFLITDKLNTEKLSPDGQWQLGLTPKDPLMKKAIANMVLEGSDVLQSLVLLSAA
                     PNVTPQDMTRIDFSALSQGTLSEAELAQYALALEASKP"
     misc_feature    complement(<373454..373690)
                     /locus_tag="Sbal_0334"
                     /note="Outer membrane lipoprotein carrier protein LolA;
                     Region: LolA; cl19192"
                     /db_xref="CDD:267545"
     gene            complement(373813..374244)
                     /locus_tag="Sbal_0335"
                     /db_xref="GeneID:4845052"
     CDS             complement(373813..374244)
                     /locus_tag="Sbal_0335"
                     /note="PFAM: thioesterase superfamily protein;
                     KEGG: shm:Shewmr7_3683 thioesterase superfamily protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase superfamily protein"
                     /protein_id="YP_001048737.1"
                     /db_xref="GI:126172588"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="GeneID:4845052"
                     /translation="MKSLLTIDMEMQIPFHDVDSMGITWHGNYLRYFEIARCKLLDEL
                     GYNYRQMQASNYAWPIIDLQIKYVKASTFEQKITVRAELVEWENRLKINYQIRDVETG
                     ARITKGYTIQAAVDMSTQELCFVTPEVFRDKIATLLAKVED"
     misc_feature    complement(373897..374220)
                     /locus_tag="Sbal_0335"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    complement(order(373978..373980,373981..373986,
                     374065..374067,374071..374073,374143..374145))
                     /locus_tag="Sbal_0335"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            complement(374241..375815)
                     /locus_tag="Sbal_0336"
                     /db_xref="GeneID:4841419"
     CDS             complement(374241..375815)
                     /locus_tag="Sbal_0336"
                     /EC_number="4.3.1.3"
                     /note="PFAM: phenylalanine/histidine ammonia-lyase;
                     KEGG: she:Shewmr4_0344 histidine ammonia-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="YP_001048738.1"
                     /db_xref="GI:126172589"
                     /db_xref="InterPro:IPR001106"
                     /db_xref="GeneID:4841419"
                     /translation="MSHTKAADSESQSDLQTVEFGRQFLTLEQVVAVAKGAPVKLCDD
                     ADYQEYIQKGARFIDSLLHEEGVVYGVTTGYGDSCTVNVSLDLVHELPLHLTRFHGCG
                     LGETLSIMQARAVMACRLNSLAIGKSGVTYELLKRIETLLNLNIVPVIPEEGSVGASG
                     DLTPLSYLAAVLVGEREVIYQGERQATQDVYAKLNITPHVLRPKEGLALMNGTAVMTA
                     LACLAFDRAQYLARLSSRITAMASLTLKGNSNHFDEILFAAKPHPGQNQIATWIREDL
                     NHHEHPRNSDRLQDRYSIRCAPHIIGVLQDALPFMRQFIETEVNSANDNPIVDGEGEH
                     ILHGGHFYGGHIAFAMDSLKNTVANLADLIDRQMALVMDPKFNNGLPANLSGSTGPRR
                     AINHGFKAVQIGVSAWTAEALKHTMPASVFSRSTECHNQDKVSMGTIAARDCMRVLQL
                     TEQVAAAALLAMTQGIGLRIAQNELSEASLTPSLAKTLAQVRADFETLIEDRPLETVL
                     RQTIAKIQAGEWEVCR"
     misc_feature    complement(374316..375764)
                     /locus_tag="Sbal_0336"
                     /note="Aromatic amino acid lyase; Region: Lyase_aromatic;
                     pfam00221"
                     /db_xref="CDD:249692"
     misc_feature    complement(374409..375743)
                     /locus_tag="Sbal_0336"
                     /note="Phenylalanine ammonia-lyase (PAL) and histidine
                     ammonia-lyase (HAL); Region: PAL-HAL; cd00332"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(374805..374807,374841..374843,
                     374931..374933,374940..374942,375183..375185,
                     375195..375209,375531..375533,375540..375542,
                     375591..375593,375597..375599,375603..375611))
                     /locus_tag="Sbal_0336"
                     /note="active sites [active]"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(374466..374471,374478..374480,
                     374487..374492,374508..374510,374517..374537,
                     374568..374579,374583..374600,374604..374606,
                     374610..374621,374625..374630,374634..374636,
                     374649..374651,374688..374690,374697..374699,
                     374706..374708,374718..374720,374730..374732,
                     374739..374741,374760..374762,374772..374774,
                     374781..374786,374790..374810,374814..374816,
                     374829..374837,374850..374855,374862..374867,
                     374874..374879,374886..374888,374895..374900,
                     374916..374921,374928..374933,374937..374945,
                     374949..374951,375021..375023,375030..375032,
                     375036..375041,375048..375053,375306..375308,
                     375315..375317,375354..375359,375441..375443,
                     375504..375527,375534..375536,375591..375596))
                     /locus_tag="Sbal_0336"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176460"
     gene            complement(375812..377671)
                     /locus_tag="Sbal_0337"
                     /db_xref="GeneID:4844841"
     CDS             complement(375812..377671)
                     /locus_tag="Sbal_0337"
                     /note="PFAM: glycosyl transferase, family 2; lipid A
                     biosynthesis acyltransferase;
                     KEGG: she:Shewmr4_0345 glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001048739.1"
                     /db_xref="GI:126172590"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR004960"
                     /db_xref="GeneID:4844841"
                     /translation="MLTPPSDLVESAHIKLALVIPNYNHSAAIAQTLAELAQFNLPCY
                     LIDDGSNDETRYLLQSLAQTYPWVTLLLHPYNRGKGAAVMTGLRRAYRDGFSHALQVD
                     ADGQHNLADIPAMLARAQAKPDALISGKPEYDESVPKGRLYGRYLTHFWVWVETLSFN
                     IQDSMCGFRVYPLAATERLLCQQALTERMDFDIEILVKLYWQGVEILFQPTKVIYPEG
                     GVSHFQGVADNVRITKLHTKLFFGMLKRLPWLLKRKSQQQTVQNSHCSSATSSTSATH
                     WSGMKERGSYWGIKLLAESYRFGGHWLCRAIMYPVICYFFLTGKVTREASLDFLRRVQ
                     KLEPQHPKLNQPVGWRDSLNHFLAFGNAALDRIDAWCDRIELSQVDFPDRQVLADQLE
                     SGKGAVLLVSHLGNLELCRAISIHQRKVKVNVMVLTNHAENFNKVVKQLNPDSTLNLI
                     QVTELNPATSMLLQQKIEDGELVVIAGDRTSSNTQGRVMYAPFMGQDAAFPQGPFILA
                     GLLDCPVFLMFCLREQGRYRVHLERFAETLKGPRAGRMDRLQQAVNRYSERLEYFARR
                     EPLQWFNFFDFWRKDNELQRTPSHLVQPNPLPTTSASSPIPDQDHKTDRTQHS"
     misc_feature    complement(377027..377629)
                     /locus_tag="Sbal_0337"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    complement(377075..377620)
                     /locus_tag="Sbal_0337"
                     /note="DPM_DPG-synthase_like is a member of the
                     Glycosyltransferase 2 superfamily; Region:
                     DPM_DPG-synthase_like; cd04179"
                     /db_xref="CDD:133022"
     misc_feature    complement(order(377360..377362,377603..377605,
                     377609..377611))
                     /locus_tag="Sbal_0337"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(order(377360..377365,377528..377530))
                     /locus_tag="Sbal_0337"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(377360..377368)
                     /locus_tag="Sbal_0337"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(375935..376540)
                     /locus_tag="Sbal_0337"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    complement(order(376229..376237,376385..376396,
                     376448..376450,376454..376456,376463..376465))
                     /locus_tag="Sbal_0337"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            complement(377665..378069)
                     /locus_tag="Sbal_0338"
                     /db_xref="GeneID:4842448"
     CDS             complement(377665..378069)
                     /locus_tag="Sbal_0338"
                     /note="KEGG: son:SO4372 thioester dehydrase family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thioester dehydrase family protein"
                     /protein_id="YP_001048740.1"
                     /db_xref="GI:126172591"
                     /db_xref="GeneID:4842448"
                     /translation="MIKSSLPPILHSDIGIDNIELRLLVAADLEYFNGHFPEQAVLPG
                     VTQLDWAVRLGCQHFGYSEAVANLEVLKFQQLILPGQEVTLSISNNAAKAKLTFAYID
                     GENRYASGRIAFDSTPVNSKSATNNGDEASPC"
     misc_feature    complement(377758..378015)
                     /locus_tag="Sbal_0338"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    complement(order(377842..377853,377938..377943))
                     /locus_tag="Sbal_0338"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    complement(order(377872..377880,377902..377904,
                     377911..377916,377923..377925))
                     /locus_tag="Sbal_0338"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            complement(378062..379426)
                     /locus_tag="Sbal_0339"
                     /db_xref="GeneID:4845598"
     CDS             complement(378062..379426)
                     /locus_tag="Sbal_0339"
                     /note="KEGG: shn:Shewana3_0338 aconitate hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="YP_001048741.1"
                     /db_xref="GI:126172592"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="GeneID:4845598"
                     /translation="MTQLLKNWLTQGPFAQQLISFNHHDIVTGALFTNQVAYFYEQLL
                     AAPEKKWLLASDTSDLFAVGLCAALLAGKEIILPPNTQTGTLSELTHQFDGILSDKPL
                     CECQAFVLLKKELSLPNKPWPASEAIGELVLFTSGSSGEPKAIRKTLEQLDVEVSVLE
                     HTFAEHLPHCSVVSTVSHQHIYGLLFKILWPLAASRPFLSEQIEYPETLSYYTALLPN
                     LCLISSPAQLSRLPKALEHERQLRSPSLVFSSGGPLSFAAAKGVNQCYGHLPIEIFGS
                     TETGGIAYRRQHEADEPWQVFDRISIDQDPTDGALLLKSPYLADDEWLRCEDKIEPTE
                     NGQFRLKGRLDRIVKIEEKRLSLAQMETLMSSHAYVEQAALVVLPQFKSQLGAVVTLS
                     ELGKNVLQEQGKLSINNALKAHLLTQFERVTLPRRWRYPDILPLNTQGKRVTAQLVEL
                     FDHD"
     misc_feature    complement(378104..379426)
                     /locus_tag="Sbal_0339"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    complement(378104..379036)
                     /locus_tag="Sbal_0339"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(378998..379003,379007..379024,
                     379031..379033))
                     /locus_tag="Sbal_0339"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(378104..378106,378365..378367,
                     378398..378400,378407..378409,378443..378445,
                     378596..378613,378674..378679,379022..379024))
                     /locus_tag="Sbal_0339"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(378161..378163,378365..378376,
                     378398..378400,378407..378409,378443..378445,
                     378596..378613,378674..378679,378737..378739,
                     378746..378751,378755..378757,378896..378901,
                     379022..379024))
                     /locus_tag="Sbal_0339"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(378161..378163,378179..378181,
                     378368..378376,378677..378679,378737..378739,
                     378746..378751,378899..378901))
                     /locus_tag="Sbal_0339"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(379423..379971)
                     /locus_tag="Sbal_0340"
                     /db_xref="GeneID:4841691"
     CDS             complement(379423..379971)
                     /locus_tag="Sbal_0340"
                     /note="KEGG: shm:Shewmr7_3678 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048742.1"
                     /db_xref="GI:126172593"
                     /db_xref="GeneID:4841691"
                     /translation="MRALLQVLTALTLLAYPVAVYFGLNYLPAGTIALVLCVLLIVRL
                     MLQKQKVKTLVLPLLVGIALTAGSYLAKRSDWLLYYPVVINLTMLALFSYSLHTGPCM
                     IESLARLKEPDLPDEAIPYLKKVTLLWCGLFILNGSMAAYTAGFTSLATWTLYNGLIA
                     YVLMGLLLGGEWLYRSFWLKKT"
     misc_feature    complement(379432..379968)
                     /locus_tag="Sbal_0340"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4648"
                     /db_xref="CDD:226995"
     gene            complement(379971..380219)
                     /locus_tag="Sbal_0341"
                     /db_xref="GeneID:4844575"
     CDS             complement(379971..380219)
                     /locus_tag="Sbal_0341"
                     /note="carries the fatty acid chain in fatty acid
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="YP_001048743.1"
                     /db_xref="GI:126172594"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="GeneID:4844575"
                     /translation="MQNREQILAMLTTILVDEFEIEAEAITPEANLYEELDLDSIDAV
                     DLVIKLQQLTGKKIQPDEFKSVRTVNDVVNAIEGLVKD"
     misc_feature    complement(379974..380219)
                     /locus_tag="Sbal_0341"
                     /note="acyl carrier protein; Provisional; Region:
                     PRK05350"
                     /db_xref="CDD:180033"
     gene            complement(380229..380483)
                     /locus_tag="Sbal_0342"
                     /db_xref="GeneID:4843222"
     CDS             complement(380229..380483)
                     /locus_tag="Sbal_0342"
                     /note="KEGG: shn:Shewana3_0344 acyl carrier protein,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="YP_001048744.1"
                     /db_xref="GI:126172595"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="GeneID:4843222"
                     /translation="MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDAL
                     ELGLAIKKKFDVKIEANSDATKAHFHSVASLASFIESQRP"
     misc_feature    complement(380235..380477)
                     /locus_tag="Sbal_0342"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; cl09936"
                     /db_xref="CDD:263928"
     gene            complement(380467..381291)
                     /locus_tag="Sbal_0343"
                     /db_xref="GeneID:4843223"
     CDS             complement(380467..381291)
                     /locus_tag="Sbal_0343"
                     /note="PFAM: phospholipid/glycerol acyltransferase;
                     KEGG: she:Shewmr4_0351 phospholipid/glycerol
                     acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_001048745.1"
                     /db_xref="GI:126172596"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="GeneID:4843223"
                     /translation="MHNAAYTLPETRRAGLNYVPRWLGGVSCYIAFGLGGLLSSLTIL
                     PLLRFWPGTPEARIIRVQKAVHLMFKGFVAMLTWAGVIHVSTHRAQQLHDARGVIVIA
                     NHPSLVDVVVLISLMPNAGCIVKQGLWRNPFLRGVVSCAGYIPNRGAELMLEDCREVL
                     ARGTNLIIFPEGTRTVVGATINDFARGAANIALRAEADILPVVLRTNVRGLTKEQPWY
                     EIPRQTMGMAVEIGATVSYQKYQAALGEHAKMARQLTRDLEHYYKQQLENNYELKQ"
     misc_feature    complement(380515..381069)
                     /locus_tag="Sbal_0343"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(380770..380778,380911..380922,
                     380965..380967,380971..380973,380980..380982))
                     /locus_tag="Sbal_0343"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(381335..382069)
                     /locus_tag="Sbal_0344"
                     /db_xref="GeneID:4841991"
     CDS             complement(381335..382069)
                     /locus_tag="Sbal_0344"
                     /note="KEGG: son:SO4366 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048746.1"
                     /db_xref="GI:126172597"
                     /db_xref="GeneID:4841991"
                     /translation="MQLTFSILSWGAWAPQYQHPQSWQTWCKNSAELNLDTPQSDTTA
                     PALKHVPAMQRRRFSRLTKMMLEVSFQCEMPANCRSIFASRHGELQRTIGLLEDIIAK
                     QPLSPLGFSQSVHNTASGIFGIVTANIAPSTSVAAGTETLSQAMVEAFAQLHQSPEPL
                     LLVFGDDPVPPVYDEFTQEFELPLALGLQLAPFDAPASVKLTVSRISESSALNPLTYG
                     ALLHALATAQNISGCLSQLHWKLEHV"
     misc_feature    complement(381350..382003)
                     /locus_tag="Sbal_0344"
                     /note="Beta-ketoacyl synthase, N-terminal domain; Region:
                     Ketoacyl-synt_2; pfam13723"
                     /db_xref="CDD:258020"
     gene            complement(382425..383321)
                     /locus_tag="Sbal_0345"
                     /db_xref="GeneID:4845055"
     CDS             complement(382425..383321)
                     /locus_tag="Sbal_0345"
                     /note="KEGG: son:SO4365 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048747.1"
                     /db_xref="GI:126172598"
                     /db_xref="GeneID:4845055"
                     /translation="MQVNQDDRITPQETSSSSNRFALFAIVLVVLLSAGGYYYYSGDS
                     DSPKLIPNAPIVLPETPPSEPMTLESAPEPETTETTPAVTETNTNSTEAPAVTEPEVV
                     AEPVPALAESDAFVQQKALAIIDNNVLGSALVQQDLARQFVVFVDNLAQGELTRKVSP
                     LKGPEKHFSVSEITNKVYLNPEGFHRYDAYVDSIAKMDEQTLMVTYKQMTPMLEEAFT
                     ELGYSNAKFNDRMLQAIKILLAAPIIEDPIELSSISVNYQFVDPNLEALPSAQKLLIR
                     MGPENTRKLKVALRKLENQLAQ"
     misc_feature    complement(382440..382913)
                     /locus_tag="Sbal_0345"
                     /note="Protein of unknown function (DUF3014); Region:
                     DUF3014; pfam11219"
                     /db_xref="CDD:151661"
     gene            complement(383520..385610)
                     /locus_tag="Sbal_0346"
                     /db_xref="GeneID:4845433"
     CDS             complement(383520..385610)
                     /locus_tag="Sbal_0346"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="YP_001048748.1"
                     /db_xref="GI:126172599"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004609"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:4845433"
                     /translation="MSANDLQQLDLVPITDLKGVAKKVAEKLAKLGITTVQDLLFHLP
                     LRYEDRTQIYPIAALMPGSYGTIEAEIQSTQIIQGRKRMLVCNVRDDTGSLSLRFFNF
                     SVAQRNAMQNGLMIRAYGEVRRGGHQAEIVHPEYKVVYPGEDVHLSDTLTPIYPTTEG
                     LKQASWLKLTEQALVLLEDGGLTELLPPQLQPNNISLKQALQTLHRPPAGISQFDLEL
                     GQHPAQQRLVQEELLAHNLSMLRLRQRSNLDAAVTMQATGQLLNPFLAALPFKPTGAQ
                     QRVVADIGKDLEKPHPMMRLVQGDVGSGKTLVAAMAALQAIENGYQVAMMAPTELLAE
                     QHATNFAAWFEPLGLKVGWLAGKLKGKVRAQSLADIESGAAQMVIGTHAIFQQHVVFS
                     KLALIIIDEQHRFGVHQRLGLREKGVSQGFHPHQLIMTATPIPRTLAMTAYADLDTSI
                     IDELPPGRTPVTTVAIADSRRNEVLERVRNAVITDKRQAYWVCTLIEESEVLECQAAE
                     DTAEELRLALPELNIGLVHGRLKSAEKQQIMADFKAGIIHLLVATTVIEVGVDVPNSS
                     LMIIENPERLGLAQLHQLRGRVGRGAIASHCVLLYKAPLSHTATQRLSVLRQSNDGFI
                     IAQKDLEIRGPGEVLGTKQTGLAELKIADLVRDQALIPHIQKLANHVMAQAPEKVDAI
                     ILRWLGHKQHYVQA"
     misc_feature    complement(383523..385601)
                     /locus_tag="Sbal_0346"
                     /note="ATP-dependent DNA helicase RecG; Provisional;
                     Region: PRK10917"
                     /db_xref="CDD:236794"
     misc_feature    complement(<385491..>385574)
                     /locus_tag="Sbal_0346"
                     /note="Y-family of DNA polymerases; Region: PolY; cl12025"
                     /db_xref="CDD:264514"
     misc_feature    complement(385194..385415)
                     /locus_tag="Sbal_0346"
                     /note="RecG_wedge_OBF: A subfamily of OB folds
                     corresponding to the OB fold found in the N-terminal
                     (wedge) domain of Escherichia coli RecG. RecG is a
                     branched-DNA-specific helicase, which catalyzes the
                     interconversion of a DNA replication fork to a...; Region:
                     RecG_wedge_OBF; cd04488"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(385197..385199,385254..385256,
                     385260..385262,385266..385268,385413..385415))
                     /locus_tag="Sbal_0346"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(385218..385220,385296..385298,
                     385311..385313,385362..385364,385380..385382))
                     /locus_tag="Sbal_0346"
                     /note="ssDNA binding site; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(384312..384728)
                     /locus_tag="Sbal_0346"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(384693..384707)
                     /locus_tag="Sbal_0346"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(384402..384413)
                     /locus_tag="Sbal_0346"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(383811..384209)
                     /locus_tag="Sbal_0346"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(383946..383954,384027..384032,
                     384096..384101,384126..384131))
                     /locus_tag="Sbal_0346"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(383841..383843,383850..383852,
                     383862..383864,383928..383930))
                     /locus_tag="Sbal_0346"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(385780..386376)
                     /locus_tag="Sbal_0347"
                     /db_xref="GeneID:4845572"
     CDS             complement(385780..386376)
                     /locus_tag="Sbal_0347"
                     /note="PFAM: regulatory protein, LuxR; response regulator
                     receiver; Bacterio-opsin activator, HTH domain protein;
                     Sigma-70, region 4 type 2;
                     KEGG: son:SO0351 DNA-binding response regulator, LuxR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="two component LuxR family transcriptional
                     regulator"
                     /protein_id="YP_001048749.1"
                     /db_xref="GI:126172600"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR007050"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="GeneID:4845572"
                     /translation="MKILLAEDQAMVRGALAALLTLAGGFNITQASDGDEALSLLKQQ
                     SFDLLLTDIEMPGRTGLELAAWLKDQHSQTKVVVITTFGRAGYIKRAIEAGVGGFLLK
                     DAPSETLVNAIQQVMAGKRVIDPELAMMAIGDVDPLNDKERRALRLASEGKSTADIAE
                     TLFIAEGTVRNYLSEAIAKLNASNRIDAARIAKQKGWL"
     misc_feature    complement(385783..386376)
                     /locus_tag="Sbal_0347"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(386026..386367)
                     /locus_tag="Sbal_0347"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(386068..386073,386080..386082,
                     386137..386139,386197..386199,386221..386223,
                     386353..386358))
                     /locus_tag="Sbal_0347"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(386221..386223)
                     /locus_tag="Sbal_0347"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(386197..386205,386209..386214))
                     /locus_tag="Sbal_0347"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(386065..386073)
                     /locus_tag="Sbal_0347"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(385795..385965)
                     /locus_tag="Sbal_0347"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(385822..385824,385855..385869,
                     385873..385878,385882..385887,385909..385917,
                     385954..385962))
                     /locus_tag="Sbal_0347"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(385795..385800,385807..385809,
                     385816..385824,385915..385917,385921..385923,
                     385927..385929))
                     /locus_tag="Sbal_0347"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(386376..387455)
                     /locus_tag="Sbal_0348"
                     /db_xref="GeneID:4842435"
     CDS             complement(386376..387455)
                     /locus_tag="Sbal_0348"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase, dimerisation and
                     phosphoacceptor region;
                     KEGG: shn:Shewana3_3817 putative signal transduction
                     histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_001048750.1"
                     /db_xref="GI:126172601"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011712"
                     /db_xref="GeneID:4842435"
                     /translation="MISTHLQLERKLAWVYLINLVFYLIPLAINAYPAWKIALSFAVL
                     IPFIASYFWAYKCNQNSAYRPILMMVAIATAITPINPGSISLFTFAAFFIGFFYPLRT
                     CLLAIAALIGLLFALNEIYDFNSYYFPLYGSGLVLGVGMFGVAERRRHQHKLKEQQST
                     QEISTLAAMVERERIARDLHDIMGHSLSSIALKAELAEKLLAKQEYQLATIQLNELGQ
                     IARESLSQIRHTVSDYKHKVLADSVTQLCKLLREKGISVELTGNIPKLPARMESQLGL
                     IVTELVNNILRHSGASQCIIDFIQQADRLVVEVKDNGPSKPIAEGNGLTGIRERLDSL
                     GGSLSYNLEQGYAFTVSLPLQGATD"
     misc_feature    complement(386394..387416)
                     /locus_tag="Sbal_0348"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    complement(<386967..387179)
                     /locus_tag="Sbal_0348"
                     /note="Domain of unknown function (DUF4131); Region:
                     DUF4131; pfam13567"
                     /db_xref="CDD:257884"
     misc_feature    complement(386739..386945)
                     /locus_tag="Sbal_0348"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    complement(386400..386636)
                     /locus_tag="Sbal_0348"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(386412..386414,386418..386423,
                     386436..386438,386484..386495,386508..386513,
                     386517..386519,386523..386525,386529..386531,
                     386595..386597,386604..386606,386616..386618))
                     /locus_tag="Sbal_0348"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(386604..386606)
                     /locus_tag="Sbal_0348"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(386487..386489,386493..386495,
                     386511..386513,386517..386519))
                     /locus_tag="Sbal_0348"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(387540..388244)
                     /locus_tag="Sbal_0349"
                     /db_xref="GeneID:4845425"
     CDS             complement(387540..388244)
                     /locus_tag="Sbal_0349"
                     /note="PFAM: Tetratricopeptide TPR_2 repeat protein;
                     KEGG: son:SO0353 TPR domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048751.1"
                     /db_xref="GI:126172602"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4845425"
                     /translation="MKTLLIVSSLALISSHAFAASPSNANITSIDAASNSMNLAQLQQ
                     LSASTQDYDKAYANYRLAISANVMGQKVLASSALTNAQTALEALDTSQADAESLALLS
                     SVYGMQIALDNSKGATLGMKSAKAIANAEQLEPQNPRVALVKAIAAYNTPAMFGGSMQ
                     NAKTLATTAIERFAQPCDDICWGEAEAYTWRGLAKQELGDSQGASEDWQQAIKVQADY
                     GWAKFLLQQNQQLSAN"
     gene            complement(388459..389403)
                     /locus_tag="Sbal_0350"
                     /db_xref="GeneID:4844382"
     CDS             complement(388459..389403)
                     /locus_tag="Sbal_0350"
                     /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family;
                     PFAM: sodium/calcium exchanger membrane region;
                     KEGG: shm:Shewmr7_0325 Na+/Ca+ antiporter, CaCA family"
                     /codon_start=1
                     /transl_table=11
                     /product="CaCA family Na(+)/Ca(+) antiporter"
                     /protein_id="YP_001048752.1"
                     /db_xref="GI:126172603"
                     /db_xref="InterPro:IPR004481"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="GeneID:4844382"
                     /translation="MLITLSIIGGFIILTLGAEALVRGASAIALRLGITPLIIGLTIV
                     AFGTSAPELAVSVKSALAGNSGIALGNVIGSNIANIGLILAITALIRPIQVQSQVVKR
                     DIPLMILASMLFWGLLLDGELSLIDGVVLLSLLVGYLTFSYISSKNSKNEEEIEAGPN
                     NPLLSGLFILVGISMLVGGGILFVNGAVDLAKTFGVSEVIIGLTIVAIGTSMPELVTS
                     VIAALKGQSDIAIGNVVGSNLFNILGILGVTAIVHPVSSLGFQPFDFMVMLALAIVIL
                     PFAWTGLRIGRREGSVLLLTYLGYMGYLINQASAQALV"
     misc_feature    complement(388489..389391)
                     /locus_tag="Sbal_0350"
                     /note="Ca2+/Na+ antiporter [Inorganic ion transport and
                     metabolism]; Region: ECM27; COG0530"
                     /db_xref="CDD:223604"
     misc_feature    complement(388978..389370)
                     /locus_tag="Sbal_0350"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     misc_feature    complement(388492..388881)
                     /locus_tag="Sbal_0350"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     gene            complement(389583..391247)
                     /locus_tag="Sbal_0351"
                     /db_xref="GeneID:4844383"
     CDS             complement(389583..391247)
                     /locus_tag="Sbal_0351"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     KEGG: son:SO0355 AMP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_001048753.1"
                     /db_xref="GI:126172604"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="GeneID:4844383"
                     /translation="MDTAIKTPIEMLAHWAKTQGDQVYLRQPIKGQFLDFTWAEVQEK
                     VQQLAGALQHLGLERGDKIAVLSKNCAEWFITDLALMHGGYVSVPIYPTANTDTIRYV
                     LQHSGAKAIFLGKLDHWADQEAGVGGELLRLAMPYDTMPAQYQWEQLLKLGYPLVDAP
                     LPTPDQVMTLIYTSGSTGQPKGAIQTFASYGWTCQAVVRDLRTDGNDRLLSYLPLAHI
                     TERVAIEGSSFYSGSVVAFVESLDSFVADVQRAKPTVFFSVPRLWSLFQKNIIDKIGV
                     SKLNLLLKIPLISSLVKHKIHKGLGLNHCRLLGSGSAPIPPSLIHWYHSIGLNICEAW
                     GMTENCAYSIINYPFDARKIGTVGRPVEDCQIRQGEDGELLLKSPGLMTAYYQQPEAT
                     AAAFDADGFFHTGDLCSIDADGCVTITGRVKDNFKTAKGKYVAPVPIERKLAQDPHVE
                     LICVIGSGLPHPVALVQLSEGANLQAREEVRTSLKATLDSVNPHLESHEHVDAIIVVS
                     DPWTIENDVLTPTLKIKRHVLEKAFSERVDGIRGAQVRWEDELTQK"
     misc_feature    complement(389628..391241)
                     /locus_tag="Sbal_0351"
                     /note="Long-chain acyl-CoA synthetases (AMP-forming)
                     [Lipid metabolism]; Region: FAA1; COG1022"
                     /db_xref="CDD:223953"
     misc_feature    complement(389649..391157)
                     /locus_tag="Sbal_0351"
                     /note="Bacterial long-chain fatty acid CoA synthetase
                     (LC-FACS), including Marinobacter hydrocarbonoclasticus
                     isoprenoid Coenzyme A synthetase; Region: LC_FACS_bac;
                     cd05932"
                     /db_xref="CDD:213298"
     misc_feature    complement(order(390705..390710,390714..390731,
                     390738..390740))
                     /locus_tag="Sbal_0351"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213298"
     misc_feature    complement(order(389679..389681,389949..389951,
                     389985..389987,389994..389996,390030..390032,
                     390237..390254,390390..390395,390729..390731))
                     /locus_tag="Sbal_0351"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213298"
     misc_feature    complement(order(389754..389756,389949..389960,
                     389985..389987,389994..389996,390030..390032,
                     390237..390254,390390..390395,390453..390455,
                     390462..390467,390471..390473,390606..390611,
                     390729..390731))
                     /locus_tag="Sbal_0351"
                     /note="putative active site [active]"
                     /db_xref="CDD:213298"
     misc_feature    complement(order(389754..389756,389793..389795,
                     389952..389960,390393..390395,390453..390455,
                     390462..390467,390609..390611))
                     /locus_tag="Sbal_0351"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213298"
     gene            complement(391475..391858)
                     /locus_tag="Sbal_0352"
                     /db_xref="GeneID:4841505"
     CDS             complement(391475..391858)
                     /locus_tag="Sbal_0352"
                     /note="TIGRFAM: putative endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP;
                     KEGG: shn:Shewana3_3813 putative endoribonuclease L-PSP"
                     /codon_start=1
                     /transl_table=11
                     /product="putative endoribonuclease L-PSP"
                     /protein_id="YP_001048754.1"
                     /db_xref="GI:126172605"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="GeneID:4841505"
                     /translation="MAEKIIIATENAPAAIGTYSQAVKVGSTVYLSGQIPLVPSTMQI
                     VSDDFEAQVVQVFENLTAVCTAAGGSINDIVKLNIFLIDLSHFAKVNEIMSRYFSQPY
                     PARAAIGVKQLPKDSQVEMDGVMEL"
     misc_feature    complement(391487..391804)
                     /locus_tag="Sbal_0352"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(391487..391489,391493..391495,
                     391499..391501,391529..391552,391577..391579,
                     391586..391588,391619..391621,391625..391627,
                     391631..391636,391640..391642,391760..391765,
                     391769..391771,391775..391777,391784..391786,
                     391790..391792,391799..391804))
                     /locus_tag="Sbal_0352"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(391499..391501,391544..391546,
                     391586..391588,391598..391600,391802..391804))
                     /locus_tag="Sbal_0352"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            complement(391884..393989)
                     /locus_tag="Sbal_0353"
                     /db_xref="GeneID:4842179"
     CDS             complement(391884..393989)
                     /locus_tag="Sbal_0353"
                     /EC_number="2.7.6.5"
                     /note="KEGG: son:SO0359 guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase;
                     TIGRFAM: RelA/SpoT family protein;
                     PFAM: amino acid-binding ACT domain protein; TGS domain
                     protein; metal-dependent phosphohydrolase, HD sub domain;
                     RelA/SpoT domain protein;
                     SMART: metal-dependent phosphohydrolase, HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase"
                     /protein_id="YP_001048755.1"
                     /db_xref="GI:126172606"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004811"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="GeneID:4842179"
                     /translation="MYLFEGLKESASGYLEPEQVELLKQAYQIARDAHEGQMRTSGEP
                     YITHPVAVAHILADMRLDHETLMAALLHDTIEDTHVTKDDLAELFGVAVAELVEGVSK
                     LDKLKFRDKKEAQAENFRKMMMAMTQDIRVILIKLADRTHNMRTLGALRPDKRRRIAR
                     ETLEIYAPIANRLGIHNIKTELEDLGFQAYYPMRYRVLKEVVKAARGNRKELIQGIEA
                     AVYTRLNDAGIPGKVKGREKNLYSIYNKMQSKELQFQEVMDIYAFRVIVDSIDTCYRV
                     LGAMHGLYKPRPGRFKDYIAIPKANGYQSLHTSLFGPHGVPVEIQIRTEDMDQMADKG
                     VAAHWAYKGGAQTGQGTTTQVRARKWMQSLLELQQSASTSFEFVENVKTELFPEEIYV
                     FTPEGRILELPVNATAVDFAYEVHTDVGNTCVGARVNRQAYPLSQPLISGQTVEIITA
                     KGARPNAAWLNFVVTGKARAKIRQVLKSLKGDDAIALGRRLLNHALGKTKLDSIPPEQ
                     IEKVIRDTKHTTLDSLLADIGLGNAMSIVIAQRLIGDNLENQESRDGHMMPIRGAEGM
                     LVTFANCCRPIPGDAVIAHVSQGKGLVVHMENCANIRGYQGEPDKYIPVQWDNVEGVD
                     YQANLRVEIVNHQGALAKITSIIAAECSNIHNLSTEERDGRVYLINLRISVKDRIHLA
                     NVMRRIRVLPEVLRTSRNR"
     misc_feature    complement(391887..393989)
                     /locus_tag="Sbal_0353"
                     /note="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase;
                     Provisional; Region: PRK11092"
                     /db_xref="CDD:236843"
     misc_feature    complement(393492..393863)
                     /locus_tag="Sbal_0353"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(393573..393575,393771..393776,
                     393846..393848))
                     /locus_tag="Sbal_0353"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(393771..393773)
                     /locus_tag="Sbal_0353"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(392997..393326)
                     /locus_tag="Sbal_0353"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(392997..392999,393021..393023,
                     393027..393029,393033..393035,393069..393071,
                     393081..393083,393087..393089,393093..393095,
                     393108..393110,393114..393116,393198..393200,
                     393210..393215,393276..393278,393282..393284))
                     /locus_tag="Sbal_0353"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(392997..392999,393027..393029,
                     393033..393035,393069..393071,393081..393083,
                     393087..393089,393093..393095,393108..393110,
                     393114..393116,393282..393284))
                     /locus_tag="Sbal_0353"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(393033..393035,393213..393215))
                     /locus_tag="Sbal_0353"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    complement(392643..392822)
                     /locus_tag="Sbal_0353"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    complement(391893..392105)
                     /locus_tag="Sbal_0353"
                     /note="ACT  domain found C-terminal of the RelA/SpoT
                     domains; Region: ACT_RelA-SpoT; cd04876"
                     /db_xref="CDD:153148"
     gene            complement(394035..394313)
                     /gene="rpoZ"
                     /locus_tag="Sbal_0354"
                     /db_xref="GeneID:4844146"
     CDS             complement(394035..394313)
                     /gene="rpoZ"
                     /locus_tag="Sbal_0354"
                     /EC_number="2.7.7.6"
                     /note="promotes RNA polymerase assembly or stability;
                     latches the N- and C-terminal regions of the beta' subunit
                     thereby facilitating its interaction with the beta and
                     alpha subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="YP_001048756.1"
                     /db_xref="GI:126172607"
                     /db_xref="InterPro:IPR003716"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="GeneID:4844146"
                     /translation="MARVTVEDAVEQIGNRFDMILVAARRARQIAVQGKDPMVEEMND
                     KPTVIALREIELGLVNAHTLDADERQTVREREAAEIAAVSAIAEGRSL"
     misc_feature    complement(394104..394313)
                     /gene="rpoZ"
                     /locus_tag="Sbal_0354"
                     /note="DNA-directed RNA polymerase subunit omega;
                     Reviewed; Region: rpoZ; PRK00392"
                     /db_xref="CDD:234744"
     gene            complement(394363..394995)
                     /gene="gmk"
                     /locus_tag="Sbal_0355"
                     /db_xref="GeneID:4844147"
     CDS             complement(394363..394995)
                     /gene="gmk"
                     /locus_tag="Sbal_0355"
                     /EC_number="2.7.4.8"
                     /note="Essential for recycling GMP and indirectly, cGMP"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_001048757.1"
                     /db_xref="GI:126172608"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="GeneID:4844147"
                     /translation="MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAP
                     RPGEVDGQHYHFVNVEQFKALIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLD
                     IDWQGAEQVKAVMPDAVGVFILPPSKAELERRLTGRGQDSSDVIASRMAQAVSEMSHY
                     KEYDFIIVNDDFDTALADLRAIIRSQRLTCASQIHAQNDMLNDLLAGQLS"
     misc_feature    complement(394438..394986)
                     /gene="gmk"
                     /locus_tag="Sbal_0355"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(394456..394977)
                     /gene="gmk"
                     /locus_tag="Sbal_0355"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(394750..394752,394765..394767,
                     394834..394836,394861..394863,394870..394872,
                     394891..394893,394942..394944,394960..394962))
                     /gene="gmk"
                     /locus_tag="Sbal_0355"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(394942..394944,394960..394962))
                     /gene="gmk"
                     /locus_tag="Sbal_0355"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            395248..396894
                     /locus_tag="Sbal_0356"
                     /db_xref="GeneID:4841989"
     CDS             395248..396894
                     /locus_tag="Sbal_0356"
                     /note="KEGG: shn:Shewana3_3809 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048758.1"
                     /db_xref="GI:126172609"
                     /db_xref="GeneID:4841989"
                     /translation="MLLKSLFCLHGRDSRPRFVAISVGVYVCIALAAAAFGANFLMYL
                     LALLGLPLLGLASLRRLADADKSKGLIGVFLLPLFIFIGLLTADVHIALIGLSLVLAA
                     GLTFWGWRFPAPTIVDYRYGYFGPELDAPTSQAMPRRRVEPTIVPKAAAKEIETQDVA
                     ARQAAKSTAHIQAQPQVERHEPHVEQSHAQAISAATASEPEVDLSAHVEPIASEPIVA
                     ESTVAEPIVASTMSAADAELEAQRQDELRFDALTRMTQNPADFVVPDSHADFRPANAS
                     RIEQTNIDLVDVDVANVDLKHVDFNAAQLDPAERSTEPGWRFAAEEDDEPDSFNDRDH
                     AEEVRQRRAEAKDSGSMTELFRGLFEFLAPLKRFFVLPKIKLPKLERRYWRPAGIGCG
                     VVVVLALVWGLWPNGDAETGDGAEVVTVNAIAPYAGERVTLALPDGFSVALEDDILIM
                     RWLGEKGKAQNLWSLATAKGDKTCSLLSFNNGTDYRPVTVDLKADSATEARFTPLDTQ
                     AIIVDLARRGSISLCGYKFSLKGSQAILEQNRTFGDYIAR"
     misc_feature    <395635..396066
                     /locus_tag="Sbal_0356"
                     /note="ribonuclease E; Reviewed; Region: rne; PRK10811"
                     /db_xref="CDD:236766"
     gene            397099..397971
                     /locus_tag="Sbal_0357"
                     /db_xref="GeneID:4845382"
     CDS             397099..397971
                     /locus_tag="Sbal_0357"
                     /note="KEGG: she:Shewmr4_3611 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048759.1"
                     /db_xref="GI:126172610"
                     /db_xref="GeneID:4845382"
                     /translation="MNTELTLVIMAAGLGSRFGGDKQLAALGPAGEPMLVLSIMSAIR
                     SGFQRAVLVIRPELETELTEILTRFLPADFAYHFCYQALTDLPEAAQLADISHRLKPW
                     GTAHALWSARHLVKGPMAVINADDFYGDSAFASLAKGLSMRPTEWMMVAYPIELTLSE
                     HGGVNRGLCQVENGQLKSVAEWLNIAEQAGELVGDGPQGHASLPPASLVSMTCWGFSP
                     SIFDVIKRELTEFIGQQDQQPKSECYLPAIVQAGIEQGLPVYVDVACEPWLGVTYPQD
                     TVWVKQKLTELLSD"
     misc_feature    397111..>397269
                     /locus_tag="Sbal_0357"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    397120..>397926
                     /locus_tag="Sbal_0357"
                     /note="Nucleoside-diphosphate-sugar pyrophosphorylase
                     involved in lipopolysaccharide biosynthesis/translation
                     initiation factor 2B, gamma/epsilon subunits
                     (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis,
                     outer membrane / Translation, ribosomal structure...;
                     Region: GCD1; COG1208"
                     /db_xref="CDD:224129"
     misc_feature    order(397126..397128,397132..397134,397252..397254)
                     /locus_tag="Sbal_0357"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            397964..399028
                     /locus_tag="Sbal_0358"
                     /db_xref="GeneID:4843369"
     CDS             397964..399028
                     /locus_tag="Sbal_0358"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: shm:Shewmr7_0333 aminoglycoside phosphotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_001048760.1"
                     /db_xref="GI:126172611"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="GeneID:4843369"
                     /translation="MIKLIRQSVLPHFGIEAAEAKISALGNGHINDTLLVRWPAGELV
                     LQRINTEVFKTPNALVSNADKISHHLCAKSLQQQYGLKVVSPCLTREGELAIDLGEQG
                     FWRAISYLPHSLSIEVVKSEQEAEMAAKAFGHFASALSDFDATQLEDVIPQFHHLPGR
                     MALLQQAAELDSQHRLDLCRHWVDYALSQQALLDELAEISPKLPLRICHNDTKINNML
                     FDKRDMSSMAIIDLDTCMKGHLMYDFGDMVRTFCSPEEEDSTALDKVEVRQDIFAAIC
                     RGYLSELGDVLTEDEKRSLWLGARVICLMIGVRFLTDYLNGDVYFHIHREGHNLDRAA
                     NQFTLYQSLLDQETVLKAHF"
     misc_feature    398024..398734
                     /locus_tag="Sbal_0358"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    <398201..>398695
                     /locus_tag="Sbal_0358"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     gene            399211..400626
                     /locus_tag="Sbal_0359"
                     /db_xref="GeneID:4843370"
     CDS             399211..400626
                     /locus_tag="Sbal_0359"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: she:Shewmr4_3609 twin-arginine translocation pathway
                     signal"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="YP_001048761.1"
                     /db_xref="GI:126172612"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:4843370"
                     /translation="MDSPVAQPLVTCSRRSERNSWLRCTLRRSQQEAVASSMMTATSD
                     NFFNAYAIFLGASLAQMGFVTGLPQLFGAISQLLSVWLASHFSRRTFIVFCAAFQACV
                     VLAMGALAAFGPEHAVWIFIALAVGYHGFINLIQPHWRAWMGSIVPERRRGTFFAART
                     RLTMGASLSVFFIGGGILTLTDSMQMAWLGFSLLFSIAAMGRFVSAWLLLQMHDPDPR
                     EPKQRGIFLQTIGHFREAWKDKVFRQYSLFVASMQGMVAISAPFFAVYMLEGLKFTYL
                     EFVFASVASIATQFVTLRFWGRFSDQFGNRLVMIITSCMIPSLPLMWLFSDNYLYILA
                     IQAFSGLAWSGFTLSTANYLYDIRPFRSDFATYAALQAALSAACVFVGAILGGTIASH
                     AADFLVWSGWDSVLSSPIFVVFLVSTVLRALVTLWFIPRSVEPKLRPRPQLLQLIFRI
                     RGFNAISGVSLDWLTVVKRRK"
     misc_feature    399310..400458
                     /locus_tag="Sbal_0359"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(399328..399330,399337..399345,399349..399354,
                     399403..399405,399412..399417,399424..399426,
                     399436..399441,399445..399450,399604..399609,
                     399616..399621,399628..399633,399640..399642,
                     399676..399681,399688..399690,399694..399696,
                     399712..399714,399967..399969,399976..399981,
                     399988..399993,400000..400002,400042..400044,
                     400054..400056,400066..400068,400075..400077,
                     400087..400089,400231..400233,400240..400245,
                     400252..400254,400264..400269,400276..400278,
                     400309..400314,400321..400326,400333..400338,
                     400345..400347)
                     /locus_tag="Sbal_0359"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    399370..400293
                     /locus_tag="Sbal_0359"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            complement(400639..401556)
                     /locus_tag="Sbal_0360"
                     /db_xref="GeneID:4844023"
     CDS             complement(400639..401556)
                     /locus_tag="Sbal_0360"
                     /note="KEGG: sfr:Sfri_3844 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048762.1"
                     /db_xref="GI:126172613"
                     /db_xref="GeneID:4844023"
                     /translation="MPDNANNSPITTHVQPTGNAKHTGHSQVATPDEMNPEQSSTLSS
                     EQASVEKQKVFIIGLPRTGTTSVSVALLEQGLKVAHMAFTKQAFMLADAISDVPCFSD
                     YRQLDGLFPQAKFVYLDREMAKWVPSMQMLLGKMLPHLEAKSGRFHPIMKRSFRHTFA
                     IDKVADPVDEAHLIACYQRHQNEVLAYFHGREDFITLDISHAGSLSRLLQFLGLTTDC
                     PTLGQVTDRAFSDSQIKSAPSQISQEGTSQAKAAVQPQPVNTSEHGLDFPKLNAGTHV
                     AAWHEYKHPNKVNSNSAGPQSRKFFDYTL"
     misc_feature    complement(<401050..401403)
                     /locus_tag="Sbal_0360"
                     /note="Sulfotransferase family; Region: Sulfotransfer_3;
                     pfam13469"
                     /db_xref="CDD:257793"
     gene            402200..403315
                     /locus_tag="Sbal_0361"
                     /db_xref="GeneID:4844778"
     CDS             402200..403315
                     /locus_tag="Sbal_0361"
                     /note="PFAM: filamentation induced by cAMP protein Fic;
                     KEGG: shm:Shewmr7_0336 filamentation induced by cAMP
                     protein Fic"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentation induced by cAMP protein fic"
                     /protein_id="YP_001048763.1"
                     /db_xref="GI:126172614"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="GeneID:4844778"
                     /translation="MWIWQQADWPKFHWNTSSIDALLRQVYFNQGQLLGKQMLSHDDS
                     LLTSDAALDTLLANIIHSSAIEGEKLNAASVRSSLAKKLGVTEDKPYPTTAQTDGLAD
                     IMLDALKNLETELTLERILGWHQQLFPQGYTLFNPVIGGTLRGDTPMQVVSGRIDKPT
                     VHFEAPSRATLDAELSQFIEWFNASRQDLGLDPLIRAAITHLWFVTLHPLDDGNGRIT
                     RLLTDLALAQAEKRSIRFYAMSVSILARRQAYYDILESTQRGDVDITPWLVWFFETLN
                     DCLLNAMADVSRTLSKTQYWQSVDQSLLSQEQAKVLNRMLDGDFELGINSSQYQKVAK
                     VSRATATRHLAQMVEQRFLVKADAGGRSTRYLLPSGK"
     misc_feature    402203..403294
                     /locus_tag="Sbal_0361"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    402203..402454
                     /locus_tag="Sbal_0361"
                     /note="Domain of unknown function (DUF4172); Region:
                     DUF4172; pfam13776"
                     /db_xref="CDD:205949"
     misc_feature    402542..402877
                     /locus_tag="Sbal_0361"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            403540..406707
                     /locus_tag="Sbal_0362"
                     /db_xref="GeneID:4842124"
     CDS             403540..406707
                     /locus_tag="Sbal_0362"
                     /note="PFAM: helicase domain protein; type III restriction
                     enzyme, res subunit;
                     SMART: DEAD-like helicases-like;
                     KEGG: son:SO0368 helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction enzyme, res subunit"
                     /protein_id="YP_001048764.1"
                     /db_xref="GI:126172615"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:4842124"
                     /translation="MEQVGIYEKLITQLVEKRLDKDIFFVGERKLEVAEASIWLSRFL
                     TKVIEYVINSVPADENQVINQISLANRLVMWLKEHINDDDFIDENLIDSQGRILTALF
                     NKQNPIATDLPKYTAAIFPLTGLTQSELFCGSNAGLSLESELKREIRSSDKIYWLVSF
                     IKWAGIRIFKNELEEFTRSGKELRIITTSYMGATDAKAVEFLASLPNTQVKLSYNTKR
                     ERLHAKSYLFLRNTGFHTGYIGSSNLSHSALTSGLEWNLKITTQEIPHIIEKSLSTFE
                     TYWESNEFELFSGDASSKEKLNNALKEAKGSGTESSSFHFDIKPFAHQREILEQLAVE
                     RSVHGRFKNLIVAATGTGKTIISAFDFARFYKLHPDANFLFVAHRQEILQQALSAYRG
                     VLKNNQFGELWVAEHKPNSYKHLFASIQSLNLQLDNLPLAADFYDYIVIDEVHHVAAS
                     SYRGLLAHFEPTILLGLTATPERHDGVDILADFCGVIAAEIRLPEAINQRHLCPFQYF
                     AIDDETDLRKLNWSRGRYDVAELSNLYTHNEQRVTRIIRSLAETVTDIGNIKALAFCV
                     TKEHAEFMAKKFNLDGISADVLTSDNSSERQQKRQSLVSGKLSILCVVDIFNEGVDIP
                     EVDTLLFLRPTESLTIFLQQLGRGLRLTDDKQCCTILDFVGNSRDEYDFSQKFRALVG
                     KTNQSIKDEILNDFPHLPLGCRIELEEKAQSMILRNISRATLNANRLTSLIASYKHQT
                     NLPLTLGNFLRLNPQVTLEDVYRIKINGQCGWTLLVEAIQGNQIAGPTAQSDLAKAYY
                     RAINFHLLSCTSLSYLIFIKQLCQNDFVFNGLDPIQNQFALMCHYNFWDKSGTALNVN
                     SLAASLLMLRNKPLQEELLAVLAILINRIHHQEMDLELALPSALKVHSRYTREQILAA
                     IGASTFTAKSPSREGVLAIHEQNLECLFVTLNKSEKQFSPTTMYHDYAISEHLFHWQS
                     QNSARPERGRGLSYIEQQKLGKTVLLFVREQSKDENGRTMGFVNFGKVHYVSHNGSQP
                     MNVTWRLEQPIPDVMWHDAAKLAVG"
     misc_feature    403951..404379
                     /locus_tag="Sbal_0362"
                     /note="N-terminal putative catalytic domain of
                     uncharacterized prokaryotic and archeal HKD family
                     nucleases fused to a DEAD/DEAH box helicase domain;
                     Region: PLDc_N_DEXD_b1; cd09203"
                     /db_xref="CDD:197297"
     misc_feature    403969..404376
                     /locus_tag="Sbal_0362"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    order(404197..404214,404254..404256,404260..404262,
                     404266..404268,404290..404304,404308..404310,
                     404314..404316)
                     /locus_tag="Sbal_0362"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197297"
     misc_feature    order(404203..404205,404209..404211,404260..404262,
                     404266..404268,404299..404301)
                     /locus_tag="Sbal_0362"
                     /note="putative active site [active]"
                     /db_xref="CDD:197297"
     misc_feature    404203..404205
                     /locus_tag="Sbal_0362"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197297"
     misc_feature    404485..405582
                     /locus_tag="Sbal_0362"
                     /note="DNA or RNA helicases of superfamily II
                     [Transcription / DNA replication, recombination, and
                     repair]; Region: SSL2; COG1061"
                     /db_xref="CDD:223989"
     misc_feature    404569..404952
                     /locus_tag="Sbal_0362"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    404587..404601
                     /locus_tag="Sbal_0362"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    404863..404874
                     /locus_tag="Sbal_0362"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    405127..405480
                     /locus_tag="Sbal_0362"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(405235..405246,405304..405309,405379..405387)
                     /locus_tag="Sbal_0362"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(405403..405405,405466..405468,405478..405480)
                     /locus_tag="Sbal_0362"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    405934..406692
                     /locus_tag="Sbal_0362"
                     /note="Domain of unknown function (DUF3427); Region:
                     DUF3427; pfam11907"
                     /db_xref="CDD:256717"
     gene            complement(406711..407607)
                     /locus_tag="Sbal_0363"
                     /db_xref="GeneID:4843283"
     CDS             complement(406711..407607)
                     /locus_tag="Sbal_0363"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: shn:Shewana3_3800 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_001048765.1"
                     /db_xref="GI:126172616"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:4843283"
                     /translation="MEHFSALPIFVTVVECGSFSLASQKLGLSKSAVSKRITLLEQSL
                     GIQLLHRTTRSLSLTEAGARYFDYVRPAVKLAADGLDAISELQQAPQGSLRIAVPMVF
                     GRLYIAPLIPEFLRRYPKIQLQMQMDDKTTDLIAGGFDLAIRIGELPDSSLIARKIAP
                     CLSVICASPEYLARHTVPHTPQQLSQHNCLFYSYFRDGVEWTFLSPQGPTRIQPNGNY
                     QVNNSDAIHQATLDGLGIANLPHFMVEADLQTGRLQALLTDHPLPEHGIYAVYPQRKY
                     LPTKVSVLIEFLMEKLAERLGK"
     misc_feature    complement(406714..407598)
                     /locus_tag="Sbal_0363"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(407422..407598)
                     /locus_tag="Sbal_0363"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(406744..407334)
                     /locus_tag="Sbal_0363"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(406807..406809,406888..406890,
                     406939..406941,407125..407127,407131..407133,
                     407173..407175,407290..407292,407302..407304))
                     /locus_tag="Sbal_0363"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(406912..406914,406921..406926,
                     406945..406959,407044..407046,407227..407247,
                     407251..407253,407263..407265,407272..407277,
                     407281..407286,407296..407301))
                     /locus_tag="Sbal_0363"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            407847..408584
                     /locus_tag="Sbal_0364"
                     /db_xref="GeneID:4842593"
     CDS             407847..408584
                     /locus_tag="Sbal_0364"
                     /EC_number="3.1.3.5"
                     /note="manganese-dependent 5'-nucleotidase; specific for
                     5'-UMP, 5'-dUMP, and 5'-dTMP; member of haloacid
                     dehalogenase (HAD)-like hydrolase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidase"
                     /protein_id="YP_001048766.1"
                     /db_xref="GI:126172617"
                     /db_xref="InterPro:IPR005833"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006402"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="GeneID:4842593"
                     /translation="MPLNGMGMGFSYFVRKRVPMSLPYQWILFDADETLFYFDALKGL
                     KLMFSEFGVDFTQADFDEYQLVNKPLWVDYQDGKITAAELQTIRFEPWAAKLAVTAMT
                     LNSAFLSAMAEICSPLPGARELLAALQGKAKLGIITNGFTELQTVRLERTGLQHHFDI
                     LVISEKVGIAKPDVGIFEHAFELMGYPERETVLMVGDNPHSDIQGGINAGIHTCWYNV
                     HGHDVPAGITPHYQVSSHQELHSLLFG"
     misc_feature    407916..408575
                     /locus_tag="Sbal_0364"
                     /note="HAD superfamily (subfamily IA) hydrolase,
                     TIGR02254; Region: YjjG/YfnB"
                     /db_xref="CDD:162788"
     misc_feature    408153..408491
                     /locus_tag="Sbal_0364"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    408258..408260
                     /locus_tag="Sbal_0364"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(408619..409257)
                     /locus_tag="Sbal_0365"
                     /db_xref="GeneID:4844884"
     CDS             complement(408619..409257)
                     /locus_tag="Sbal_0365"
                     /note="PFAM: helix-hairpin-helix motif; ERCC4 domain
                     protein;
                     SMART: Helix-hairpin-helix DNA-binding, class 1;
                     KEGG: sdn:Sden_0291 ERCC4"
                     /codon_start=1
                     /transl_table=11
                     /product="ERCC4 domain-containing protein"
                     /protein_id="YP_001048767.1"
                     /db_xref="GI:126172618"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="GeneID:4844884"
                     /translation="MAAAKIPLFYDDREHAEKIIYELSLHEDLSLIKKRLKLGDYQLK
                     DWIIERKTLPDLVQSLCDGRLFSQVARLAQSPNHTALLIEGCTQDIACYQIRREALIG
                     ALCSITINFYIPILRSLSQAETAKILYFCANQLNRREHELTLTGRKPKRTKNQQLFIL
                     QSLPEVGPKLANKLLCHFASVEAVVTASEEALMQVGGIGKNKASKIREVLTR"
     misc_feature    complement(408871..409227)
                     /locus_tag="Sbal_0365"
                     /note="ERCC4 domain; Region: ERCC4; pfam02732"
                     /db_xref="CDD:251501"
     misc_feature    complement(408628..408780)
                     /locus_tag="Sbal_0365"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     gene            409439..410572
                     /locus_tag="Sbal_0366"
                     /db_xref="GeneID:4843546"
     CDS             409439..410572
                     /locus_tag="Sbal_0366"
                     /note="KEGG: shm:Shewmr7_3560 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048768.1"
                     /db_xref="GI:126172619"
                     /db_xref="GeneID:4843546"
                     /translation="MSEYQYYRFECVNSSLSVPQRNRLRNISSRAEITSHSFCVQYHY
                     GDLSADPEALMMVFFDIGFYYTNWGQVNAYLKLPAGTIPSDFKAINADFYVSFVENKQ
                     NQLLIFTLEDDYRYRDDESAESFMLHLVALRTELLTGDYRALYFHWLSQANDDMALEP
                     LPLIAFDFQQLTQAQLAFTTLFDIPLPSIRALHLLLQSMPAHVPQTTVLTAQQQVAKL
                     TDAEKDALLCRLFDEGKIFAADAYALLRTQETPIEYSHWVTVASLHPFWHVAEKEVMQ
                     EDRMAEAERLARETLLRNEHLEAVYKAHQSHWDSAFEEAARGCASGYDNASRTLQVLF
                     DAYQLKQSSSEFKQNFDVFISKNKQRKALIKRLEPLQKIMLSL"
     gene            410962..411243
                     /locus_tag="Sbal_0367"
                     /db_xref="GeneID:4843547"
     CDS             410962..411243
                     /locus_tag="Sbal_0367"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: sdn:Sden_0306 transciptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001048769.1"
                     /db_xref="GI:126172620"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:4843547"
                     /translation="MKVTNAKQLSTYLKDARLNAHLTQSKVASKVGIRQDTVSSFELN
                     PDSTKLETLFKIFSALNLELDIKVRNPQLVDERRHDDATVPEQEWREEW"
     misc_feature    410983..>411237
                     /locus_tag="Sbal_0367"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    410998..411156
                     /locus_tag="Sbal_0367"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(411001..411003,411013..411015,411088..411090)
                     /locus_tag="Sbal_0367"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(411010..411012,411085..411087)
                     /locus_tag="Sbal_0367"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(411031..411036,411067..411069,411076..411078,
                     411088..411093)
                     /locus_tag="Sbal_0367"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            411243..411404
                     /locus_tag="Sbal_0368"
                     /pseudo
                     /db_xref="GeneID:4842754"
     gene            complement(411479..412342)
                     /locus_tag="Sbal_0369"
                     /db_xref="GeneID:4843445"
     CDS             complement(411479..412342)
                     /locus_tag="Sbal_0369"
                     /note="PFAM: YicC N-terminal domain protein; domain of
                     unknown function DUF1732;
                     KEGG: shm:Shewmr7_0351 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048770.1"
                     /db_xref="GI:126172621"
                     /db_xref="InterPro:IPR005229"
                     /db_xref="InterPro:IPR013527"
                     /db_xref="InterPro:IPR013551"
                     /db_xref="GeneID:4843445"
                     /translation="MIQSMTAYARIEHKAQWGTASWEIRSVNQRYLETYLRLPEQFRS
                     FEPVLRDRLRKRLSRGKVEVNLRYELADNSNNELQLNQALAKQLLGAANWLKQEAGQG
                     DVNLTDILRWPGVLASGEQDMDAIGADLMTAFDSAIDQFIEARGREGEAIKDMLLSRL
                     DGVSEQIAVVREHMPTVMLYQREKLTNRLAEIKGELDPARIEQEMVLLAQKQDVAEEM
                     DRLEAHVAEARRILKKGGSEGRRLDFMMQEFNRESNTLASKSISTEITSAAVELKVLI
                     EQMREQIQNVE"
     misc_feature    complement(411482..412342)
                     /locus_tag="Sbal_0369"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11820"
                     /db_xref="CDD:236993"
     misc_feature    complement(411878..412339)
                     /locus_tag="Sbal_0369"
                     /note="YicC-like family, N-terminal region; Region:
                     YicC_N; pfam03755"
                     /db_xref="CDD:252148"
     misc_feature    complement(411482..411739)
                     /locus_tag="Sbal_0369"
                     /note="Domain of unknown function (DUF1732); Region:
                     DUF1732; pfam08340"
                     /db_xref="CDD:254742"
     gene            412880..413593
                     /gene="rph"
                     /locus_tag="Sbal_0370"
                     /db_xref="GeneID:4845053"
     CDS             412880..413593
                     /gene="rph"
                     /locus_tag="Sbal_0370"
                     /EC_number="2.7.7.56"
                     /note="RNase PH; tRNA nucleotidyltransferase; forms
                     hexamers in Bacillus subtilis; phosphoroltic 3'-5'
                     exoribonuclease; involved in maturation of tRNA precursors
                     and removes terminal nucleotides near CCA acceptor arms of
                     mature tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="YP_001048771.1"
                     /db_xref="GI:126172622"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR002381"
                     /db_xref="GeneID:4845053"
                     /translation="MRPSNRTPAQTRPITITRQFTAHAEGSVLVEFGETKVLCTASFT
                     EGVPRFLKGQGQGWVTAEYGMLPRSTHSRMDREAARGKQSGRTQEIQRLIGRALRACV
                     DMKALGENTIVIDCDVIQADGGTRTASITGACVALVDALNWARGKGIIKSNPLKFLIA
                     AVSVGIYKGEAISDLEYIEDSAAETDMNVVMTETGKIIEIQGTAEGEPFSHEELLELL
                     ALAKNSIREIVDVQKAALN"
     misc_feature    412880..413587
                     /gene="rph"
                     /locus_tag="Sbal_0370"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    412907..413587
                     /gene="rph"
                     /locus_tag="Sbal_0370"
                     /note="Ribonuclease PH; Region: RNase_PH_bact; cd11362"
                     /db_xref="CDD:206767"
     misc_feature    order(412937..412951,412979..412981,412985..412987,
                     412991..412993,412997..412999,413003..413005,
                     413063..413065,413069..413071,413075..413092,
                     413096..413098,413105..413110,413132..413137,
                     413141..413146,413153..413155,413165..413167,
                     413174..413176,413216..413218,413222..413224,
                     413228..413230,413234..413242,413465..413479,
                     413483..413485,413489..413506,413510..413512,
                     413519..413524,413531..413536,413543..413545)
                     /gene="rph"
                     /locus_tag="Sbal_0370"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(413072..413074,413135..413137,413240..413257,
                     413417..413419,413435..413437)
                     /gene="rph"
                     /locus_tag="Sbal_0370"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            413770..414411
                     /gene="pyrE"
                     /locus_tag="Sbal_0371"
                     /db_xref="GeneID:4841622"
     CDS             413770..414411
                     /gene="pyrE"
                     /locus_tag="Sbal_0371"
                     /EC_number="2.4.2.10"
                     /note="involved in fifth step of pyrimidine biosynthesis;
                     converts orotidine 5'-phosphate and diphosphate to orotate
                     and 5-phospho-alpha-D-ribose 1-diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="YP_001048772.1"
                     /db_xref="GI:126172623"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR002375"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="GeneID:4841622"
                     /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRISPYFFNAGLFNTGR
                     DLARLGRFYAAALVDSGIDFDLLFGPAYKGIPIATTTAVALCEHHDIDIPYCFNRKEK
                     KDHGEGGSLVGSELKGRVMLVDDVITAGTAIRESMEIIEAHKAQLAGVLIALDRQEKG
                     KGELSAIQEVERDFGCGIVAIIKLADLISYLSEKPGMEVQLAAVSQYREQYGI"
     misc_feature    413914..414267
                     /gene="pyrE"
                     /locus_tag="Sbal_0371"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(413980..413982,413986..413988,414139..414147,
                     414151..414165,414235..414237)
                     /gene="pyrE"
                     /locus_tag="Sbal_0371"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(414589..415239)
                     /gene="folE"
                     /locus_tag="Sbal_0372"
                     /db_xref="GeneID:4844469"
     CDS             complement(414589..415239)
                     /gene="folE"
                     /locus_tag="Sbal_0372"
                     /EC_number="3.5.4.16"
                     /note="involved in the first step of tetrahydrofolate
                     biosynthesis; catalyzes the formation of formate and
                     2-amino-4-hydroxy-6-(erythro-1,2,
                     3-trihydroxypropyl)dihydropteridine triphosphate from GTP
                     and water; forms a homopolymer"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="YP_001048773.1"
                     /db_xref="GI:126172624"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="GeneID:4844469"
                     /translation="MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEI
                     LTLMSLDLSDDSLADTPRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDI
                     SLTSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVAL
                     QTLLETKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK"
     misc_feature    complement(414601..415152)
                     /gene="folE"
                     /locus_tag="Sbal_0372"
                     /note="GTP cyclohydrolase I; Provisional; Region: folE;
                     PRK09347"
                     /db_xref="CDD:236472"
     misc_feature    complement(order(414652..414654,414721..414723,
                     414889..414891,414895..414897))
                     /gene="folE"
                     /locus_tag="Sbal_0372"
                     /note="active site"
                     /db_xref="CDD:238351"
     gene            complement(415510..417498)
                     /locus_tag="Sbal_0373"
                     /db_xref="GeneID:4844861"
     CDS             complement(415510..417498)
                     /locus_tag="Sbal_0373"
                     /note="PFAM: peptidase S15; peptidase S9, prolyl
                     oligopeptidase active site domain protein; dienelactone
                     hydrolase;
                     KEGG: shm:Shewmr7_0355 peptidase S9, prolyl oligopeptidase
                     active site domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9 prolyl oligopeptidase"
                     /protein_id="YP_001048774.1"
                     /db_xref="GI:126172625"
                     /db_xref="InterPro:IPR000383"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002470"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="GeneID:4844861"
                     /translation="MKPFQLATLVTLCLPMLPLNTFAADTTASNTVLLAQQFSKGDEY
                     SNVKISPTGKYLSAITSVEGKNVLLVLDTQTKKLLNAIRFPSNAQVGDYEWANSERLV
                     LAKEYLKGWRDVPQYYGELLAINADGSRKAYLFGFESGEQQTGSNIKKNTAINATAFI
                     LDPLPDDERYMLVNAIPWNDRINLDFELSQDVYRVDLFTGVRKRITGSPIGQARFMTD
                     HQGEVRFVAGEDNKNITKVFYRKDGNWVNTDKLNLGLADFKPLSFTDDKNTIYAAGRS
                     QGETLGVYKINLETGDKTEIIQDENVDPSNFWINGTNKQLYAVEFENGYPSYAFVDNE
                     DSHAKLLKDLLGALPGHQVRIVSETRDAEKLVVVAFNDRNPGDYYIFDTKKLKLEYLA
                     AAKKWLDPEQMAEVKPISFTSRDGKQLHGYLTLPFGKEAKNLPLVVNPHGGPHGIRDW
                     WGFDPQNQYLASQGIAVLQVNFRGSGGYGDQFERAGYQKWGSEIQYDIIDGTQYVIDQ
                     GFADKERICIVGGSFGGYSALQSAVLAPDMFKCAIGVAGVYDLELMFDEGDVASRRSG
                     TSYLKDVLGQDKAVLKAMSPSENVDKLKANILLVHGGEDERAPIEQLESLEKGLKAHN
                     YPYQKLVMDNEGHGFYNDEHRAKYYEQMLSFLKTNLKL"
     misc_feature    complement(415516..417408)
                     /locus_tag="Sbal_0373"
                     /note="Dipeptidyl aminopeptidases/acylaminoacyl-peptidases
                     [Amino acid transport and metabolism]; Region: DAP2;
                     COG1506"
                     /db_xref="CDD:224423"
     misc_feature    complement(415516..416148)
                     /locus_tag="Sbal_0373"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:249771"
     gene            complement(417634..418227)
                     /gene="slmA"
                     /locus_tag="Sbal_0374"
                     /gene_synonym="ttk"
                     /db_xref="GeneID:4843466"
     CDS             complement(417634..418227)
                     /gene="slmA"
                     /locus_tag="Sbal_0374"
                     /gene_synonym="ttk"
                     /note="FtsZ binding protein; synthetically lethal with a
                     defect in the Min system; this protein is the first
                     identified nucleoid occlusion factor which works along
                     with the Min system to properly position the FtsZ ring
                     assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion protein"
                     /protein_id="YP_001048775.1"
                     /db_xref="GI:126172626"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:4843466"
                     /translation="MAVSPKINRREHILQCLAQMLETNPGQRITTAKLASEVGVSEAA
                     LYRHFPSKARMFEGLIEFIEESLLSRINLIMDDEKDTMKRCQLVLQLLLIFAERNPGI
                     SRVLNGDALLGENERLRSRISNLFAKIETQLKQILREKTLREGKGFNLDEAILANLLL
                     AFAEGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS"
     misc_feature    complement(417652..418227)
                     /gene="slmA"
                     /locus_tag="Sbal_0374"
                     /gene_synonym="ttk"
                     /note="division inhibitor protein; Provisional; Region:
                     slmA; PRK09480"
                     /db_xref="CDD:181894"
     misc_feature    complement(418051..418191)
                     /gene="slmA"
                     /locus_tag="Sbal_0374"
                     /gene_synonym="ttk"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(418262..418720)
                     /gene="dut"
                     /locus_tag="Sbal_0375"
                     /db_xref="GeneID:4845046"
     CDS             complement(418262..418720)
                     /gene="dut"
                     /locus_tag="Sbal_0375"
                     /EC_number="3.6.1.23"
                     /note="catalyzes the formation of dUMP from dUTP"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="YP_001048776.1"
                     /db_xref="GI:126172627"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="GeneID:4845046"
                     /translation="MKTPIELKILDSRIGSEFPLPAYATPGSAGMDLRAMIDTTLTIA
                     PGETVLIPTGIAIHVADQGLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCW
                     NRSDSPFALEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK"
     misc_feature    complement(418355..418636)
                     /gene="dut"
                     /locus_tag="Sbal_0375"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cd07557"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(418364..418366,418376..418378,
                     418385..418399,418409..418411,418415..418417,
                     418421..418423,418427..418429,418448..418450,
                     418457..418459,418475..418483,418499..418516,
                     418520..418522,418571..418573,418577..418582,
                     418595..418597,418631..418636))
                     /gene="dut"
                     /locus_tag="Sbal_0375"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(418427..418432,418442..418444,
                     418451..418459,418502..418510))
                     /gene="dut"
                     /locus_tag="Sbal_0375"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            complement(418717..419937)
                     /locus_tag="Sbal_0376"
                     /db_xref="GeneID:4845047"
     CDS             complement(418717..419937)
                     /locus_tag="Sbal_0376"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /note="KEGG: shn:Shewana3_3771 phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase;
                     TIGRFAM: phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase;
                     PFAM: flavoprotein; DNA/pantothenate metabolism
                     flavoprotein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase"
                     /protein_id="YP_001048777.1"
                     /db_xref="GI:126172628"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="GeneID:4845047"
                     /translation="MMSVSLTNKNVLLGIGGGIAAYKSADLVRRLKERGFDVRVVMSQ
                     SAMEFITPLTLQALSGHPVASSLLDPAAEAAMGHIELARWADLVIIAPATANLLARIN
                     AGMADELITTTCLATEAPIALCPAMNQQMYRNLATQANLTSLASRGFTLWGPASGSQA
                     CGEVGPGRMLEPLEIAELASNFFATKEVSALPLAGQSLLITAGPTREAIDPVRYISNH
                     SSGKMGFALAKAAADMGATVTLVSGPVNLSTPEGVIRIDVESAQNMLDAVMDNVDKKD
                     IFIGCAAVADYRISDIATCKIKKSAEEMQLALVRNPDILATVASLPNRPFVVGFAAET
                     HDVEAYARDKLKRKNLNMIAANDVSVAGLGFNADANALRVFWPHGSQDLPATDKLTLA
                     RQLLSLIVKEKTNT"
     misc_feature    complement(418735..419931)
                     /locus_tag="Sbal_0376"
                     /note="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Validated;
                     Region: PRK05579"
                     /db_xref="CDD:235513"
     misc_feature    complement(419380..419913)
                     /locus_tag="Sbal_0376"
                     /note="Flavoprotein; Region: Flavoprotein; cl19190"
                     /db_xref="CDD:267543"
     misc_feature    complement(418813..419361)
                     /locus_tag="Sbal_0376"
                     /note="DNA / pantothenate metabolizm flavoprotein; Region:
                     DFP; pfam04127"
                     /db_xref="CDD:252395"
     gene            420060..420737
                     /gene="radC"
                     /locus_tag="Sbal_0377"
                     /db_xref="GeneID:4845596"
     CDS             420060..420737
                     /gene="radC"
                     /locus_tag="Sbal_0377"
                     /note="Involved in DNA double-strand break repair and
                     recombination. Promotes the annealing of complementary
                     single-stranded DNA and by simulation of RAD51
                     recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="YP_001048778.1"
                     /db_xref="GI:126172629"
                     /db_xref="InterPro:IPR001405"
                     /db_xref="GeneID:4845596"
                     /translation="MGIKDWPEGEGPRDKLLQKGAGQLSDAELLAVLLRNGLAGLNAV
                     DLARSLISEFGGLRNLLCAPRNQVCRLPGVGPVKYAQLQAAAELARRVAQENLQRGQV
                     LTNPDLTRDYLMRQLADRSYEVFAVLLLDSQHRVIQFVELFRGTIDSASVYPREVVSL
                     VLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMVVGDREIVSF
                     AERGWIN"
     misc_feature    420060..420731
                     /gene="radC"
                     /locus_tag="Sbal_0377"
                     /note="hypothetical protein; Reviewed; Region: PRK00024"
                     /db_xref="CDD:178801"
     misc_feature    420387..420716
                     /gene="radC"
                     /locus_tag="Sbal_0377"
                     /note="Mov34/MPN/PAD-1 family; Region: MPN_DUF2466;
                     cd08071"
                     /db_xref="CDD:163702"
     misc_feature    order(420426..420428,420576..420578,420582..420584,
                     420606..420608,420615..420617)
                     /gene="radC"
                     /locus_tag="Sbal_0377"
                     /note="MPN+ (JAMM) motif; other site"
                     /db_xref="CDD:163702"
     misc_feature    order(420576..420578,420582..420584,420615..420617)
                     /gene="radC"
                     /locus_tag="Sbal_0377"
                     /note="Zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:163702"
     gene            420859..421095
                     /gene="rpmB"
                     /locus_tag="Sbal_0378"
                     /db_xref="GeneID:4843127"
     CDS             420859..421095
                     /gene="rpmB"
                     /locus_tag="Sbal_0378"
                     /note="required for 70S ribosome assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="YP_001048779.1"
                     /db_xref="GI:126172630"
                     /db_xref="InterPro:IPR001383"
                     /db_xref="GeneID:4843127"
                     /translation="MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEK
                     RFVQLRVSTKGIRLIDKKGIEVVVAELRARGEKV"
     misc_feature    420859..421086
                     /gene="rpmB"
                     /locus_tag="Sbal_0378"
                     /note="50S ribosomal protein L28; Reviewed; Region: rpmB;
                     PRK00359"
                     /db_xref="CDD:234736"
     gene            421102..421275
                     /gene="rpmG"
                     /locus_tag="Sbal_0379"
                     /db_xref="GeneID:4843296"
     CDS             421102..421275
                     /gene="rpmG"
                     /locus_tag="Sbal_0379"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group lack the CXXC motif"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="YP_001048780.1"
                     /db_xref="GI:126172631"
                     /db_xref="InterPro:IPR001705"
                     /db_xref="GeneID:4843296"
                     /translation="MAKAKGNREKIKLVSTAKTGHFYTTEKNKRNMPEKMEIKKFDPV
                     IRQHVIYKEAKIK"
     misc_feature    421108..421266
                     /gene="rpmG"
                     /locus_tag="Sbal_0379"
                     /note="50S ribosomal protein L33; Validated; Region: rpmG;
                     PRK00595"
                     /db_xref="CDD:179075"
     gene            421599..422918
                     /locus_tag="Sbal_0380"
                     /db_xref="GeneID:4845054"
     CDS             421599..422918
                     /locus_tag="Sbal_0380"
                     /EC_number="2.3.1.1"
                     /note="catalyzes the formation of N-acetyl-L-glutamate
                     from L-glutamate and acetyl-CoA in arginine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="YP_001048781.1"
                     /db_xref="GI:126172632"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR003006"
                     /db_xref="InterPro:IPR010167"
                     /db_xref="GeneID:4845054"
                     /translation="MRTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNHFRAILN
                     DVALLHSLGIKVVLVYGARPQIDAALAVNGIEPAYHEGVRITDEDSLKVIKQVAGALQ
                     FDITARLSMSLSNTPMQGAQINLVSGNFVIAQPLGVDNGIDFCLSGRVRRIDVQGLKR
                     QLDNHCIVLMGPIAASVTGESFNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNGDV
                     IAELMPNDAQNIMSKLAEQGSACVGTMAFLKASIDACRNGVPRCHLVSYLEDGALLQE
                     LFSREGIGTQIVTESAERLRCASIADIGGVLNLIRPLEEQGILVRRSREQLEIEIEQF
                     MLIERDGLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSLLLKNIINQARNRGYS
                     RLFALTTRSIHWFLEHGFVIEDVEALPQKKKQLYNYQRRSKILALDL"
     misc_feature    421599..422915
                     /locus_tag="Sbal_0380"
                     /note="N-acetylglutamate synthase; Validated; Region:
                     PRK05279"
                     /db_xref="CDD:235386"
     misc_feature    421611..422459
                     /locus_tag="Sbal_0380"
                     /note="AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like
                     domain of the NAG Synthase (NAGS) of the
                     arginine-biosynthesis pathway (ABP) found in gamma- and
                     beta-proteobacteria and higher plant chloroplasts. Domain
                     architecture of these NAGS consisted of an...; Region:
                     AAK_NAGS-ABP; cd04237"
                     /db_xref="CDD:239770"
     misc_feature    421623..421652
                     /locus_tag="Sbal_0380"
                     /note="putative feedback inhibition sensing region; other
                     site"
                     /db_xref="CDD:239770"
     misc_feature    order(421680..421682,421686..421694,422217..422222,
                     422229..422234)
                     /locus_tag="Sbal_0380"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239770"
     misc_feature    order(421680..421682,421686..421691,421779..421787,
                     422151..422159)
                     /locus_tag="Sbal_0380"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239770"
     misc_feature    422598..422783
                     /locus_tag="Sbal_0380"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(422685..422693,422721..422726)
                     /locus_tag="Sbal_0380"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            423038..423577
                     /locus_tag="Sbal_0381"
                     /db_xref="GeneID:4845155"
     CDS             423038..423577
                     /locus_tag="Sbal_0381"
                     /note="KEGG: son:SO4244 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048782.1"
                     /db_xref="GI:126172633"
                     /db_xref="GeneID:4845155"
                     /translation="MSPQYFELAPFTQTSIFSFIVLLLGLAGILLMLWLKNMPKIAKS
                     ASLGILLVMMGGFSWVFYQSNSAELVLTDTELTVDVPFYKVQLSRADLLPAEARIVDL
                     QQEADLTPSFKTNGIGMPGFQLGWFNLQGKGRAFLAITDKSQLVLVLVPTVKGYSLLL
                     TVPQGSEFLAQLQKSSSLL"
     misc_feature    423245..>423481
                     /locus_tag="Sbal_0381"
                     /note="Bacterial PH domain; Region: bPH_4; cl19751"
                     /db_xref="CDD:268104"
     gene            complement(423602..424486)
                     /locus_tag="Sbal_0382"
                     /db_xref="GeneID:4841367"
     CDS             complement(423602..424486)
                     /locus_tag="Sbal_0382"
                     /note="TIGRFAM: RarD protein, DMT superfamily transporter;
                     PFAM: protein of unknown function DUF6, transmembrane;
                     KEGG: son:SO4243 rarD protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter DMT superfamily protein"
                     /protein_id="YP_001048783.1"
                     /db_xref="GI:126172634"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004626"
                     /db_xref="GeneID:4841367"
                     /translation="MQDLEYRKGILLAVSAYCMWGFAPLYFKLLNHVSATEILLHRVI
                     WSFVFMLIIMQFIGGFSRLRLLFKQPKQLMVLTITSILIAGNWLLFIWAVNNDHMLDA
                     SLGYFINPLLNVLLGMLFLGERLRKLQWFAVALASAGVLIQLISFGSIPIVSLALAGT
                     FGFYALLRKKVNVDAKAGLLVETAVLLPVALIYLVATLDTATASMLTNDWQLNLMLMA
                     AGIVTTIPLLCFAGAAVRIPLSMLGFFQYIGPSIMFILAVSLFNEPFDAEKGVTFGFI
                     WSALLVFTLDMAYKRKAA"
     misc_feature    complement(423611..424486)
                     /locus_tag="Sbal_0382"
                     /note="putative chloramphenical resistance permease RarD;
                     Provisional; Region: PRK15430"
                     /db_xref="CDD:185328"
     misc_feature    complement(424061..424459)
                     /locus_tag="Sbal_0382"
                     /note="EamA-like transporter family; Region: EamA;
                     cl17759"
                     /db_xref="CDD:266818"
     gene            complement(424688..425152)
                     /locus_tag="Sbal_0383"
                     /db_xref="GeneID:4845040"
     CDS             complement(424688..425152)
                     /locus_tag="Sbal_0383"
                     /note="TIGRFAM: uncharacterized domain 1;
                     PFAM: thioesterase superfamily protein;
                     KEGG: she:Shewmr4_3591 uncharacterized domain 1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048784.1"
                     /db_xref="GI:126172635"
                     /db_xref="InterPro:IPR003736"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="GeneID:4845040"
                     /translation="MTSPIQAEALRRVAAVFDQHVPFHNLLGLDIKRYDIDGVEVVIN
                     MKPELIGNIHQQILHGGVTATVLDVVGGLTAFAGLVASRDDWTVEELQQRLQTLGTID
                     MRVDYLRPGRGLTFTGTGSVIRAGNRVSVCRMELHNEQGTHIAFGTGTYMVG"
     misc_feature    complement(424694..425077)
                     /locus_tag="Sbal_0383"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(424823..424834,424853..424855,
                     424979..424981))
                     /locus_tag="Sbal_0383"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(424832..424834,424838..424852,
                     424961..424963,424970..424972,424976..424978))
                     /locus_tag="Sbal_0383"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(424853..424855,424934..424939,
                     424946..424951,424973..424975))
                     /locus_tag="Sbal_0383"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            425592..427415
                     /locus_tag="Sbal_0384"
                     /db_xref="GeneID:4845041"
     CDS             425592..427415
                     /locus_tag="Sbal_0384"
                     /note="KEGG: shn:Shewana3_3763 ATP-dependent DNA helicase
                     RecQ;
                     TIGRFAM: ATP-dependent DNA helicase, RecQ family;
                     ATP-dependent DNA helicase RecQ;
                     PFAM: helicase domain protein; HRDC domain protein;
                     DEAD/DEAH box helicase domain protein;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="YP_001048785.1"
                     /db_xref="GI:126172636"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR006293"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:4845041"
                     /translation="MEKFVLDTHDDPLSQRLAQVFGYRDFRDGQREVIERVCGGQDCL
                     VIMPTGGGKSLCYQLPALLMDGITIVVSPLISLMKDQVDSLLQTGVAAAYLNSSLPRE
                     QSAEVLRQLRHGELKLLYVSPERLLSADFIERMQSLQLAMFAIDEAHCISQWGHDFRP
                     EYAALGQLKQLFPYVPMMALTATADQATRQSICERLGIDPFRLLSSFDRPNIRYTVAE
                     KLNAANQLRHFLTQQNGTNGIIYCSSRRRVDEVADRLCLQGFNAKAYHAGMTQEDRGA
                     VQDSFLKDQIDIVVATVAFGMGINKSNVRFVVHYDIPKSIEAYYQETGRAGRDGLDAE
                     AFMLFDPADIGRVRHLIEQSEPGPQQQVEFHKLNTMAAFAEAQTCRRQVLLHYFDESA
                     LEPCGNCDICLDPPKRYNGTEDAQKVLSCIFRLGQRFGINHLIEVLRGSKGAPIVDRG
                     HDKLTTWGIGKDKSHEYWLSVIRQLIHLGLASQDVTRGSSITLNPSARPVLKGEVALM
                     LAEPRIQLTTTKRKVSQSKAPLNYDRKLFARLKLLRRTIAEQQDVPPYLVFNDATLAE
                     MAAMMPTSAGEMLAVNGVGERKLSRFGDAFLDEIAAYLAGE"
     misc_feature    425634..427412
                     /locus_tag="Sbal_0384"
                     /note="ATP-dependent DNA helicase RecQ; Provisional;
                     Region: PRK11057"
                     /db_xref="CDD:182933"
     misc_feature    425712..426140
                     /locus_tag="Sbal_0384"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    425739..425753
                     /locus_tag="Sbal_0384"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    426027..426038
                     /locus_tag="Sbal_0384"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    426222..426605
                     /locus_tag="Sbal_0384"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(426318..426329,426387..426392,426465..426473)
                     /locus_tag="Sbal_0384"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(426489..426491,426552..426554,426564..426566,
                     426573..426575)
                     /locus_tag="Sbal_0384"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    426819..427094
                     /locus_tag="Sbal_0384"
                     /note="This DNA-binding domain is found in the RecQ
                     helicase among others and has a helix-turn-helix
                     structure; Region: RQC; smart00956"
                     /db_xref="CDD:214936"
     misc_feature    427188..427391
                     /locus_tag="Sbal_0384"
                     /note="HRDC domain; Region: HRDC; pfam00570"
                     /db_xref="CDD:249966"
     gene            complement(427397..429178)
                     /locus_tag="Sbal_0385"
                     /db_xref="GeneID:4842054"
     CDS             complement(427397..429178)
                     /locus_tag="Sbal_0385"
                     /note="SMART: Tetratricopeptide domain protein;
                     KEGG: she:Shewmr4_3589 response regulator receiver
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_001048786.1"
                     /db_xref="GI:126172637"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:4842054"
                     /translation="MDFRVLVLSLLLWLIPFGASAIDQLDELTELVYQYPSKALTQIT
                     ALEKQFTTRATSDINRLRLSVLKCQNLLQLGENEAAINVAQLGEANAKQLKLDQVRPY
                     FLICQADANLNYNNIQNALPLLDSAITLARRYQQPQALVDALRLRGQLDTDTDNFSSA
                     IEDLRLAIDIYPDIHTQTQNWVWPPQAYIYAAMGYLLYATHDFPQAMYYTNLGIQSSD
                     AKGKVLHIILRNAARIALDNQEFDYSDKLEKQAKALLPELGSPLELAYSYAILASIAL
                     DKGRIDTAEEYLSIAINTFKKHNQQLAMMRSTRLLAQIRFAQHQDDAALILMNHAIEQ
                     AENLKQYSDLKGFYGIMSDHYLEQGDFKQAYSFLLKRYRAAELANQGMNTARILQFKA
                     RLNQQDLQQDQNSTAPEKASILQELNLDWAYSTLFLIAMTLLGGAIWYLIDKQNNRAP
                     RIEGEEPAETLLQQVTSALNIAKQGNYPLSLLLFNASQIRQVDLPPLQDELQHRLREQ
                     DKLIRYSMDEIVIILPHTSAAGAKKVVNQLVACIQPWQGSSKVNIGIAAMQQFDTLES
                     LIKRASINQLGKVKISENNPNHYSPAK"
     misc_feature    complement(428054..>428377)
                     /locus_tag="Sbal_0385"
                     /note="Tetratricopeptide repeat; Region: TPR_21;
                     pfam09976"
                     /db_xref="CDD:255670"
     misc_feature    complement(427466..>427678)
                     /locus_tag="Sbal_0385"
                     /note="Class III nucleotidyl cyclases; Region:
                     Nucleotidyl_cyc_III; cl11967"
                     /db_xref="CDD:264492"
     misc_feature    complement(427628..427630)
                     /locus_tag="Sbal_0385"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     gene            429686..431254
                     /locus_tag="Sbal_0386"
                     /db_xref="GeneID:4845678"
     CDS             429686..431254
                     /locus_tag="Sbal_0386"
                     /EC_number="2.3.3.13"
                     /note="catalyzes the formation of 2-isopropylmalate from
                     acetyl-CoA and 2-oxoisovalerate in leucine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="YP_001048787.1"
                     /db_xref="GI:126172638"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005671"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="GeneID:4845678"
                     /translation="MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVME
                     VGFPVSSPGDFESVQTIARTIKNSRVCALSRALEKDIDAAAQALSVADQFRIHTFIST
                     STIHVESKLKRSFDQVLEMAVSAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEAAIL
                     AGARTINIPDTVGYTVPSEFGTIIQTLFNRVPNIDQAVISVHCHDDLGLSVANSITAV
                     QHGARQIECTINGIGERAGNCSLEEIAMILATRKGMLGLETGINAKEIHRTSNLVSQL
                     CNMPVQANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESIGLNRNNLNMTSRSGR
                     HVIKHRMEEMGYSEHDYNMDALYEEFLKLADKKGQVFDYDLEALAFMEAQAEEDNHYQ
                     LQQLVVQSDSTEGVATATVRIEVGGEIKTEAATGNGPVDAAYNAIARATDRRIDIISY
                     KLGAKGVGQNALGQVDITAVYHEQNFHGVGLATDVVEASARALVHVMNLTCRADKVAD
                     YKQSMQKNRELGGV"
     misc_feature    429686..431224
                     /locus_tag="Sbal_0386"
                     /note="2-isopropylmalate synthase; Validated; Region:
                     PRK00915"
                     /db_xref="CDD:234864"
     misc_feature    429704..430510
                     /locus_tag="Sbal_0386"
                     /note="2-isopropylmalate synthase (IPMS), N-terminal
                     catalytic TIM barrel domain; Region: DRE_TIM_IPMS;
                     cd07940"
                     /db_xref="CDD:163678"
     misc_feature    order(429722..429727,429734..429736,429815..429817,
                     429908..429910,429974..429976,430100..430102,
                     430106..430108,430190..430192,430196..430198,
                     430289..430291,430295..430297)
                     /locus_tag="Sbal_0386"
                     /note="active site"
                     /db_xref="CDD:163678"
     misc_feature    order(429722..429727,429815..429817)
                     /locus_tag="Sbal_0386"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163678"
     misc_feature    order(430289..430291,430295..430297)
                     /locus_tag="Sbal_0386"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163678"
     misc_feature    430790..431179
                     /locus_tag="Sbal_0386"
                     /note="LeuA allosteric (dimerisation) domain; Region:
                     LeuA_dimer; smart00917"
                     /db_xref="CDD:214910"
     gene            431325..432419
                     /locus_tag="Sbal_0387"
                     /db_xref="GeneID:4842049"
     CDS             431325..432419
                     /locus_tag="Sbal_0387"
                     /EC_number="1.1.1.85"
                     /note="catalyzes the oxidation of 3-isopropylmalate to
                     3-carboxy-4-methyl-2-oxopentanoate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="YP_001048788.1"
                     /db_xref="GI:126172639"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="GeneID:4842049"
                     /translation="MSYQVAVLAGDGIGPEVMAEARKVLREVEARFDLNIEYTQYDVG
                     GIAIDNHGCPLPDATLKGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFEL
                     FCNLRPAKLHDGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGENEEAF
                     DTMRYSRREISRIARIAFEAARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVE
                     LEHIYIDNATMQLLRRPDEFDVMLCSNLFGDILSDEIAMLTGSMGLLSSASMNSSGFG
                     LFEPAGGSAPDIAGKGVANPVAQILSAALMLRHSLKQEEAASAIERAVSKALNSGYLT
                     GELLSSDKRSEAKSTAEMGDFIANAIKEGV"
     misc_feature    431325..432413
                     /locus_tag="Sbal_0387"
                     /note="3-isopropylmalate dehydrogenase; Provisional;
                     Region: PRK00772"
                     /db_xref="CDD:234832"
     gene            432419..433825
                     /locus_tag="Sbal_0388"
                     /db_xref="GeneID:4844388"
     CDS             432419..433825
                     /locus_tag="Sbal_0388"
                     /EC_number="4.2.1.33"
                     /note="dehydratase component, catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate"
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase large subunit"
                     /protein_id="YP_001048789.1"
                     /db_xref="GI:126172640"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="GeneID:4844388"
                     /translation="MTNAKTLYQKVWDAHIVASPEGEAPVIYVDRHLVHEVTSPQAFS
                     GLKVAGRKLRAPEKTFATMDHNTSTRSASLDALSPMARTQVETLAQNCKDFGVRLYDI
                     HHPNQGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTL
                     RQLKAKTMKIEVRGHVTDGVTAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSMEGR
                     MTVCNMAIEMGAKAGMVAPDQTTFDYLAGREFAPKDEDWAEAVAYWKAIKTDDGAVFD
                     AVVELDAADIAPQLTWGTNPGQVVAIDGKVPDPLNEANPSTRASMEKALEYIGLSAGT
                     QMTDISINKVFIGSCTNSRIEDLRSAAVHAKGRKVASGVTAIVVPGSGQVKAQAEAEG
                     LDKIFIEAGFEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPA
                     MAAAAAVAGHFVDIRKPY"
     misc_feature    432509..433765
                     /locus_tag="Sbal_0388"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    order(432521..432523,432530..432532,432806..432811,
                     433655..433657,433712..433714,433727..433729)
                     /locus_tag="Sbal_0388"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    order(432812..432814,433463..433465,433643..433645,
                     433652..433657,433709..433711)
                     /locus_tag="Sbal_0388"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            433853..434458
                     /gene="leuD"
                     /locus_tag="Sbal_0389"
                     /db_xref="GeneID:4842174"
     CDS             433853..434458
                     /gene="leuD"
                     /locus_tag="Sbal_0389"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis; forms a heterodimer of LeuC/D"
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase small subunit"
                     /protein_id="YP_001048790.1"
                     /db_xref="GI:126172641"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="GeneID:4842174"
                     /translation="MQPFTTHTGLAVMIDSTNIDTDQIIPKQFLSKVTRDGFGVHLFH
                     DWRYLDDAGDQPNPEFSLNQSRYRGASILLAQENFGCGSSREHAPWALADFGLRAIIA
                     QSFADIFYGNSINNGLLPVALTHAQVRQLMDEVAAEAGAQITVDLTSCKVVSPSGAEF
                     SFTLAESARHKLLNGLDAIGLTLSHAAQIGQYETQIQGWRR"
     misc_feature    433904..434293
                     /gene="leuD"
                     /locus_tag="Sbal_0389"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    434099..434107
                     /gene="leuD"
                     /locus_tag="Sbal_0389"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            434992..436341
                     /locus_tag="Sbal_0390"
                     /db_xref="GeneID:4841409"
     CDS             434992..436341
                     /locus_tag="Sbal_0390"
                     /note="PFAM: membrane protein involved in aromatic
                     hydrocarbon degradation;
                     KEGG: shn:Shewana3_3757 membrane protein involved in
                     aromatic hydrocarbon degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic hydrocarbon degradation membrane
                     protein"
                     /protein_id="YP_001048791.1"
                     /db_xref="GI:126172642"
                     /db_xref="InterPro:IPR005017"
                     /db_xref="GeneID:4841409"
                     /translation="MQKRLLTLAVTAALLSSTTQLHAAGFQLAEYSATGLGRAFAGEA
                     AMADNASAQARNPAMLTYLEGRQLSTGGIYVMPNVDVTGDVSISSPLLGPDPVVMKGG
                     DALDVADDALVPNFYYSNQLNDQWTWGLAVNSNYGLATELPATHAAAIFGNKTSVTTV
                     EFNPNIAYRINDAVSVGAGVRIVYGEGEIGASLPGWVDGIKPALPAPVQAVLPPGGTE
                     LKSMKGDDVGYGWQLGASWQINPAHRLGFAYHSGVQLDLDGHASGVLYTGGQDVSIEG
                     YLPLELPAFAEIASHHQLTDNWAMHASVNWTDWSVFDQLVAYFPGDVKPKGDLESDLV
                     KEEHFEDNWRFALGTTYQVNNDWLVRAGVALDKTAANDEWRTTTIPDSDRLWFSVGAG
                     YQATKNLNVDFAVTYIKATGDAPINEQQNLLGLAAVNFNGEASGDVWLAGIQMSYKM"
     misc_feature    434992..436335
                     /locus_tag="Sbal_0390"
                     /note="Long-chain fatty acid transport protein [Lipid
                     metabolism]; Region: FadL; COG2067"
                     /db_xref="CDD:224978"
     gene            436535..438019
                     /locus_tag="Sbal_0391"
                     /db_xref="GeneID:4844546"
     CDS             436535..438019
                     /locus_tag="Sbal_0391"
                     /note="TIGRFAM: glycerol kinase;
                     PFAM: carbohydrate kinase, FGGY;
                     KEGG: shn:Shewana3_3756 glycerol kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_001048792.1"
                     /db_xref="GI:126172643"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="GeneID:4844546"
                     /translation="MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGW
                     VEHDPMEIWASQSSVLVEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIV
                     WQCRRSSEICEQLKAQGLEEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGEL
                     LFGTIDTWLVWKLTEGKVHVTDPTNAARTLLFNIHSLTWDNKLLEALDIPLSLLPEVK
                     PSCSVYGTTRIAGEGSEIQVAGMAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGT
                     KAVRSNHGLLTTVAVGPKGEVNYALEGSVFMGGATIQWLRDELGLIRDASDTEYFASK
                     VADTNGVYLVPAFVGLGAPYWDPNARGALFGLTRGANRNHIIRAALESIAYQSKDLLD
                     AMTKDSGVSLKRLKVDGGAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAV
                     GFWESVIELEHKACIDKHFIPNIDAETRVRLYAGWQDAVARTRA"
     misc_feature    436535..438016
                     /locus_tag="Sbal_0391"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    436547..438004
                     /locus_tag="Sbal_0391"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    order(436547..436552,436556..436558,436562..436564,
                     436571..436576,436583..436585,436589..436591,
                     436595..436600,436607..436609,436613..436615,
                     436661..436663,436757..436783,436841..436846,
                     436850..436852,436859..436861,436871..436873,
                     436907..436909,436916..436927,436931..436933,
                     436937..436942,437081..437086,437093..437098,
                     437114..437119,437123..437125,437189..437200,
                     437249..437254,437270..437275,437330..437332,
                     437339..437341,437366..437368,437372..437374,
                     437390..437410,437423..437425,437429..437431,
                     437438..437440,437444..437446,437450..437455,
                     437471..437473,437576..437578,437597..437599,
                     437603..437608,437612..437614,437840..437842,
                     437846..437854,437858..437863,437867..437884,
                     437888..437893)
                     /locus_tag="Sbal_0391"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(436562..436564,436568..436576,436583..436585,
                     436778..436786,436841..436843,436937..436939,
                     437264..437269,437324..437332,437339..437341,
                     437459..437464,437468..437473,437507..437512,
                     437516..437518,437759..437767,437774..437776)
                     /locus_tag="Sbal_0391"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    order(436562..436564,436568..436576,436583..436585,
                     437324..437332,437459..437464,437468..437473,
                     437507..437512,437516..437518,437759..437767,
                     437774..437776)
                     /locus_tag="Sbal_0391"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(436562..436564,436571..436573,437264..437266)
                     /locus_tag="Sbal_0391"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    order(436562..436564,437264..437266)
                     /locus_tag="Sbal_0391"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(436571..436573,436778..436786,436841..436843,
                     436937..436939,437264..437269,437339..437341)
                     /locus_tag="Sbal_0391"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(436631..436633,436682..436684,436691..436696,
                     436706..436708,436715..436720,436817..436819,
                     437048..437050,437057..437059,437216..437221)
                     /locus_tag="Sbal_0391"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(436649..436651,436658..436660,436667..436669,
                     436844..436846,437453..437455,437462..437464,
                     437471..437476,437483..437485,437552..437554,
                     437558..437560,437573..437575,437612..437638,
                     437648..437650,437657..437659)
                     /locus_tag="Sbal_0391"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(437228..437233,437237..437239)
                     /locus_tag="Sbal_0391"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(437735..437737,437741..437743,437945..437947,
                     437951..437953,437957..437968,437972..437974)
                     /locus_tag="Sbal_0391"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            complement(438191..438520)
                     /locus_tag="Sbal_0392"
                     /db_xref="GeneID:4844547"
     CDS             complement(438191..438520)
                     /locus_tag="Sbal_0392"
                     /note="KEGG: shm:Shewmr7_0374 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048793.1"
                     /db_xref="GI:126172644"
                     /db_xref="GeneID:4844547"
                     /translation="MSGLDSIYAMLAQPVKAVLHPKRVVDKVSSATANAPDSHETPQS
                     QLPPTLEGRDAKVRERRKDADNNKNKKRRASDEPEELKEGVVLEVTDDTAEIKKPPSQ
                     HIIDVEV"
     gene            439258..439716
                     /locus_tag="Sbal_0393"
                     /db_xref="GeneID:4843232"
     CDS             439258..439716
                     /locus_tag="Sbal_0393"
                     /note="MraZ; UPF0040; crystal structure shows similarity
                     to AbrB"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein MraZ"
                     /protein_id="YP_001048794.1"
                     /db_xref="GI:126172645"
                     /db_xref="InterPro:IPR003444"
                     /db_xref="GeneID:4843232"
                     /translation="MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSAC
                     LLLYPIHEWELIEAKLLKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYA
                     NLDKRIMLVGQLNKFELWDEQSWLQQIDECLETIRSEELASNERLADFSL"
     misc_feature    439258..439674
                     /locus_tag="Sbal_0393"
                     /note="cell division protein MraZ; Reviewed; Region:
                     PRK00326"
                     /db_xref="CDD:234728"
     misc_feature    439258..439485
                     /locus_tag="Sbal_0393"
                     /note="MraZ protein; Region: MraZ; pfam02381"
                     /db_xref="CDD:111290"
     misc_feature    439486..>439659
                     /locus_tag="Sbal_0393"
                     /note="MraZ protein; Region: MraZ; pfam02381"
                     /db_xref="CDD:111290"
     gene            439748..440689
                     /gene="mraW"
                     /locus_tag="Sbal_0394"
                     /db_xref="GeneID:4842176"
     CDS             439748..440689
                     /gene="mraW"
                     /locus_tag="Sbal_0394"
                     /note="TIGRFAM: S-adenosyl-methyltransferase MraW;
                     PFAM: methyltransferase;
                     KEGG: she:Shewmr4_3578 S-adenosyl-methyltransferase MraW"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-methyltransferase MraW"
                     /protein_id="YP_001048795.1"
                     /db_xref="GI:126172646"
                     /db_xref="InterPro:IPR002903"
                     /db_xref="GeneID:4842176"
                     /translation="MSQEFAHLSVLLAETVGGLNIKDDGIYIDGTFGRGGHSRQVLQQ
                     LGENGRLIAIDRDPQAIEAAKQFADDPRFQIVHGGFGQLADYVEELGLVGKIDGVLLD
                     LGVSSPQLDDAERGFSFMRDGPLDMRMDNSQGQTAAQWLARAEIEDMAWVFKTYGEEK
                     NARHIARCIAADRDKTPFLRTKDLADLIARITKSKERNKHPATRVFQAIRIYINSELD
                     QIDQALEGAVNVLAPQGRLSVISFHSLEDRIVKRFIRRHSQGESVPHGFPVTEDQINK
                     SRKLRAVGKAIMPSDEEIERNARARSSVLRIAERLDY"
     misc_feature    439760..440683
                     /gene="mraW"
                     /locus_tag="Sbal_0394"
                     /note="16S rRNA m(4)C1402 methyltranserfase; Provisional;
                     Region: PRK00050"
                     /db_xref="CDD:234597"
     gene            440700..441014
                     /locus_tag="Sbal_0395"
                     /db_xref="GeneID:4844567"
     CDS             440700..441014
                     /locus_tag="Sbal_0395"
                     /note="PFAM: cell division protein FtsL;
                     KEGG: she:Shewmr4_3577 cell division protein FtsL"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="YP_001048796.1"
                     /db_xref="GI:126172647"
                     /db_xref="InterPro:IPR007082"
                     /db_xref="InterPro:IPR011922"
                     /db_xref="GeneID:4844567"
                     /translation="MSKPSINLPRIVLHDLWLHKWILLLALLVLCNAVAVVYGSHISR
                     QLTTQWDQLLQERDRLDIEWRNLLLEEQSQTEHSRITRIASKELNMSRPLPSEEVVVK
                     VP"
     misc_feature    440721..441005
                     /locus_tag="Sbal_0395"
                     /note="Cell division protein FtsL; Region: FtsL;
                     pfam04999"
                     /db_xref="CDD:252934"
     gene            441028..442782
                     /locus_tag="Sbal_0396"
                     /db_xref="GeneID:4843933"
     CDS             441028..442782
                     /locus_tag="Sbal_0396"
                     /EC_number="2.4.1.129"
                     /note="PFAM: penicillin-binding protein, transpeptidase;
                     Penicillin-binding protein, dimerisation domain;
                     KEGG: shn:Shewana3_3749 succinate dehydrogenase
                     (ubiquinone)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan glycosyltransferase"
                     /protein_id="YP_001048797.1"
                     /db_xref="GI:126172648"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR005311"
                     /db_xref="GeneID:4843933"
                     /translation="MTRQAKIKRVSKPQKPQLIHWRLYVVVGFVCTLFCSLVGRAAYI
                     QIIEPDKLRHESDMRTLRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNG
                     FADMRRWQALADVLHEPVEDILDRVRSNPTKRFTYLKRQITPAVADYITQLKLPGVFL
                     KSESRRYYPGGEITAQLIGITNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVE
                     RLDIIQEGESPNDLVLSIDQRIQQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMV
                     NTPSYNPNARDNLQTFRMRNRAMTDTFEPGSTIKPFVVAAALEAGTVKSTDIIATSPG
                     WMRLGGRQVRDPANYGDMSLARILAKSSNVGISKLALSIPVQQLLGTYQSMGLGSFSG
                     INLTGESAGVIQDRHRWSDFERATLSFGYGLTATTLQLARMYATLGNGGTLFPVSIMK
                     LKKPPVGERVISEDVAHDVMQMLVGVTEKGGTGTLAHIDGYPVAGKSGTSRKAVAGGY
                     GDDYVALFAGVAPANNPKLAIVVVVNEPKGDLYYGGSVAGPAFAKVMSGALQMLNVEP
                     ITDKEQVQLAGIAAGRAE"
     misc_feature    441031..442725
                     /locus_tag="Sbal_0396"
                     /note="peptidoglycan synthase FtsI; Provisional; Region:
                     PRK15105"
                     /db_xref="CDD:185060"
     misc_feature    441226..441690
                     /locus_tag="Sbal_0396"
                     /note="Penicillin-binding Protein dimerization domain;
                     Region: PBP_dimer; pfam03717"
                     /db_xref="CDD:252119"
     misc_feature    441805..442692
                     /locus_tag="Sbal_0396"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; pfam00905"
                     /db_xref="CDD:250215"
     gene            442779..444278
                     /gene="murE"
                     /locus_tag="Sbal_0397"
                     /db_xref="GeneID:4844666"
     CDS             442779..444278
                     /gene="murE"
                     /locus_tag="Sbal_0397"
                     /note="involved in cell wall formation; peptidoglycan
                     synthesis; cytoplasmic enzyme; catalyzes the addition of
                     meso-diaminopimelic acid to the nucleotide precursor
                     UDP-N-aceylmuramoyl-l-alanyl-d-glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
                     6-diaminopimelate ligase"
                     /protein_id="YP_001048798.1"
                     /db_xref="GI:126172649"
                     /db_xref="InterPro:IPR000713"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR005761"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:4844666"
                     /translation="MMLLRDLLAPWLHYAGAQSFNDLTLDSRAIRRGDVFLALPGHKV
                     DGRQFIEKVLDLGAAAVLVHTDDADQHGKVLHSDNAEHGVQIYFFQLSRQVSAIAAQR
                     YPLAHQSATTSLGVIGITGTNGKTSTSQLIAQLITSLGRKAAVMGTLGNGLWGELVDS
                     GNTTADAITLMRQLHDFEAQGASVCAMEVSSHGLVQGRVDAVSFDVAVFTNLTRDHLD
                     YHGDMESYAAAKQSLFRFSTLGHGLLNLDDAVGASWLTELKSVPAQMWGFSIEGHQAA
                     AFYTKNAKFDDQGVSATLVWPEGETEIHSPLLGAFNLSNLLAALSALYLQGFDMKALA
                     EQVQYLTPVAGRMERFTTANNITLVVDYAHTPDAIEQALNALRRHCAGDLWCVFGCGG
                     DRDKGKRPLMGKAAEQYADRIMVTSDNARSEDPAQIITDIIQGLTHPQQALTQVDRIA
                     AIKEVVALAKPGDVILLAGKGHETYQEAAGVRHDYDERALARQLSEQSR"
     misc_feature    442779..444269
                     /gene="murE"
                     /locus_tag="Sbal_0397"
                     /note="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
                     6-diaminopimelate ligase; Provisional; Region: murE;
                     PRK00139"
                     /db_xref="CDD:234660"
     misc_feature    442845..443087
                     /gene="murE"
                     /locus_tag="Sbal_0397"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    443133..443711
                     /gene="murE"
                     /locus_tag="Sbal_0397"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    443805..444065
                     /gene="murE"
                     /locus_tag="Sbal_0397"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            444275..445657
                     /locus_tag="Sbal_0398"
                     /db_xref="GeneID:4845808"
     CDS             444275..445657
                     /locus_tag="Sbal_0398"
                     /note="TIGRFAM:
                     UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
                     6-diaminopimelate--D-alanyl-D-alanyl ligase;
                     PFAM: cytoplasmic peptidoglycan synthetase domain protein;
                     cytoplasmic peptidoglycan synthetases domain protein; Mur
                     ligase, middle domain protein;
                     KEGG: son:SO4223
                     UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
                     6-diaminopimelate--D-alanyl- D-alanine ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
                     6-diaminopimelate--D-alanyl-D-alanyl ligase"
                     /protein_id="YP_001048799.1"
                     /db_xref="GI:126172650"
                     /db_xref="InterPro:IPR000713"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR005863"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:4845808"
                     /translation="MIPLSLETLSQHLGMFRVGDDVTIEDLSSDSRKIGAATLFVALK
                     GERFDGHDFAATAIENGAAALMVERELAFDIPQLIVPDCQKAMGAIGAYVRDQINPIC
                     VALTGSNGKTSVKEMIATILSAKHQILYTAGNFNNEIGVPLTLLRLTPADEFGIFELG
                     ANHKGEIDYTSGLVRPNVALVNNVGSAHLEGFGSQAGVAQAKSEIFNHLQADGTAIIN
                     ADDAFADFMSVKARPYKQLSFSQQDGAAKRHIDVIATGHKTNADGCYRFMLNYSGESC
                     QVVLPLAGRHQVSNALAAASVCIALGLNLTEIAEGLSQLTPVKGRMQPSQLGRVRLID
                     DSYNANPVSVGAAIAWLKEISENRCLVLGDLGELGDNAPLLHAELGQLAKQQGIDALF
                     CTGTLSQHTSQAFGAEHYDSVATLVEKLIKHINQLPGQVTVLVKGSRSAAMERVVDGL
                     TVAFGRGELV"
     misc_feature    444275..445624
                     /locus_tag="Sbal_0398"
                     /note="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
                     ligase; Reviewed; Region: murF; PRK10773"
                     /db_xref="CDD:182718"
     misc_feature    444341..444559
                     /locus_tag="Sbal_0398"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    444590..445168
                     /locus_tag="Sbal_0398"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    445226..445453
                     /locus_tag="Sbal_0398"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            445658..446740
                     /gene="mraY"
                     /locus_tag="Sbal_0399"
                     /db_xref="GeneID:4843063"
     CDS             445658..446740
                     /gene="mraY"
                     /locus_tag="Sbal_0399"
                     /EC_number="2.7.8.13"
                     /note="First step of the lipid cycle reactions in the
                     biosynthesis of the cell wall peptidoglycan"
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="YP_001048800.1"
                     /db_xref="GI:126172651"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="InterPro:IPR003524"
                     /db_xref="GeneID:4843063"
                     /translation="MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALVFSLWFGPKL
                     IERLQLLQIGQVVRNDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVML
                     FVLGSFGLIGFIDDYRKVVRKDTKGLIARWKYILQSLAALLIAFFLYATAANPGETQL
                     VVPFFKDVMPQLGAVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYL
                     SGHAQFANYLHIPHLPGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAA
                     LGTIAVLVRQEILLVIMGGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWP
                     EPRVIVRFWIISIFLVLLGLATLKLR"
     misc_feature    445838..446725
                     /gene="mraY"
                     /locus_tag="Sbal_0399"
                     /note="Phospho-N-acetylmuramoyl-pentapeptide-transferase
                     (mraY) is an enzyme responsible for the formation of the
                     first lipid intermediate in the synthesis of bacterial
                     cell wall peptidoglycan. It catalyzes the formation of...;
                     Region: GT_MraY; cd06852"
                     /db_xref="CDD:133462"
     misc_feature    446000..446005
                     /gene="mraY"
                     /locus_tag="Sbal_0399"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133462"
     misc_feature    446447..446458
                     /gene="mraY"
                     /locus_tag="Sbal_0399"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133462"
     misc_feature    order(446606..446608,446624..446638)
                     /gene="mraY"
                     /locus_tag="Sbal_0399"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:133462"
     gene            446747..448066
                     /gene="murD"
                     /locus_tag="Sbal_0400"
                     /db_xref="GeneID:4843064"
     CDS             446747..448066
                     /gene="murD"
                     /locus_tag="Sbal_0400"
                     /note="UDP-N-acetylmuramoylalanine--D-glutamate ligase;
                     involved in peptidoglycan biosynthesis; cytoplasmic;
                     catalyzes the addition of glutamate to the nucleotide
                     precursor UDP-N-acetylmuramoyl-L-alanine during cell wall
                     formation"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
                     synthetase"
                     /protein_id="YP_001048801.1"
                     /db_xref="GI:126172652"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR005762"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:4843064"
                     /translation="MQNQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGAET
                     LATSFPDVKLISGGFDCRYLVQATQIIISPGIATYTPEVRAAVDMGIEVIGDVELFAR
                     EIADRKPCVIGITGSNGKSTVTTLVGEMAREAGIAVAVGGNIGVPALDLLHENADLFV
                     LELSSFQLETTHSLKCVVATCLNISEDHMDRYSDIAAYREAKLRLYKQSRAVLFNRDD
                     KLTVPPEPMNQNSFGLAAPETDEWGISDSKIYHGSSEIMPITEVSLIGSHNHANLLAA
                     MALVDVVGVDKQVMAKVARSFTGLSHRCEVVGIKNGVTYVNDSKATNVGATVAALDGL
                     SDHLGDIILIAGGDGKGADFKPLGVALAKVTHLITLGRDGKKIAALKDGAVRVETMAA
                     AVTKAAELATSGDIVLLSPACASLDMYSNFMARGDDFRNLVEQLNGE"
     misc_feature    446747..448060
                     /gene="murD"
                     /locus_tag="Sbal_0400"
                     /note="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
                     synthetase; Provisional; Region: murD; PRK03803"
                     /db_xref="CDD:235160"
     misc_feature    447086..447586
                     /gene="murD"
                     /locus_tag="Sbal_0400"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    447650..>447835
                     /gene="murD"
                     /locus_tag="Sbal_0400"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            448056..449267
                     /locus_tag="Sbal_0401"
                     /db_xref="GeneID:4843067"
     CDS             448056..449267
                     /locus_tag="Sbal_0401"
                     /note="TIGRFAM: cell division protein FtsW;
                     PFAM: cell cycle protein;
                     KEGG: shn:Shewana3_3744 cell division protein FtsW"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="YP_001048802.1"
                     /db_xref="GI:126172653"
                     /db_xref="InterPro:IPR001182"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR013437"
                     /db_xref="GeneID:4843067"
                     /translation="MASDVRQLSLFGRLRSAMPNWQRDTEVPGVQLYDRALLAAVLSL
                     IGFGFVMVMSASMPEAQTLTGNPFYFMTRHVGYLVGCLAIAAFVLRVEMQTWQRWSPM
                     LLLVVGLMLLAVLVVGTTVNGATRWLSIGPIRIQVAEVAKFAFAIYMAGYLVRRHQEV
                     RENAKGFYKPIAVFAIYAVLILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALIFAG
                     VLAFVALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQK
                     LEYLPEAHTDFIFAVIGEELGFIGIIAVLSVLLFVALRSIRLGNLCLAMDKPFEGYLG
                     YAIGIWVCFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMMLLRIDYERRM
                     TLVQAVQGRLK"
     misc_feature    448077..449246
                     /locus_tag="Sbal_0401"
                     /note="Cell cycle protein; Region: FTSW_RODA_SPOVE;
                     cl00511"
                     /db_xref="CDD:241915"
     gene            449267..450355
                     /gene="murG"
                     /locus_tag="Sbal_0402"
                     /db_xref="GeneID:4844103"
     CDS             449267..450355
                     /gene="murG"
                     /locus_tag="Sbal_0402"
                     /EC_number="2.4.1.227"
                     /note="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase; involved in cell wall
                     formation; inner membrane-associated; last step of
                     peptidoglycan synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyldiphospho-muramoylpentapeptide
                     beta-N- acetylglucosaminyltransferase"
                     /protein_id="YP_001048803.1"
                     /db_xref="GI:126172654"
                     /db_xref="InterPro:IPR004276"
                     /db_xref="InterPro:IPR006009"
                     /db_xref="InterPro:IPR007235"
                     /db_xref="GeneID:4844103"
                     /translation="MTPAGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADR
                     MEARLVPQYGFDIDFIDIKGVRGNGLIRKLAAPFKVVRSILQAKAVIAEFKPDVVLGM
                     GGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQVLCAFKNTFTTVKAKVV
                     GNPIRQELIALGAEPKPEADEALKVLVVGGSLGAKVFNDLMPEAVAILSQQQFVTVWH
                     QVGKDNLTGVKAAYQQHGQDGGVNIAEFIDDMEAAYRWADVVLCRAGALTVSELAAVG
                     LPSILVPYPHAVDDHQTRNGQVLVEAGAAFLLPQAILDVNKLAGKLQLLANDRTELAR
                     MGQRARDVAVLDATEQVAAVCISLAEKG"
     misc_feature    449282..450349
                     /gene="murG"
                     /locus_tag="Sbal_0402"
                     /note="undecaprenyldiphospho-muramoylpentapeptide beta-N-
                     acetylglucosaminyltransferase; Provisional; Region: murG;
                     PRK00726"
                     /db_xref="CDD:234825"
     misc_feature    449285..450328
                     /gene="murG"
                     /locus_tag="Sbal_0402"
                     /note="MurG is an N-acetylglucosaminyltransferase, the
                     last enzyme involved in the intracellular phase of
                     peptidoglycan biosynthesis. It transfers
                     N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4
                     hydroxyl of a lipid-linked N-acetylmuramoyl
                     pentapeptide...; Region: GT1_MurG; cd03785"
                     /db_xref="CDD:99961"
     misc_feature    order(449315..449317,449645..449647,449837..449839,
                     449921..449923,450002..450004,450014..450016,
                     450059..450070,450077..450079,450116..450118,
                     450137..450142,450149..450151)
                     /gene="murG"
                     /locus_tag="Sbal_0402"
                     /note="active site"
                     /db_xref="CDD:99961"
     misc_feature    order(449486..449488,449495..449497,449528..449530,
                     449612..449614,449687..449689)
                     /gene="murG"
                     /locus_tag="Sbal_0402"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99961"
     gene            450358..451824
                     /gene="murC"
                     /locus_tag="Sbal_0403"
                     /db_xref="GeneID:4844708"
     CDS             450358..451824
                     /gene="murC"
                     /locus_tag="Sbal_0403"
                     /note="Catalyzes the formation of
                     UDP-N-acetylmuramoyl-L-alanine from UDP-N-acetylmuramate
                     and L-alanine in peptidoglycan synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="YP_001048804.1"
                     /db_xref="GI:126172655"
                     /db_xref="InterPro:IPR000713"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR005758"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:4844708"
                     /translation="MTKTERYAQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEG
                     YQVSGSDIAQNAVTDRLCLLGAKIQIGHAAENVQQVDVVVVSTAINLENPEILAAKEL
                     RIPIVRRAEMLAELMRYRHGVAIAGTHGKTTTTSLIASVYGQAGRDPTFVIGGLLNSA
                     GTNARLGTSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDF
                     LHNLPFYGVAVVCIDDAVVREIMPRIGRQLVTYGFSDDADVQALNFSQQGHQCRFTVR
                     RKGKADLDLVLNLPGQHNVLNALAAIAVATEDEIDDSAITQALVEFQGIGRRFQHLGK
                     FATPKGEVMLVDDYGHHPSEVAATIKAARAGWPDKRLVMAYQPHRYTRTRDLYEDFVE
                     VLSQVDCLLLLDVYSAGEAPITGADGRALCRSIRLRGQLDPIFIASPDQLAEVLPDVL
                     QEGDLLLTQGAGNIGALSRLLATTELGFAVAELPAQAS"
     misc_feature    450397..451773
                     /gene="murC"
                     /locus_tag="Sbal_0403"
                     /note="UDP-N-acetylmuramate--L-alanine ligase;
                     Provisional; Region: murC; PRK00421"
                     /db_xref="CDD:234757"
     misc_feature    450421..450720
                     /gene="murC"
                     /locus_tag="Sbal_0403"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    450730..451272
                     /gene="murC"
                     /locus_tag="Sbal_0403"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    451330..451596
                     /gene="murC"
                     /locus_tag="Sbal_0403"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            451937..452725
                     /locus_tag="Sbal_0404"
                     /db_xref="GeneID:4843217"
     CDS             451937..452725
                     /locus_tag="Sbal_0404"
                     /note="PFAM: cell division protein FtsQ;
                     Polypeptide-transport-associated domain protein,
                     FtsQ-type;
                     KEGG: son:SO4217 cell division protein FtsQ"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="YP_001048805.1"
                     /db_xref="GI:126172656"
                     /db_xref="InterPro:IPR005548"
                     /db_xref="InterPro:IPR013685"
                     /db_xref="GeneID:4843217"
                     /translation="MSWSDKRRHWRARMSRVNWYLWSGAGFLFFIVASFVFGGYQLHK
                     FLNDASTLPIEAVAIKGERAYTTDKDIQVALQDLMQRSFFSADITLVQQALEDLPWVY
                     RASVRREWPAKLRVYLQEQQPAAHWNGDSWLNVHGEVFEAPSHPELEHLPQLSGPDDM
                     GLEVLTVYAQINSLLKINGFTLASLYLTPRHAWHATLGNGIVLDLGREDKIARIQRFI
                     TVYPVLAKQEKSVARVDLRYDTGLAVGWGDAQTREPIINDQKPR"
     misc_feature    451967..452701
                     /locus_tag="Sbal_0404"
                     /note="cell division protein FtsQ; Provisional; Region:
                     PRK10775"
                     /db_xref="CDD:182720"
     misc_feature    452096..452299
                     /locus_tag="Sbal_0404"
                     /note="POTRA domain, FtsQ-type; Region: POTRA_1;
                     pfam08478"
                     /db_xref="CDD:254821"
     misc_feature    452306..452647
                     /locus_tag="Sbal_0404"
                     /note="Cell division protein FtsQ; Region: FtsQ;
                     pfam03799"
                     /db_xref="CDD:252171"
     gene            452706..453941
                     /locus_tag="Sbal_0405"
                     /db_xref="GeneID:4843823"
     CDS             452706..453941
                     /locus_tag="Sbal_0405"
                     /note="PFAM: cell division protein FtsA;
                     KEGG: shn:Shewana3_3740 cell division protein FtsA"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="YP_001048806.1"
                     /db_xref="GI:126172657"
                     /db_xref="InterPro:IPR003494"
                     /db_xref="GeneID:4843823"
                     /translation="MIKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSR
                     GMDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDE
                     EVTQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHI
                     VTCANDMAKNITKSVERCGLKVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDI
                     AVYTNGALRHCAVVPVAGNQVTNDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIE
                     VPSVGGRPSRSMSRHTLAEVVEPRYQELFELVLKELKDSGLEDQIAAGIVLTGGTASI
                     QGVVDIAEATFGMPVRVASPLPIKGLYEYVDQSIYSTGVGLLHYGARRVIERQFERPE
                     RQGVTSAWNRVQSWFKGEF"
     misc_feature    452706..453938
                     /locus_tag="Sbal_0405"
                     /note="cell division protein FtsA; Reviewed; Region: ftsA;
                     PRK09472"
                     /db_xref="CDD:181887"
     misc_feature    452736..453401
                     /locus_tag="Sbal_0405"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(452745..452756,452760..452762,452766..452768,
                     453267..453269,453333..453344)
                     /locus_tag="Sbal_0405"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     misc_feature    453321..453761
                     /locus_tag="Sbal_0405"
                     /note="Cell division protein FtsA; Region: FtsA;
                     pfam14450"
                     /db_xref="CDD:258601"
     gene            453975..455162
                     /locus_tag="Sbal_0406"
                     /db_xref="GeneID:4842135"
     CDS             453975..455162
                     /locus_tag="Sbal_0406"
                     /note="GTPase; similar structure to tubulin; forms
                     ring-shaped polymers at the site of cell division; other
                     proteins such as FtsA, ZipA, and ZapA, interact with and
                     regulate FtsZ function"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="YP_001048807.1"
                     /db_xref="GI:126172658"
                     /db_xref="InterPro:IPR000158"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="GeneID:4842135"
                     /translation="MFEIMDTHSDDAVIKVIGVGGGGGNAVEHMVKHNIEGVEFIVTN
                     TDAQALRKSGAGSTIQLGRDVTKGLGAGANPDVGRAAAEEDRENIRAAIKGSDMIFIA
                     AGMGGGTGTGAAPVVAQIAREEGILTVAVVTKPFPFEGKKRMAYAEQGIAELAKHVDS
                     LITIPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVM
                     SEMGNAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEF
                     ETVGNHVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKRPDIQLVSKPAPRP
                     EPVVVEPKVEAYVEEAVHVNYAAPKGNVLPAAPLPAPQPAPSTKHELDYLDIPAFLRK
                     QAD"
     misc_feature    454047..455159
                     /locus_tag="Sbal_0406"
                     /note="cell division protein FtsZ; Validated; Region:
                     PRK09330"
                     /db_xref="CDD:236468"
     misc_feature    454047..454919
                     /locus_tag="Sbal_0406"
                     /note="FtsZ is a GTPase that is similar to the eukaryotic
                     tubulins and is essential for cell division in
                     prokaryotes.  FtsZ is capable of polymerizing in a
                     GTP-driven process into structures similar to those formed
                     by tubulin. FtsZ forms a ring-shaped septum at...; Region:
                     FtsZ_type1; cd02201"
                     /db_xref="CDD:100021"
     misc_feature    order(454047..454049,454119..454121,454284..454304,
                     454377..454382,454401..454403,454470..454472,
                     454521..454523,454530..454535,454542..454544)
                     /locus_tag="Sbal_0406"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100021"
     misc_feature    order(454593..454598,454602..454604,454782..454793,
                     454800..454802)
                     /locus_tag="Sbal_0406"
                     /note="SulA interaction site; other site"
                     /db_xref="CDD:100021"
     gene            455343..456263
                     /gene="lpxC"
                     /locus_tag="Sbal_0407"
                     /db_xref="GeneID:4842740"
     CDS             455343..456263
                     /gene="lpxC"
                     /locus_tag="Sbal_0407"
                     /note="zinc-dependent; catalyzes the deacetylation of
                     UDP-(3-O-acyl)-N-acetylglucosamine to
                     UDP-3-O-(3-hydroxytetradecanoyl)-glucosamine in the second
                     step of lipid A biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase"
                     /protein_id="YP_001048808.1"
                     /db_xref="GI:126172659"
                     /db_xref="InterPro:IPR004463"
                     /db_xref="GeneID:4842740"
                     /translation="MIFQRTVQKMVKTTGVGLHSGNKVTLSIMPAPVNSGIVLVRTDL
                     SPAVAIPAKAEQVRETTMCTALVNDEGIRISTIEHLFAALAGLGIDNAVIEVDAPEIP
                     IMDGSASPFVFLLQSAGIKEQAAPKKYLKIKRPVRVEDGDKWAELKPFKGFRVNFKID
                     FAHPEIARSQQHVVMDFSTSAFVKDISRARTFGFMRDIEYLRANNLALGGSMENAVVL
                     DEYRVLNPDGLRYEDEFVKHKILDAFGDLYVAGHAILGEFTAYKTGHALNNQLVRALL
                     AQQDAWELVSFEKEADVPVSFTVPGGAVFA"
     misc_feature    455343..456233
                     /gene="lpxC"
                     /locus_tag="Sbal_0407"
                     /note="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase; Reviewed; Region: lpxC; PRK13186"
                     /db_xref="CDD:237294"
     misc_feature    455346..456182
                     /gene="lpxC"
                     /locus_tag="Sbal_0407"
                     /note="UDP-3-O-acyl N-acetylglycosamine deacetylase;
                     Region: LpxC; pfam03331"
                     /db_xref="CDD:202596"
     gene            complement(456276..456722)
                     /locus_tag="Sbal_0408"
                     /db_xref="GeneID:4842741"
     CDS             complement(456276..456722)
                     /locus_tag="Sbal_0408"
                     /note="KEGG: shn:Shewana3_3737 conserved hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048809.1"
                     /db_xref="GI:126172660"
                     /db_xref="GeneID:4842741"
                     /translation="MKKPPQDLSQLLHQSGKLPDLAEKAELLMYLNHHVKQIIAGPVA
                     EQLKVANFRQGVLVVETTSAAWAARINFQKPKLLAQLQAETLPILTAIEVKVNPRLAM
                     YDAKPKQGHKELSPAAAEHIAALAENIGGSLGEKLKRLASLASRNK"
     misc_feature    complement(456279..456710)
                     /locus_tag="Sbal_0408"
                     /note="Protein of unknown function (DUF721); Region:
                     DUF721; cl02324"
                     /db_xref="CDD:261245"
     gene            456750..457649
                     /locus_tag="Sbal_0409"
                     /db_xref="GeneID:4844779"
     CDS             456750..457649
                     /locus_tag="Sbal_0409"
                     /note="PFAM: peptidase M23B;
                     KEGG: shn:Shewana3_3736 peptidase M23B"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23B"
                     /protein_id="YP_001048810.1"
                     /db_xref="GI:126172661"
                     /db_xref="InterPro:IPR002886"
                     /db_xref="GeneID:4844779"
                     /translation="MSVTVFIQGRNGVTRWQPSKRWLLLPILLLATGSGIYQHNSARF
                     QDQQASVDNDRLVREQQKKQVLELKSATESQLAMLVTHVARMQAKITRLEALGQQVAQ
                     QNKLDEDFDFSSEVGVGGLSELGTNIELGQLIDDMDKLASRIDNNNVQLSLLETVSSN
                     HHIDDERYISGIPLDKGWLSSPYGLRNDPFNGRRTVHKGIDFTGREGAKVVATAAGVV
                     TWAGNMFGYGELVEIDHGNGLHTRYGHNKALSVTVGDVVAKGDAIASMGSTGRSTGAH
                     VHYEVLRGGQQIDPQKFVYRKAS"
     misc_feature    <457263..457625
                     /locus_tag="Sbal_0409"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    457332..457619
                     /locus_tag="Sbal_0409"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            457710..460436
                     /locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /db_xref="GeneID:4845652"
     CDS             457710..460436
                     /locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /note="functions in protein export; can interact with
                     acidic membrane phospholipids and the SecYEG protein
                     complex; binds to preproteins; binds to ATP and undergoes
                     a conformational change to promote membrane insertion of
                     SecA/bound preprotein; ATP hydrolysis appears to drive
                     release of the preprotein from SecA and deinsertion of
                     SecA from the membrane; additional proteins SecD/F/YajC
                     aid SecA recycling; exists in an equilibrium between
                     monomers and dimers; may possibly form higher order
                     oligomers; proteins in this cluster correspond SecA1;
                     SecA2 is not essential and seems to play a role in
                     secretion of a subset of proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="YP_001048811.1"
                     /db_xref="GI:126172662"
                     /db_xref="InterPro:IPR000185"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004027"
                     /db_xref="InterPro:IPR011115"
                     /db_xref="InterPro:IPR011116"
                     /db_xref="InterPro:IPR011130"
                     /db_xref="InterPro:IPR014018"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:4845652"
                     /translation="MFGKLLTKVFGSRNDRTLKGLQKIVISINALEADYEKLTDEALK
                     AKTAEFRERLAAGASLDSIMAEAFATVREASKRVFDMRHFDVQLLGGMVLDSNRIAEM
                     RTGEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAG
                     LGQHEKKAAYNADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDE
                     ARTPLIISGAAEDSSELYIKINTLIPNLIRQDKEDTEEYVGEGDYSIDEKAKQVHFTE
                     RGQEKVENLLIERGMLAEGDSLYSAANISLLHHVNAALRAHTLFERDVDYIVQDNEVI
                     IVDEHTGRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNYFRQYEKLAGMTG
                     TADTEAFEFQHIYGLDTVVVPTNRPMVRKDMADLVYLTADEKYQAIIKDIKDCRERGQ
                     PVLVGTVSIEQSELLARLMVQEKIPHEVLNAKFHEREAEIVAQAGRTGSVTIATNMAG
                     RGTDIVLGGNWNMEIDELDNPTAEQKAKIKADWQIRHDEVVAAGGLHILGTERHESRR
                     IDNQLRGRAGRQGDAGSSRFYLSMEDSLMRIFASDRVSGMMKKLGMEEGEAIEHPWVS
                     RAIENAQRKVEARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIEDTIQNIQDD
                     VIGAVIDQYIPPQSVEELWDIPGLEQRLHQEFMLKLPIQEWLDKEDDLHEESLRERII
                     TAWGDAYKAKEEMVGAQVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKN
                     PKQEYKRESFELFQQLLNTLKHDVISVLSKVQVQAQSDVEEMEARRREEDAKIQRDYQ
                     HAAAESLVGSSDEHEAVTAQAPMIRDGEKVGRNDPCPCGSGRKYKQCHGKLS"
     misc_feature    457710..460433
                     /locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /note="preprotein translocase subunit SecA; Reviewed;
                     Region: PRK13107"
                     /db_xref="CDD:183863"
     misc_feature    458391..458783
                     /locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /note="SecA preprotein cross-linking domain; Region:
                     SecA_PP_bind; smart00958"
                     /db_xref="CDD:214938"
     misc_feature    459558..460202
                     /locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /note="SecA Wing and Scaffold domain; Region: SecA_SW;
                     pfam07516"
                     /db_xref="CDD:254253"
     misc_feature    460371..460427
                     /locus_tag="Sbal_0410"
                     /gene_synonym="azi; div"
                     /note="SEC-C motif; Region: SEC-C; pfam02810"
                     /db_xref="CDD:251544"
     gene            461209..462745
                     /locus_tag="Sbal_R0008"
                     /db_xref="GeneID:4842053"
     rRNA            461209..462745
                     /locus_tag="Sbal_R0008"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4842053"
     gene            462846..462922
                     /locus_tag="Sbal_R0009"
                     /note="tRNA-Ile1"
                     /db_xref="GeneID:4843446"
     tRNA            462846..462922
                     /locus_tag="Sbal_R0009"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:4843446"
     gene            463060..463135
                     /locus_tag="Sbal_R0010"
                     /note="tRNA-Ala1"
                     /db_xref="GeneID:4843447"
     tRNA            463060..463135
                     /locus_tag="Sbal_R0010"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:4843447"
     gene            463504..466406
                     /locus_tag="Sbal_R0011"
                     /db_xref="GeneID:4843448"
     rRNA            463504..466406
                     /locus_tag="Sbal_R0011"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4843448"
     gene            466548..466662
                     /locus_tag="Sbal_R0012"
                     /db_xref="GeneID:4843449"
     rRNA            466548..466662
                     /locus_tag="Sbal_R0012"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:4843449"
     gene            466697..466772
                     /locus_tag="Sbal_R0013"
                     /note="tRNA-Thr1"
                     /db_xref="GeneID:4843450"
     tRNA            466697..466772
                     /locus_tag="Sbal_R0013"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:4843450"
     gene            466812..466926
                     /locus_tag="Sbal_R0014"
                     /db_xref="GeneID:4843451"
     rRNA            466812..466926
                     /locus_tag="Sbal_R0014"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:4843451"
     gene            complement(467476..467967)
                     /locus_tag="Sbal_0411"
                     /db_xref="GeneID:4843452"
     CDS             complement(467476..467967)
                     /locus_tag="Sbal_0411"
                     /note="binds specifically to the major sigma factor sigma
                     70; active in stationary phase"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="YP_001048812.1"
                     /db_xref="GI:126172663"
                     /db_xref="InterPro:IPR007448"
                     /db_xref="GeneID:4843452"
                     /translation="MECIMLRELEKAEQKWGGSNKLIDQWLKNRRKLLVHYCQIAGLP
                     PYGKSEKSLPSFEHVKSFCDLLVDYVSEGHFEVYDRVVNACSEYGESSKTLAQQVLPK
                     ITPTTNAALDFNDKYAETQDDLVLYQLDKDLSELAHNMETRFELEDELLEVLHRKHSE
                     HTQ"
     misc_feature    complement(467479..467955)
                     /locus_tag="Sbal_0411"
                     /note="anti-RNA polymerase sigma 70 factor; Provisional;
                     Region: PRK11718"
                     /db_xref="CDD:236962"
     gene            468027..468320
                     /locus_tag="Sbal_0412"
                     /db_xref="GeneID:4845567"
     CDS             468027..468320
                     /locus_tag="Sbal_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048813.1"
                     /db_xref="GI:126172664"
                     /db_xref="GeneID:4845567"
                     /translation="MRICVNDEMDKPAVLHQKIQIKSPTIETYRWASKVYSRLDATSF
                     LIVLASADFLYQRLGTGATFFCLSVTSLRINEQYVIWITFSGLCGQIDASDGE"
     gene            468413..469477
                     /gene="hemE"
                     /locus_tag="Sbal_0413"
                     /db_xref="GeneID:4841361"
     CDS             468413..469477
                     /gene="hemE"
                     /locus_tag="Sbal_0413"
                     /EC_number="4.1.1.37"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_001048814.1"
                     /db_xref="GI:126172665"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="GeneID:4841361"
                     /translation="MAELKNDRYLRALLKEPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNHELACEVTLQPLRRYDLDAAILFSDILTVPDAMGLGLYFEAGEGPRFERP
                     TDTIDAIKKLSIPDPEDELGYVMKAVSTIRRELNGAVPLIGFSGSPWTLATYMVEGGS
                     SKTFEKIKKMAYAEPMALHMLLDKLADSVILYLNAQVANGAQSLMIFDSWGGALSHSA
                     YREFSLRYMQKIIDGLTRFADGRKVPVTLFTKGGGLWLEAMAETGCDALGLDWTVDIA
                     DARRRVGHKVALQGNMDPSMLYAPIPRIEEEVGHILAGYGEGTGHVFNLGHGIHQHVD
                     PEHAGAFIKAVHAQSKQYHK"
     misc_feature    468440..469453
                     /gene="hemE"
                     /locus_tag="Sbal_0413"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    order(468488..468505,468518..468520,468530..468532,
                     468548..468550,468629..468649,468683..468685,
                     468698..468700,468842..468844,468872..468874,
                     468890..468892,469031..469033,469037..469042,
                     469154..469156,469391..469393)
                     /gene="hemE"
                     /locus_tag="Sbal_0413"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(468491..468493,468503..468505,468641..468643,
                     468872..468874,469037..469039,469391..469393)
                     /gene="hemE"
                     /locus_tag="Sbal_0413"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            469909..471255
                     /locus_tag="Sbal_0414"
                     /db_xref="GeneID:4845153"
     CDS             469909..471255
                     /locus_tag="Sbal_0414"
                     /note="KEGG: shm:Shewmr7_3589 diguanylate
                     cyclase/phosphodiesterase with PAS/PAC sensor(s);
                     TIGRFAM: PAS sensor protein;
                     PFAM: PAS fold-4 domain protein; PAS fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PAS/PAC sensor protein"
                     /protein_id="YP_001048815.1"
                     /db_xref="GI:126172666"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4845153"
                     /translation="MHIGKKIMVFIAGFCLPAVVIVSYCLGCWYDHRVELLRQDSANR
                     ELANIQQQFQIDVDRLTFLTNIYALPLSQLDEEQLKKLESSWHDSSMSANLSWYILRQ
                     GELHTFFPNAHPFASDKLHEIASAIINANKSSVAGAYLIGEQTYVITAVASAPNESVL
                     LVRQLTNNDLLEYAQALLVTKVTMSHSNAVTASVEGVHSDTIEIPSLLKDKPVYLQVQ
                     FSEGPFQEVKFKLDWVSLGFILFGVFIVGLGYIWLRSGLLKPFKNLMRQLALVDPMSS
                     VYQPVACEGNEELEVLASRVNSLLARIYQQKERAKITLESIAEAVILTDVDAKVIYMN
                     PRAESLLDVASCYALDQSLASLLKAGDQLNQAVFTCIRLGESSPQVEKIKLLTASPRI
                     MERSISNLRNHDKEIVGTVVVLRDITQEELLKHQLQKRANFDSITGLLNRQAFDEQ"
     misc_feature    470848..471171
                     /locus_tag="Sbal_0414"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    470857..471159
                     /locus_tag="Sbal_0414"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(470905..470907,470917..470919,470935..470937,
                     470974..470985,471055..471057,471070..471072)
                     /locus_tag="Sbal_0414"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(470965..470967,470977..470979,470995..470997,
                     471004..471009,471091..471093,471097..471099)
                     /locus_tag="Sbal_0414"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    471145..>471252
                     /locus_tag="Sbal_0414"
                     /note="c-di-GMP synthetase (diguanylate cyclase, GGDEF
                     domain) [Signal    transduction mechanisms]; Region:
                     COG2199"
                     /db_xref="CDD:225109"
     gene            471319..472488
                     /locus_tag="Sbal_0415"
                     /db_xref="GeneID:4843467"
     CDS             471319..472488
                     /locus_tag="Sbal_0415"
                     /note="PFAM: GGDEF domain containing protein; EAL domain
                     protein;
                     KEGG: son:SO0437 sensory box protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_001048816.1"
                     /db_xref="GI:126172667"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="GeneID:4843467"
                     /translation="MINDSCGHTAGDRMLAMVAKAMQACLGPQEQLARLAGDEFGLVI
                     CNRSALSVAQLLKQMIAQVSLQVLNDKNCNYKVGLSIGVAFGRAPYIDAQELLKDADI
                     ACIAAKAKGANQIHFYDDKDKELTYQRNAPKWAVRIAQAIEENELILYYQPIRGLGSG
                     PQRQRMEILLRIQEPCGRILAPAQFIAAAERFKLMPDIDKEVIRKAFLWLSLHPVLWP
                     DHCISFNLSGNSLGAEGMVEYIAQQQHIFDIPSQCICFEITETTAIQNRNRGMEMLKQ
                     LRKLGFSFALDDFGSGFASYGYLRELPVDYVKIDGCFIKNLAVNAKDYAIVKSIQDVC
                     RVMGIETVAEFVENQDIIDRLLSIGINYAQGYAIGRPQPLANYREQYEMRLAQRA"
     misc_feature    <471322..471666
                     /locus_tag="Sbal_0415"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(471325..471330,471340..471342,471352..471354,
                     471418..471420,471424..471435)
                     /locus_tag="Sbal_0415"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(471406..471408,471490..471492)
                     /locus_tag="Sbal_0415"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    471430..471432
                     /locus_tag="Sbal_0415"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    471727..472446
                     /locus_tag="Sbal_0415"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            472564..473367
                     /locus_tag="Sbal_0416"
                     /db_xref="GeneID:4843468"
     CDS             472564..473367
                     /locus_tag="Sbal_0416"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
                     KEGG: shn:Shewana3_0437 short-chain
                     dehydrogenase/reductase SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_001048817.1"
                     /db_xref="GI:126172668"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:4843468"
                     /translation="MDGLTGKVVIITGASEGIGRALAVAMARMGCQLVISARNETRLA
                     SLALEIANYGLPPFVFAADVSRAEQCEALIEATVAHYGHLDILINNAGMTMWSRFDEL
                     TQLSVLEDIMRVNYLGPAYLTHAALPHLKASKGQVVVVASVAGLTGVPTRSGYAASKH
                     AVIGFFDSLRIELADDNVAVTVICPDFVVSQIHKRALDGAGNPLGKSPMQEAKILTAE
                     QCANMMLPVIATRGRQLITSLRGRLGRWLKLIAPGLIDKIARRAIASGH"
     misc_feature    472573..473337
                     /locus_tag="Sbal_0416"
                     /note="11beta-hydroxysteroid dehydrogenase type 1
                     (11beta-HSD1)-like, classical (c) SDRs; Region:
                     11beta-HSD1_like_SDR_c; cd05332"
                     /db_xref="CDD:187593"
     misc_feature    472579..473364
                     /locus_tag="Sbal_0416"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06181"
                     /db_xref="CDD:235726"
     misc_feature    order(472600..472617,472672..472680,472747..472755,
                     472831..472839,472843..472845,472903..472905,
                     472918..472920,472981..472989,473026..473028,
                     473038..473040,473116..473127,473131..473133,
                     473137..473142)
                     /locus_tag="Sbal_0416"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187593"
     misc_feature    order(472762..472764,472852..472866,472876..472878,
                     472885..472890,472897..472902,472909..472914,
                     472924..472926,472933..472935,472999..473022,
                     473029..473034,473041..473046,473050..473058,
                     473062..473070,473074..473079,473158..473172,
                     473275..473277,473299..473304,473308..473310,
                     473314..473319,473323..473331,473335..473337)
                     /locus_tag="Sbal_0416"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187593"
     misc_feature    order(472837..472839,472846..472848,472987..472995,
                     473008..473010,473017..473019,473026..473028,
                     473116..473124,473137..473142,473149..473154)
                     /locus_tag="Sbal_0416"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187593"
     misc_feature    order(472906..472908,472987..472989,473026..473028,
                     473038..473040)
                     /locus_tag="Sbal_0416"
                     /note="active site"
                     /db_xref="CDD:187593"
     gene            complement(473386..473613)
                     /locus_tag="Sbal_0417"
                     /db_xref="GeneID:4842848"
     CDS             complement(473386..473613)
                     /locus_tag="Sbal_0417"
                     /note="KEGG: son:SO0439 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048818.1"
                     /db_xref="GI:126172669"
                     /db_xref="GeneID:4842848"
                     /translation="MGYSIKDLIYQGEKSGVHNWGTLEGKSFYWHPDWFHIAEDMTGH
                     MATATIDKQGEKATQSEAEQSIIKHLNKSGK"
     gene            complement(473785..477000)
                     /locus_tag="Sbal_0418"
                     /db_xref="GeneID:4844405"
     CDS             complement(473785..477000)
                     /locus_tag="Sbal_0418"
                     /note="KEGG: son:SO0440 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001048819.1"
                     /db_xref="GI:126172670"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4844405"
                     /translation="MRIRLLCASIAILLSGCGGGSEDAGTTTPPTQPPVQPPAPVQYI
                     ASSVSANGGALDPSSQKVESGKSAIFSITADTGFTLEAITGCGGTLNALTYTTAVITA
                     DCTITPTFIANAENAIKHQDHRLASASELIDFSIAKLASIDIKRKAHINQLYQGVGSS
                     ISWHPTHDSITFSSFMPENTFTVLPSNVDGSGESAVRGLVMAGEQQGQRYAAMAGNLF
                     SVNTSAQTDTLLKNILGWLTKGADKTDGLSIVTTQMPSKADSWDFPHNEGIRTWLTNN
                     YPAAHSINAANTCDYSELSNCIDTLKPDVILISDIDRQSLGFAGIKAAIAKAKAAGIP
                     LLLSNYWRNQSPMLSPLYLEMGLSTSGNYWSKLNANDLSVTDVLAEDTALTKVNNLLG
                     KLNEASFDTSVLNDCTGNYLSCNAAAFVDSFKAGADWYRSNAETLDNNAIDVFTKADF
                     PLMKAGLLLADKYRSEIDYPIAYSEHAQWQQALFADWTVSYARVHNLAQPDLGEYVTD
                     RANLCKGSNAHYAYPATVSERKTISVPYAGQWTTTGWYALPGQTIKLTRLDSSAANVE
                     IKLNYHRRNTNRAYEQKVYRGPLELAQQRLRLAQGKSIEFSSPYGGPIYLYINGDASS
                     VDVNAEHVAKHPTIMDFSNPAEIAAFNERIQNTELPHVDLRTDGAEQHLRRDRFLNAI
                     GTYVPDVNALLNSIVDDHINSVYTLAGLKIQGKSLSESLPADVLAACKGLFGDDCIDN
                     SLHTRTIIQHANYDQNAQCGAGCSGNPWDAAWNIDPTGWGDNHELGHNLQTNRLNVQY
                     AAANNSDNRAGYSSRAGENSNNIFPYVVKWKTYYLRDGNTGTVTDGHMNHKDLFYVFM
                     SDAAGTTDTSGKRVVFGANCKVLDAGEDRYTAPWSSNAYAVHNGYRMAFYIQMALKAH
                     GITLSDGTMLNNGFNLFTLLYQHSRIFGKYANNASDWEANRSKLGFSQFPFDGNSVYG
                     GKTVKDIPGNDFMLVSLSQLTGKDWRSHFDMLGLRYSSLAAAQTVANATSGTMPMGMY
                     ELETDLPPANMSQGLTFVPLSLTDGTTQWKGVGSPTQCTKP"
     misc_feature    complement(474523..475383)
                     /locus_tag="Sbal_0418"
                     /note="Peptidase M60-like family; Region: M60-like;
                     cl19940"
                     /db_xref="CDD:268293"
     gene            complement(477178..478476)
                     /locus_tag="Sbal_0419"
                     /db_xref="GeneID:4841375"
     CDS             complement(477178..478476)
                     /locus_tag="Sbal_0419"
                     /EC_number="6.3.4.13"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="YP_001048820.1"
                     /db_xref="GI:126172671"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="GeneID:4841375"
                     /translation="MKVLVIGGGGREHALAWKAAQSAQVETVYVAPGNAGTALEPNVE
                     NLAISATDIPALLDFAKTNKIELTIVGPEAPLVMGVVDAFNAAGLPIFGPTKAAAQLE
                     GSKAFTKDFLARHNIPTAGYKNCTEISDAKAFVRELTATTGYPVVIKADGLAAGKGVI