GenomeNet

Database: RefSeq
Entry: NC_009455
LinkDB: NC_009455
Original site: NC_009455 
LOCUS       NC_009455            1341892 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Dehalococcoides sp. BAV1 chromosome, complete genome.
ACCESSION   NC_009455
VERSION     NC_009455.1  GI:147668652
DBLINK      Project: 58477
            BioProject: PRJNA58477
KEYWORDS    RefSeq.
SOURCE      Dehalococcoides mccartyi BAV1
  ORGANISM  Dehalococcoides mccartyi BAV1
            Bacteria; Chloroflexi; Dehalococcoidia; Dehalococcoidales;
            Dehalococcoidaceae; Dehalococcoides.
REFERENCE   1  (bases 1 to 1341892)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Lowry,S., Clum,A.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E.,
            Ritalahti,K.M., Loeffler,F. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Dehalococcoides sp. BAV1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1341892)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Lowry,S., Clum,A.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E.,
            Ritalahti,K.M., Loeffler,F. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
REFERENCE   3  (bases 1 to 1341892)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2002) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000688.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4000264
            Source DNA and bacteria available from Frank Loeffler
            (frank.loeffler@ce.gatech.edu)
            Contacts: Frank Loeffler (frank.loeffler@ce.gatech.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-PGF
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1341892
                     /organism="Dehalococcoides mccartyi BAV1"
                     /mol_type="genomic DNA"
                     /strain="BAV1"
                     /db_xref="taxon:216389"
     gene            245..1579
                     /locus_tag="DehaBAV1_0001"
                     /db_xref="GeneID:5131182"
     CDS             245..1579
                     /locus_tag="DehaBAV1_0001"
                     /note="TIGRFAM: chromosomal replication initiator protein
                     DnaA;
                     PFAM: Chromosomal replication initiator, DnaA C-terminal
                     domain; Chromosomal replication initiator, DnaA;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_001213471.1"
                     /db_xref="GI:147668653"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="GeneID:5131182"
                     /translation="MSVRPAQELWEAALGEIELQVNKPNFRTWFAKTVGLKYDGSEFV
                     IGVPNTFVAEYLELNQRSLIEKTLINTTHSPVELCFQLIQSGQVPAAVPQTNKQKQES
                     PFNPRYTFESFIVGSCNRMAHAASLAAAQNPGKSYNPLYIYAEAGLGKTHLLQAIGHL
                     ANLNRRKALYVSGEQFTTDFISSIRNGQTEEFRSRYRDVDLLLLDDVQFIGGKEQTEE
                     CLFHTFNDLHNSNRQIVISADSPPKSLPQLAERLRSRFEWGLTIEIEPPDEKTRLELL
                     QLKAEQSGTELNMDTLEYLAQAVKHNIRELEGSLNRVLAYARLLRAAITPDLAARALS
                     DIGSRPVRENSPLRPGNIISAVSQVFQIPTTELLGAARDKDTALARQFAMFILKQQNS
                     ASLVEIGQSLGGRSASTVSHACDKIQLELENSTFLRLKMTEVQNHLSQQRLP"
     misc_feature    260..1564
                     /locus_tag="DehaBAV1_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    263..448
                     /locus_tag="DehaBAV1_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    641..1024
                     /locus_tag="DehaBAV1_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    674..697
                     /locus_tag="DehaBAV1_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(677..700,953..955)
                     /locus_tag="DehaBAV1_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    995..997
                     /locus_tag="DehaBAV1_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1289..1558
                     /locus_tag="DehaBAV1_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1358..1360,1382..1387,1406..1408,1424..1432,
                     1457..1471,1478..1480,1487..1492)
                     /locus_tag="DehaBAV1_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1910..3184
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /db_xref="GeneID:5131201"
     CDS             1910..3184
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="essential GTPase; exhibits high exchange rate for
                     GTP/GDP; associates with 50S ribosomal subunit; involved
                     in regulation of chromosomal replication"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase ObgE"
                     /protein_id="YP_001213472.1"
                     /db_xref="GI:147668654"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="GeneID:5131201"
                     /translation="MFDRVEINIKAGDGGSGKVSFRREKFVPYGGPDGGDGGDGGNVY
                     LEADSGLYSLLNFKHKRVHKASNGEGGMGSRCTGHNGADLVIKVPVGTVATILEENGQ
                     KRVLADLAADGDRTLVAHGGQGGLGNTHFVSSTNQAPMLAQKGQPGGEYDLILELKLI
                     ADVAIIGYPNVGKSSLLSLLTAAKPKVANYPFTTLSPVMGVIERPEGVFVMAEVPGLI
                     ENAHLGKGLGHDFLRHISRTRMVIHLLDGTSENPIDDMIKVNSELYLYDASLSERPQV
                     VAINKIDDELVQLRREELKETFKEAGLEVFFISALTGEGVDVLLAKVAEKLDILKAAD
                     ISETAPDHEVKIFRPAPKGKMGFRITRLEDGWQVEAPEIERIIEHSDIEDPEVRRQVM
                     VLLKHRSVQQSLIKSGAVIGQKIITGRMEWYL"
     misc_feature    1910..3178
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="GTPase CgtA; Reviewed; Region: obgE; PRK12297"
                     /db_xref="CDD:237046"
     misc_feature    1916..2386
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="GTP1/OBG; Region: GTP1_OBG; pfam01018"
                     /db_xref="CDD:110047"
     misc_feature    2390..2890
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="Obg GTPase; Region: Obg; cd01898"
                     /db_xref="CDD:206685"
     misc_feature    2408..2431
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="G1 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    order(2417..2434,2747..2752,2756..2758,2834..2839)
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206685"
     misc_feature    2453..2500
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206685"
     misc_feature    2489..2491
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="G2 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    2546..2557
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="G3 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    order(2555..2578,2585..2623)
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206685"
     misc_feature    2747..2758
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="G4 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    2834..2842
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="G5 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    2978..3178
                     /gene="obgE"
                     /locus_tag="DehaBAV1_0002"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /note="Domain of unknown function (DUF1967); Region:
                     DUF1967; pfam09269"
                     /db_xref="CDD:255259"
     gene            3172..3786
                     /locus_tag="DehaBAV1_0003"
                     /db_xref="GeneID:5131739"
     CDS             3172..3786
                     /locus_tag="DehaBAV1_0003"
                     /EC_number="2.7.7.18"
                     /note="TIGRFAM: cytidyltransferase-related domain;
                     nicotinate (nicotinamide) nucleotide adenylyltransferase;
                     PFAM: cytidylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="YP_001213473.1"
                     /db_xref="GI:147668655"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="GeneID:5131739"
                     /translation="MVSLKTGILGGTFDPIHTGHLILADEVKNRLGLDEVIFIPTGQP
                     YYKADKTISPAEDRLNMVKLAISDKPYFRVMDIEIKRSGPTYTADTLNDLKTILPEKT
                     ELYFMLGWDNLEALPRWHKASEIIRLCRLVAAPRIGQVKPDVDELDDKLPGLQQSLIL
                     LSKPEVDISSSLVRERVENGQGVEHLVPAAVASYIKKHNLYCRK"
     misc_feature    3187..3774
                     /locus_tag="DehaBAV1_0003"
                     /note="Nicotinamide/nicotinate mononucleotide
                     adenylyltransferase; Region: NMNAT; cd02165"
                     /db_xref="CDD:185680"
     misc_feature    order(3196..3210,3220..3222,3226..3231,3238..3240,
                     3301..3303,3424..3432,3487..3489,3493..3498,3502..3507,
                     3526..3531,3574..3579,3673..3675)
                     /locus_tag="DehaBAV1_0003"
                     /note="active site"
                     /db_xref="CDD:185680"
     misc_feature    3220..3231
                     /locus_tag="DehaBAV1_0003"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:185680"
     gene            complement(3868..5796)
                     /locus_tag="DehaBAV1_0004"
                     /db_xref="GeneID:5131176"
     CDS             complement(3868..5796)
                     /locus_tag="DehaBAV1_0004"
                     /EC_number="5.99.1.3"
                     /note="TIGRFAM: DNA gyrase, B subunit;
                     PFAM: DNA gyrase, subunit B domain protein; ATP-binding
                     region, ATPase domain protein; TOPRIM domain protein; DNA
                     topoisomerase, type IIA, subunit B, region 2 domain
                     protein;
                     SMART: DNA topoisomerase II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_001213474.1"
                     /db_xref="GI:147668656"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="GeneID:5131176"
                     /translation="MLDANKAKPGANSETYTASDIQVLEGLAAVRKRPGMYIGSTDQR
                     GLHHLVYEIVYNSVDEAMAGVCDRIKVIMFKDGSVSVEDNGRGIPVDIHSTTKISALE
                     TVMTVLHAGAKFGGKTYQVSGGLHGVGASVVNALSEWTTVKVRRNGKIYQQSYLRGKP
                     STPLEEVGVSEGSGTTTIFMADSQIFSTTEYDFETLTDRLREIAYLNKGLEVYIYDEK
                     SDQERTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSDSTILEVAIQYNDGYSDSTL
                     TFANCVNTVDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSV
                     KLPEPQFEGQTKGKLGNIEIKSFVESAVAEQLSLYLEEHPDDTKRILEKCITAAKARE
                     AARKARDLIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQ
                     AILPLRGKILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPSKLRYNRLVLMTDAD
                     VDGSHIRTLLLTFFFRHMPRLITESHLFIAQPPLYKIKIGSTEHWVYNDAEKEAILAQ
                     TKSTKVDIQRYKGLGEMSAEQLWRTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVA
                     PRKAFIQSHSRTVKNLDI"
     misc_feature    complement(3871..5766)
                     /locus_tag="DehaBAV1_0004"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    complement(<5383..5661)
                     /locus_tag="DehaBAV1_0004"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(5407..5418,5533..5538,5542..5544,
                     5548..5550,5554..5556,5620..5622,5629..5631,5641..5643))
                     /locus_tag="DehaBAV1_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(5629..5631)
                     /locus_tag="DehaBAV1_0004"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(5410..5412,5416..5418,5536..5538,
                     5542..5544))
                     /locus_tag="DehaBAV1_0004"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(4642..5112)
                     /locus_tag="DehaBAV1_0004"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(4957..4959)
                     /locus_tag="DehaBAV1_0004"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(4765..4767,4771..4776,4783..4785))
                     /locus_tag="DehaBAV1_0004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(4759..4761,4765..4767))
                     /locus_tag="DehaBAV1_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(4177..4518)
                     /locus_tag="DehaBAV1_0004"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(4267..4269,4273..4275,4279..4281,
                     4486..4488,4495..4500))
                     /locus_tag="DehaBAV1_0004"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(4279..4281,4498..4500))
                     /locus_tag="DehaBAV1_0004"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    complement(3904..4098)
                     /locus_tag="DehaBAV1_0004"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(6001..8187)
                     /locus_tag="DehaBAV1_0005"
                     /db_xref="GeneID:5131613"
     CDS             complement(6001..8187)
                     /locus_tag="DehaBAV1_0005"
                     /EC_number="2.7.6.5"
                     /note="TIGRFAM: RelA/SpoT family protein;
                     PFAM: amino acid-binding ACT domain protein; TGS domain
                     protein; metal-dependent phosphohydrolase, HD sub domain;
                     RelA/SpoT domain protein;
                     SMART: metal-dependent phosphohydrolase, HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="(p)ppGpp synthetase I SpoT/RelA"
                     /protein_id="YP_001213475.1"
                     /db_xref="GI:147668657"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004811"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="GeneID:5131613"
                     /translation="MEFADLKEKASKYLPPEKLTLLEEAYNYAAAAHAGQMRKSGEPF
                     IEHPLNVAMTLADLQLDAATLSAALLHDVPEDANISLEQIDKKFGADVAKLVDGVTKL
                     SKLALGPAIEDARRPGGNASLRQAENLRKMLVAMAEDLRVVFIKLADRFHNMRTLQAL
                     SPEKRRSIAKETMEIYAPLAHRLGIWELKWQLEDLAFRYLDPRHYRQVANLVDSKLAQ
                     RQNYLEHVSAILQGEFEKNGLNVEVSGRPKHLYSIYQKMEKYASQGKQFEDIYDVLAL
                     RVLVNDIPDCYHAVGIVHSLWHPIPGAFDDYIANPKPNGYQSLHTAVMSLGTTPLEVQ
                     VRTYQMHHIAEYGVAAHWRYKTAGKEDVNFEDRIGWLRQLIEWHRDMRGAEEFLESVK
                     TDIFNDQVFVFTPKGEIKDLAKGATPIDFAYRIHTELGNRCIGAKANGRLVPLDYQLK
                     NGEVVEIVTTKKDRGPSRDWLNGNMGYIKTHHAREKILAWFKKQERTENLDRGRELLE
                     KELKHIGIKTVDRDALAKTFKYENADEFLMAIGYGAVSVHQVSMKLLSQQEQPRVVTP
                     PTQTTKPTSQSSVSVMGTGSLLTNIAKCCNPVPGDDIIGYVTRNRGVTVHRQDCHNIL
                     HEEERERLVSVDWGMPKEELYPASIRIQAWDRVGLVRDVSTVVAEEKISILSMTVTEN
                     DDKTTTLAMTTQIKSLSQLTRLMAKLEGIRGIISINRVGADGSRSG"
     misc_feature    complement(6028..8187)
                     /locus_tag="DehaBAV1_0005"
                     /note="Guanosine polyphosphate
                     pyrophosphohydrolases/synthetases [Signal transduction
                     mechanisms / Transcription]; Region: SpoT; COG0317"
                     /db_xref="CDD:223394"
     misc_feature    complement(7660..8064)
                     /locus_tag="DehaBAV1_0005"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(7741..7743,7972..7977,8047..8049))
                     /locus_tag="DehaBAV1_0005"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(7972..7974)
                     /locus_tag="DehaBAV1_0005"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(7150..7530)
                     /locus_tag="DehaBAV1_0005"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(7153..7158,7180..7182,7186..7188,
                     7192..7194,7228..7230,7240..7242,7246..7248,7252..7254,
                     7267..7269,7273..7275,7357..7359,7369..7374,7444..7446,
                     7450..7452))
                     /locus_tag="DehaBAV1_0005"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(7156..7158,7186..7188,7192..7194,
                     7228..7230,7240..7242,7246..7248,7252..7254,7267..7269,
                     7273..7275,7450..7452))
                     /locus_tag="DehaBAV1_0005"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(7192..7194,7372..7374))
                     /locus_tag="DehaBAV1_0005"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    complement(6811..6990)
                     /locus_tag="DehaBAV1_0005"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    complement(6031..6243)
                     /locus_tag="DehaBAV1_0005"
                     /note="ACT  domain found C-terminal of the RelA/SpoT
                     domains; Region: ACT_RelA-SpoT; cd04876"
                     /db_xref="CDD:153148"
     gene            8315..9571
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /db_xref="GeneID:5131184"
     CDS             8315..9571
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /EC_number="6.1.1.21"
                     /note="catalyzes a two-step reaction, first charging a
                     histidine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; class II aminoacyl-tRNA
                     synthetase; forms homodimers; some organisms have a
                     paralogous gene, hisZ, that is similar to hisS and
                     produces a protein that performs the first step in
                     histidine biosynthesis along with HisG"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="YP_001213476.1"
                     /db_xref="GI:147668658"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="GeneID:5131184"
                     /translation="MYQSPRGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFE
                     DAGLFVRSVGEGTDIVSKEMYTFEDRGGDKLTLRPEGTAPVCRAYLEHGMQTRTKPVK
                     LYYLSSIFRYDRPQAGRYRQHHQFGFEAIGEADASLDAEIIEMAWSFYNLLGITDLSL
                     ELNSIGCRQCRPNYISALKDYYQQHAGKLCPDCNTRLDKNTLRLLDCKRAECQAVAGN
                     APRSADYLCPDCLAHYSRLKECLTILDLPFHENFRLVRGLDYYSRTVFEIQPMAEGAQ
                     STIGGGGRYDGLIEQLGGEATPAMGFATGIERIILNLKRQGIVPSPLPSPAVFLAYMG
                     ETASLASFALASDLRKAGIGIYQTYAQKSIKAQLRQANSLGVDWVVILGEEELKQGCA
                     VLRNMKEAGQANIPLDQLICEIKKQI"
     misc_feature    8315..9568
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="histidyl-tRNA synthetase; Reviewed; Region: hisS;
                     PRK00037"
                     /db_xref="CDD:234586"
     misc_feature    8366..9256
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(8372..8374,8408..8410,8423..8443,8513..8518,
                     8552..8554,8558..8560,8573..8578,8585..8590,8675..8680,
                     8699..8701,8723..8725,8735..8737,8744..8746,9161..9163,
                     9215..9220)
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    8417..8443
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(8552..8554,8558..8560,8645..8647,8651..8653,
                     8672..8674,8681..8683,8687..8689,8699..8701,9080..9082,
                     9086..9088,9092..9097,9146..9148,9161..9163,9218..9220,
                     9227..9229,9236..9238)
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    8642..8656
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(9215..9229,9236..9238)
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     misc_feature    9296..9559
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="HisRS Histidyl-anticodon binding domain. HisRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     HisRS_anticodon; cd00859"
                     /db_xref="CDD:238436"
     misc_feature    order(9311..9316,9419..9421,9437..9439,9461..9463,
                     9491..9493,9497..9499)
                     /gene="hisS"
                     /locus_tag="DehaBAV1_0006"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238436"
     gene            9568..10731
                     /locus_tag="DehaBAV1_0007"
                     /db_xref="GeneID:5131155"
     CDS             9568..10731
                     /locus_tag="DehaBAV1_0007"
                     /note="PFAM: Saccharopine dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="saccharopine dehydrogenase"
                     /protein_id="YP_001213477.1"
                     /db_xref="GI:147668659"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="GeneID:5131155"
                     /translation="MTKNILIIGGYGNAGSCIAMLLMQETDARIFLGGRSLEKAKYVA
                     EGLNRLENIQRVEGVRLNVEDPQSLKEAFSGMDIVVVASNTPEYARQIAVAALEAKVD
                     YIDIQYSDRKLHQLKLLSQKINNANLCFITEAGSLPGLPSALVHLVHQDFTTLERVSV
                     GAIICQNWESAISEERTNEVMRQLSDYQPYVYKNYHWKRLGWFHPGTSRTFNFGSFGR
                     LSCGPMTLEEMRPLPGMYTTLKELGFYMGGFNWFTNWISIPLLNLGLRFFGKEAKRSL
                     GKLLVWGLRNFDNQPYGMAIKVSARGERGGIRERQDILLSHKDAYMFTAIPLVACLKQ
                     YLDGSARRSGLYYMGHLVDSKRLVGDMEKMGMTIRFQTQLVDKPPVARPRIED"
     misc_feature    9580..>9864
                     /locus_tag="DehaBAV1_0007"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     gene            complement(10728..11330)
                     /locus_tag="DehaBAV1_0008"
                     /db_xref="GeneID:5131726"
     CDS             complement(10728..11330)
                     /locus_tag="DehaBAV1_0008"
                     /note="PFAM: protein of unknown function DUF205"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_001213478.1"
                     /db_xref="GI:147668660"
                     /db_xref="InterPro:IPR003811"
                     /db_xref="GeneID:5131726"
                     /translation="MLGSIPSAYLVTRRLIGRDIRQMGGGNVGGLNTFREVGTGAGIS
                     VAFIDLVKGALAVSVSYYLLTQNAQWVILTGFMAVIGHNWSVWLDFKGGKGLGPAFGA
                     MLFLLPVYGLPQQLGILALLVFIPLALTRNIALATGIALFSLPFLVWYGSHSEFATLI
                     SVLLFLMIGGKFVLDNRKSLRDPANRRNLIVDHWKRPDKG"
     misc_feature    complement(10731..11330)
                     /locus_tag="DehaBAV1_0008"
                     /note="membrane protein; Provisional; Region: PRK14416"
                     /db_xref="CDD:184667"
     gene            complement(11384..12304)
                     /locus_tag="DehaBAV1_0009"
                     /db_xref="GeneID:5131603"
     CDS             complement(11384..12304)
                     /locus_tag="DehaBAV1_0009"
                     /EC_number="2.6.1.-"
                     /EC_number="2.6.1.42"
                     /note="catalyzes the transamination of the branched-chain
                     amino acids to their respective alpha-keto acids"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="YP_001213479.1"
                     /db_xref="GI:147668661"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005785"
                     /db_xref="GeneID:5131603"
                     /translation="MGTSYAYFKKQIIPLEDAKIGVMTHALHYGTGVFEGIRGNWNDE
                     KKQMYVFRLKEHYTRLLSGAKVLKMDLPYTVDELCKITIELVRKCGFKEDIYIRPLAY
                     KSSESFGVRLHNLECDLLIVAIPWGRYIDKDTCHCCVSTWRRPDDNVMPPQLKSTGIY
                     LNNAFTKTEAVENGFDEGIMLTPDGHVSEGSGENLFLVRKGKLITPPICDSILDGITR
                     NSVMELAEKELGLQVVERSIDRVELYMAEECFLTGTAAHLTPVSEIDHRKVGNGEIGP
                     LTAKLKDLYFEAIKGNITKYENWCTPVYNL"
     misc_feature    complement(11432..12250)
                     /locus_tag="DehaBAV1_0009"
                     /note="BCAT_beta_family: Branched-chain aminotransferase
                     catalyses the transamination of the branched-chain amino
                     acids  leusine, isoleucine and valine to their respective
                     alpha-keto acids, alpha-ketoisocaproate,
                     alpha-keto-beta-methylvalerate and...; Region:
                     BCAT_beta_family; cd01557"
                     /db_xref="CDD:238798"
     misc_feature    complement(order(11759..11761,11801..11803,11813..11815,
                     11819..11821,11834..11836,11945..11947,11969..11971,
                     11981..11989,12005..12007,12011..12013,12107..12109,
                     12203..12205,12209..12211,12215..12229,12236..12250))
                     /locus_tag="DehaBAV1_0009"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238798"
     misc_feature    complement(order(11543..11545,11654..11659,11738..11740,
                     11825..11827,11840..11842,11975..11977,12128..12130,
                     12203..12205,12218..12220))
                     /locus_tag="DehaBAV1_0009"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238798"
     misc_feature    complement(11840..11842)
                     /locus_tag="DehaBAV1_0009"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238798"
     gene            complement(12458..13630)
                     /locus_tag="DehaBAV1_0010"
                     /db_xref="GeneID:5131175"
     CDS             complement(12458..13630)
                     /locus_tag="DehaBAV1_0010"
                     /EC_number="2.7.7.7"
                     /note="PFAM: UMUC domain protein DNA-repair protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase"
                     /protein_id="YP_001213480.1"
                     /db_xref="GI:147668662"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="GeneID:5131175"
                     /translation="MSIRRVMHVDLDAFFVSVEQAVRPEFKDKPVIVGGKPERRGVVA
                     AASYEARKFGIHSGMPLITAKHLCPQAIFIEGNHQLYREYSEKFMLILSDFSPFLEPM
                     GLDEAYLEVTGFESLHGSIAQMASKIRRRITAELGINASIGIANSKVAAKIATEQAKP
                     NGQCEVPAGEEASFLAPLDIAVMPGIGKKTEQHLKSLGIDTLGKLAALPASFLKSCLG
                     TYAPYLSNAAMGIDNRPVEMPSEAKSISRETTFETDTRNQTFLEAKLSYLSEKITATL
                     RKRGKQTRVVQIKIRFADFTTLTRQKHLGQPASGNREIFQTALSLMNGILDSDRQAVR
                     LLGVGISDFCGPEKQLEIDPAKARLEKLDASLDKIRQKYGFSSVQTGRTYRLKDMF"
     misc_feature    complement(12602..13612)
                     /locus_tag="DehaBAV1_0010"
                     /note="DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa;
                     cd03586"
                     /db_xref="CDD:176459"
     misc_feature    complement(order(13154..13156,13316..13318,13478..13480,
                     13487..13489,13496..13501,13586..13594,13598..13603))
                     /locus_tag="DehaBAV1_0010"
                     /note="active site"
                     /db_xref="CDD:176459"
     misc_feature    complement(12578..13597)
                     /locus_tag="DehaBAV1_0010"
                     /note="DNA polymerase IV; Validated; Region: PRK02406"
                     /db_xref="CDD:235035"
     misc_feature    complement(order(12605..12607,12614..12616,12626..12631,
                     12722..12724,12728..12739,12806..12808,12881..12904,
                     12971..12976,13061..13081,13175..13177,13313..13318,
                     13322..13324,13451..13453,13526..13528))
                     /locus_tag="DehaBAV1_0010"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176459"
     gene            complement(13630..13818)
                     /locus_tag="DehaBAV1_0011"
                     /db_xref="GeneID:5131647"
     CDS             complement(13630..13818)
                     /locus_tag="DehaBAV1_0011"
                     /note="PFAM: protein of unknown function DUF951"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213481.1"
                     /db_xref="GI:147668663"
                     /db_xref="InterPro:IPR009296"
                     /db_xref="GeneID:5131647"
                     /translation="MPEINPGDVYKLRKPHPCGGTDWKVDFAGSDIGITCLRCGHHLL
                     LSRPLFEKKVKCLIKPGE"
     misc_feature    complement(13642..13812)
                     /locus_tag="DehaBAV1_0011"
                     /note="Bacterial protein of unknown function (DUF951);
                     Region: DUF951; pfam06107"
                     /db_xref="CDD:147978"
     gene            complement(13889..14701)
                     /locus_tag="DehaBAV1_0012"
                     /db_xref="GeneID:5131616"
     CDS             complement(13889..14701)
                     /locus_tag="DehaBAV1_0012"
                     /note="TIGRFAM: orotidine 5'-phosphate decarboxylase;
                     PFAM: Orotidine 5'-phosphate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="YP_001213482.1"
                     /db_xref="GI:147668664"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011995"
                     /db_xref="GeneID:5131616"
                     /translation="MKFLEKLKQAGNRNKSLLCVGLDPDPKLMPVGMSALEFNREIIE
                     ATAPFVCGYKINLAFYEALGKQGWEILSETCEFIPRELITIADAKRGDIGNTSKAYAR
                     AILDELDCDGVTVSPYLGYDSLEPFIEYQDKGIFILCLTSNQGSTDFQMLKTEYLGQK
                     RFLYEVVADKASLWNRYENIGLVVGATQQEELKKLRLIYPKLPFLIPGIGAQGGDLKA
                     TIENGTNPNGELAIICASRGILYARSGSEFAQGAAEAAEQMRDAINHYRKRF"
     misc_feature    complement(13976..14650)
                     /locus_tag="DehaBAV1_0012"
                     /note="Orotidine 5'-phosphate decarboxylase (ODCase) is a
                     dimeric enzyme that decarboxylates orotidine
                     5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP),
                     an essential step in the pyrimidine biosynthetic pathway.
                     In mammals, UMP synthase...; Region:
                     OMP_decarboxylase_like; cd04725"
                     /db_xref="CDD:240076"
     misc_feature    complement(order(13991..13996,14081..14083,14276..14281,
                     14435..14437,14441..14443,14534..14536,14540..14542,
                     14633..14635,14639..14641))
                     /locus_tag="DehaBAV1_0012"
                     /note="active site"
                     /db_xref="CDD:240076"
     misc_feature    complement(order(13991..13993,14213..14215,14279..14281,
                     14315..14317,14348..14356,14402..14407,14414..14419,
                     14426..14431,14435..14440,14525..14530,14534..14536))
                     /locus_tag="DehaBAV1_0012"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240076"
     gene            14849..15544
                     /locus_tag="DehaBAV1_0013"
                     /db_xref="GeneID:5131634"
     CDS             14849..15544
                     /locus_tag="DehaBAV1_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213483.1"
                     /db_xref="GI:147668665"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="GeneID:5131634"
                     /translation="MKKEFPNKNFQRIEAGHGFEISLIRSDSFEVTVDASEDGFRNIE
                     IKQEGDKLWLMYSPSIFSLKNLLPGWYLPRATVKMPRLGGLYINGATRAKLEGFDSNG
                     KLEIKLSGASQLEGEVKAGEAEIKAEAASEVRLKGVFKKLKLELESGSKVQMEGWTEE
                     LEAEAKGVSQIALDKMVCKQAKVKLENASQAELRVEEVLNVKLNGASELKYAGSPCFN
                     EVEIKGSSSLSKS"
     misc_feature    14873..15493
                     /locus_tag="DehaBAV1_0013"
                     /note="Protein of unknown function (DUF2807); Region:
                     DUF2807; pfam10988"
                     /db_xref="CDD:256228"
     gene            15583..16377
                     /locus_tag="DehaBAV1_0014"
                     /db_xref="GeneID:5132247"
     CDS             15583..16377
                     /locus_tag="DehaBAV1_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213484.1"
                     /db_xref="GI:147668666"
                     /db_xref="GeneID:5132247"
                     /translation="MKKAALLCLSICFTGILALLGGGCIPGVGGFITGSGEVESQPFD
                     YADFNRVEISNVITADISRADSFEVSVSTNENIFEYLELEKSGQTLKIGLKDNYSFTN
                     VKIEASIRLPELVGLDISGASKATVSGFNSVNDFTALVSGASRITLFNMRVGQTRLYI
                     SGASFASGDLICGNASLEVSGASRLELSGQGVDIDVLTEGASTVNLEKFLAASAEVTA
                     TGVSNIRVYTNGDLYITASGVSSVKYFGNPIIKDINISDISSAGKG"
     sig_peptide     15583..15648
                     /locus_tag="DehaBAV1_0014"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.977) with cleavage site probability 0.403 at
                     residue 22"
     misc_feature    15721..16326
                     /locus_tag="DehaBAV1_0014"
                     /note="Protein of unknown function (DUF2807); Region:
                     DUF2807; pfam10988"
                     /db_xref="CDD:256228"
     gene            16423..17739
                     /locus_tag="DehaBAV1_0015"
                     /db_xref="GeneID:5132407"
     CDS             16423..17739
                     /locus_tag="DehaBAV1_0015"
                     /note="TIGRFAM: FolC bifunctional protein;
                     PFAM: cytoplasmic peptidoglycan synthetase domain protein;
                     Mur ligase, middle domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional folylpolyglutamate synthase/
                     dihydrofolate synthase"
                     /protein_id="YP_001213485.1"
                     /db_xref="GI:147668667"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:5132407"
                     /translation="MGLTDYESATSRAAANYDLRRVVELLMRLRNPHMGIPAVHLAGT
                     KGKGSTASLIASVMSVAGYRTGLYTSPHLLDFRERICLDGKMISKDHLVRLMASIRPL
                     VDEMNAHAYLGKITSFEVMTALAFEFFHRQQATFQVIETGLGGRLDATNVITPNLSVL
                     TPISLDHTEVLGDSLDKIAAEKAGIIKQSVPVVSAAQRLEAMAVIRERCLKTQSRLIE
                     VSDGYKAEFLGYLGNGQLVKLTGRLGEYCLCLSLLGHYQRQNALTALASLEVLIEAGF
                     KISPEDICEGFRQARWPGRFEVIKGNPLLVIDGAHNEEAVAELVLSLEEYPATAKIEK
                     GERVLVFGTSFDKDAQAMAALLGGYFGTVVLTRSAHPRAMKMDLLKQAFEGRGLQVLE
                     ADGVPKALELAGEISPADGLICATGSLFVAAEALKGKSQPRSGTGS"
     misc_feature    16456..17703
                     /locus_tag="DehaBAV1_0015"
                     /note="Folylpolyglutamate synthase [Coenzyme metabolism];
                     Region: FolC; COG0285"
                     /db_xref="CDD:223362"
     misc_feature    16549..17226
                     /locus_tag="DehaBAV1_0015"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    17296..17541
                     /locus_tag="DehaBAV1_0015"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            complement(17722..17937)
                     /locus_tag="DehaBAV1_0016"
                     /db_xref="GeneID:5132115"
     CDS             complement(17722..17937)
                     /locus_tag="DehaBAV1_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213486.1"
                     /db_xref="GI:147668668"
                     /db_xref="GeneID:5132115"
                     /translation="MSCYFRHMGDIFLAAGVDPQGEKRRELDKIIHRFLGIEYKSCPE
                     TWKKLKEEVIPYPDKKNKLIELLRASS"
     gene            complement(17951..18214)
                     /locus_tag="DehaBAV1_0017"
                     /db_xref="GeneID:5132088"
     CDS             complement(17951..18214)
                     /locus_tag="DehaBAV1_0017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213487.1"
                     /db_xref="GI:147668669"
                     /db_xref="InterPro:IPR007527"
                     /db_xref="GeneID:5132088"
                     /translation="MQSSLIGKIEKAKRYAQEKDRIRFNQLSVQFRGENDIHTTEYIN
                     SKWHCTCNFFAAWGMCSHTMAMEKVLENMLPDEALSNVFAELP"
     gene            18517..18978
                     /locus_tag="DehaBAV1_0018"
                     /db_xref="GeneID:5132411"
     CDS             18517..18978
                     /locus_tag="DehaBAV1_0018"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="YP_001213488.1"
                     /db_xref="GI:147668670"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="GeneID:5132411"
                     /translation="MKAVVQRVSRASVRVSGETVGEIGPGLAVLLGVAEGDTEEDAEY
                     LASKIINLRIFSDAEGKFNLSLKDLCREMLVVSQFTLIADTRKGRRPSFIEAAQPQEA
                     DGLYNVFIRLCREEGTQVATGQFGAMMMLEIYNDGPVTIILDSRDRLNPRL"
     misc_feature    18517..18951
                     /locus_tag="DehaBAV1_0018"
                     /note="D-Tyrosyl-tRNAtyr deacylases; a class of
                     tRNA-dependent hydrolases which are capable of hydrolyzing
                     the ester bond of D-Tyrosyl-tRNA reducing the level of
                     cellular D-Tyrosine while recycling the peptidyl-tRNA;
                     found in bacteria and in eukaryotes but not...; Region:
                     Dtyr_deacylase; cd00563"
                     /db_xref="CDD:238316"
     misc_feature    order(18535..18537,18745..18759,18793..18795,18937..18939)
                     /locus_tag="DehaBAV1_0018"
                     /note="putative active site [active]"
                     /db_xref="CDD:238316"
     misc_feature    order(18646..18648,18655..18663,18667..18678,18745..18750,
                     18754..18759,18763..18771,18775..18789,18793..18795,
                     18895..18948)
                     /locus_tag="DehaBAV1_0018"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238316"
     misc_feature    order(18658..18660,18673..18675,18775..18777,18784..18786)
                     /locus_tag="DehaBAV1_0018"
                     /note="putative tRNAtyr binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238316"
     gene            19030..19458
                     /locus_tag="DehaBAV1_0019"
                     /db_xref="GeneID:5131342"
     CDS             19030..19458
                     /locus_tag="DehaBAV1_0019"
                     /note="PFAM: ferric-uptake regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator family protein"
                     /protein_id="YP_001213489.1"
                     /db_xref="GI:147668671"
                     /db_xref="InterPro:IPR002481"
                     /db_xref="GeneID:5131342"
                     /translation="MHKQNSIAGELASDGFRLTPQRVLILEALDMAEGHISAEDIYAE
                     VGQEYPNINISTVYRTLELLKGQGLVLETDMGDGRLRYHSVNKGSHHYLVCRKCGQVT
                     DLSEDMVKQLEQSIFKTYGFAADFKNLVIYGQCQKCSASA"
     misc_feature    19087..19434
                     /locus_tag="DehaBAV1_0019"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(19132..19134,19276..19278,19297..19299,19303..19305,
                     19336..19338)
                     /locus_tag="DehaBAV1_0019"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    19186..19230
                     /locus_tag="DehaBAV1_0019"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(19294..19296,19300..19302,19357..19359,19408..19410)
                     /locus_tag="DehaBAV1_0019"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(19309..19317,19363..19368,19393..19401,19405..19431)
                     /locus_tag="DehaBAV1_0019"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(19312..19314,19321..19323,19432..19434)
                     /locus_tag="DehaBAV1_0019"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            complement(19849..20601)
                     /locus_tag="DehaBAV1_0020"
                     /db_xref="GeneID:5132434"
     CDS             complement(19849..20601)
                     /locus_tag="DehaBAV1_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213490.1"
                     /db_xref="GI:147668672"
                     /db_xref="GeneID:5132434"
                     /translation="MESRKLSRFIIIVAIISLAASALLYLLHYYIFQDSHHIFIYMLG
                     DLAFIPLEVFLVVVVIERILTSREKHAISQKMNMVVGSFYSELGNALLGKILGSFDDP
                     EQIDSHMGVNKNWSSPEFKQALVYSSHFNHTPNPGKLDLQHLKNLLAAKRSFMLTLLE
                     NPNLLEKDDFTDLLWASFHLGEELDARPSLENLPETDKAHLANDVKRMYALLLNQWIK
                     YLIHLKSQYPHLYSLVLRTHPFQPSPNPVIHE"
     sig_peptide     complement(20533..20601)
                     /locus_tag="DehaBAV1_0020"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.950) with cleavage site probability 0.614 at
                     residue 23"
     gene            20704..21090
                     /locus_tag="DehaBAV1_0021"
                     /db_xref="GeneID:5132413"
     CDS             20704..21090
                     /locus_tag="DehaBAV1_0021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213491.1"
                     /db_xref="GI:147668673"
                     /db_xref="GeneID:5132413"
                     /translation="MVKYAPDMVADKKDQLEQIEGICLPDELIHAVFDLKGQGTGFIG
                     LTNKRIIFYDKEFAKKAKAIVSIPYNRVATVGSEDKGGLIFRKGFMVSDKLYVGVSGQ
                     AVKEFEFRGGDKAHQAHDIIMTYVLN"
     misc_feature    20776..20994
                     /locus_tag="DehaBAV1_0021"
                     /note="Pleckstrin homology-like domain; Region: PH-like;
                     cl17171"
                     /db_xref="CDD:266526"
     gene            complement(21172..21312)
                     /locus_tag="DehaBAV1_0022"
                     /db_xref="GeneID:5132256"
     CDS             complement(21172..21312)
                     /locus_tag="DehaBAV1_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213492.1"
                     /db_xref="GI:147668674"
                     /db_xref="GeneID:5132256"
                     /translation="MANRIAEQIDRTFFQFKWLFMPPKAKYVYLWNRSRASLQADYYG
                     LR"
     gene            complement(21369..23759)
                     /locus_tag="DehaBAV1_0023"
                     /db_xref="GeneID:5132410"
     CDS             complement(21369..23759)
                     /locus_tag="DehaBAV1_0023"
                     /note="TIGRFAM: DNA internalization-related competence
                     protein ComEC/Rec2;
                     PFAM: beta-lactamase domain protein; ComEC/Rec2-related
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA internalization-related competence protein
                     ComEC/Rec2"
                     /protein_id="YP_001213493.1"
                     /db_xref="GI:147668675"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR004477"
                     /db_xref="InterPro:IPR004797"
                     /db_xref="GeneID:5132410"
                     /translation="MIISLCSLGLIAGVALSRLGLPVLPFIILALALGVFWFIFRKKT
                     RLLLGLSLGFLALSGGLWLANSQITINSDPSRLDYYNDSGKLELQGIITENPDKRDRT
                     SLILLEASGIATSSGWQEVSGNVLLTLPSYPEYSYGDQIRISGYLKTPENFDGFDYKS
                     YLENQQIYSVMVYPETTLLSEDNGNPVMTAIFSFRQSLSESLSRAMPEPEASLAKGIL
                     LGERSGIPEDIQTEFSISGTTHLLAISGANLSILSGILLAALGWILGKRGYIYIYLTL
                     ILIWGYSLLSGFDPPVVRAVIMASIFLSAELLGRQKNAMPALCLAAAVMVAFSPSILW
                     SVSFQLSFMSMLGLILVYPMLKELNIRLLDRLGLAEGIFRATLGLVLDGLAVSLAAIA
                     GIWPVLLYYFENISLIGPVATLLAMPAMPFIIVLSFLTALLGLVFPAGAIFMGYLTWL
                     PCRYMLVVVSLTASVPGVLMSGLRPGAMLMGIYYFLLGMLYWLYKHMLKMPPSRPNTN
                     PASTLNLRWLLAGIAVPVLFFSFNLSPSTDQKLHVYFLNVGQGDAILIQYQNQDILID
                     GGPSPQTLCSELDKHLPFFDRSIEMVILTHPDSDHLNGLLEVLERYRVKEVILPQTRS
                     QDSLYQSYQNLIAEKAIPARIAETGMQITMANGAVLEVISPFGGLSSKAADTDNNHST
                     VLNLSCGQINYLFCADIETTVEYQLITQRLLADTTVLKVSHHGSKYSSSAWFLDVTSP
                     EFGLISVGADNRYGHPHPETLSRLISVMAENCIYRTDIWGSLDFATDGQSLYILQS"
     sig_peptide     complement(23697..23759)
                     /locus_tag="DehaBAV1_0023"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.812) with cleavage site probability 0.564 at
                     residue 21"
     misc_feature    complement(23247..23738)
                     /locus_tag="DehaBAV1_0023"
                     /note="Domain of unknown function (DUF4131); Region:
                     DUF4131; pfam13567"
                     /db_xref="CDD:257884"
     misc_feature    complement(21468..23510)
                     /locus_tag="DehaBAV1_0023"
                     /note="DNA internalization-related competence protein
                     ComEC/Rec2; Region: ComEC_Rec2; TIGR00361"
                     /db_xref="CDD:232940"
     misc_feature    complement(22272..23111)
                     /locus_tag="DehaBAV1_0023"
                     /note="Competence protein; Region: Competence; pfam03772"
                     /db_xref="CDD:252155"
     misc_feature    complement(21663..22124)
                     /locus_tag="DehaBAV1_0023"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; pfam00753"
                     /db_xref="CDD:250108"
     gene            complement(23756..24256)
                     /locus_tag="DehaBAV1_0024"
                     /db_xref="GeneID:5132409"
     CDS             complement(23756..24256)
                     /locus_tag="DehaBAV1_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA uptake protein and related DNA-binding
                     protein-like protein"
                     /protein_id="YP_001213494.1"
                     /db_xref="GI:147668676"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:5132409"
                     /translation="MKVSKRFGLLLGLALSVITAQGCSETTPLAVYTPPQITEKPLEI
                     YISGNINLPGIYPAGTQDTLQSLLESSGGLKDNSELTTIYLSFNPPPLASSAQKIDLN
                     RAEIWLLVALPGIGEARASDIVSYRNQNGGFKNTLELMLIPGFSQSLYDQIKDMICVS
                     ETADIS"
     sig_peptide     complement(24188..24256)
                     /locus_tag="DehaBAV1_0024"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.794 at
                     residue 23"
     misc_feature    complement(23780..24181)
                     /locus_tag="DehaBAV1_0024"
                     /note="DNA uptake protein and related DNA-binding proteins
                     [DNA replication, recombination, and repair]; Region:
                     ComEA; COG1555"
                     /db_xref="CDD:224472"
     misc_feature    complement(23783..23977)
                     /locus_tag="DehaBAV1_0024"
                     /note="Helix-hairpin-helix motif; Region: HHH_3;
                     pfam12836"
                     /db_xref="CDD:257337"
     gene            complement(24434..25099)
                     /locus_tag="DehaBAV1_0025"
                     /db_xref="GeneID:5132395"
     CDS             complement(24434..25099)
                     /locus_tag="DehaBAV1_0025"
                     /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA domain-containing protein"
                     /protein_id="YP_001213495.1"
                     /db_xref="GI:147668677"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006036"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="GeneID:5132395"
                     /translation="MYVVVIGGGRLGYYLLKALLNDGHEVLLIEKNSSLCDGINKEMG
                     SVCLHGDGCETAVLTEAGTSRADLLIAVTGDDEDNLVACQVAKYKFNVPRTIARVRNP
                     KNESVFRQLGVDSTVNSTNIILEHIEHEVPSHAMTHLLTLHGKDLEIIDIRIPENALT
                     VGKQIHELVLPPQTIISLIVRKDGKPILPRPETTVQVGDQFMIVTSAAKEAEIRDILT
                     ATA"
     misc_feature    complement(24449..25099)
                     /locus_tag="DehaBAV1_0025"
                     /note="K+ transport systems, NAD-binding component
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG0569"
                     /db_xref="CDD:223643"
     misc_feature    complement(24746..25093)
                     /locus_tag="DehaBAV1_0025"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(24461..24655)
                     /locus_tag="DehaBAV1_0025"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(25104..25508)
                     /locus_tag="DehaBAV1_0026"
                     /db_xref="GeneID:5132428"
     CDS             complement(25104..25508)
                     /locus_tag="DehaBAV1_0026"
                     /note="PFAM: TrkA-N domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA domain-containing protein"
                     /protein_id="YP_001213496.1"
                     /db_xref="GI:147668678"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006036"
                     /db_xref="GeneID:5132428"
                     /translation="MKVVIMGCGRVGAQLATMLDKEGNEVISLDIDAYSFRRLPADFK
                     GTALLCNGMDEESLKKAGIETADAFVAVTQGDNRNIMAAQIAKKIFNVPKVVCRIYDP
                     LRRDLYTLLGLDAISPTTIFAQMLKDKIESKE"
     misc_feature    complement(<25110..25508)
                     /locus_tag="DehaBAV1_0026"
                     /note="K+ transport systems, NAD-binding component
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG0569"
                     /db_xref="CDD:223643"
     misc_feature    complement(25155..25502)
                     /locus_tag="DehaBAV1_0026"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     gene            complement(25512..25940)
                     /locus_tag="DehaBAV1_0027"
                     /db_xref="GeneID:5132222"
     CDS             complement(25512..25940)
                     /locus_tag="DehaBAV1_0027"
                     /note="PFAM: UspA domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="YP_001213497.1"
                     /db_xref="GI:147668679"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="GeneID:5132222"
                     /translation="MEFERILVPVDGTETDEEAISLACTISKVSGKTRVFAVHIIPVE
                     RALPLDAELSSAINKSEGILAKAEEIAEKQGVKLETDLLQAREVANAIIDEAVEKEID
                     LILIGLSYKTRFGEFCMGGVLPYILQNAPCRVIVYHQRKV"
     misc_feature    complement(25527..25928)
                     /locus_tag="DehaBAV1_0027"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases, ATP sulphurylases Universal
                     Stress Response protein and electron transfer flavoprotein
                     (ETF). The domain forms a apha/beta/apha fold which  binds
                     to Adenosine nucleotide; Region: AANH_like; cl00292"
                     /db_xref="CDD:260331"
     misc_feature    complement(order(25821..25823,25827..25829,25893..25904,
                     25911..25916))
                     /locus_tag="DehaBAV1_0027"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     gene            complement(26017..27462)
                     /locus_tag="DehaBAV1_0028"
                     /db_xref="GeneID:5132385"
     CDS             complement(26017..27462)
                     /locus_tag="DehaBAV1_0028"
                     /note="PFAM: cation transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="YP_001213498.1"
                     /db_xref="GI:147668680"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="GeneID:5132385"
                     /translation="MKINNVLHYLGLVIAIVGGFMLIPFIFSLINAEPDQMAFGISIV
                     ITLSAGFLLWRFTPITERRISLRESLAIVAGSWIMAALFGSLPFIISGVLPSVIDCIF
                     EAMSGLTTTGASVFSSVENLPHGILVWRSLTQWIGGLGIIMLFVTILPMLGIGASQLM
                     EAETPGQQERLTSRIRDTARTLWLLYLGFTVAGFIALVIAGLPGFDAFNVILATTPTG
                     GFAPVSSIGVYNNLAVELILIFFMVASGVNFGLYYYLLWKGRPAKFFGNPEFKLYIGI
                     LAGCILLINWDLVANAGIGIFEGLRQASFQTASVMTTTGFATADFATWPHFSQAILLV
                     LMVVGASAGSTGGGLKVIRLLVLFKYTYRRILLTFNPNAVIPIKIGGNVISDKLISRS
                     VGLTILYFAALWAGFLIMSAIGLDFVTALSSITSCLGNIGPALGTVGPMSSYADIPGI
                     GKLVLLIAMLVGRIELFTLLVLFVPAFWRWR"
     misc_feature    complement(26026..27462)
                     /locus_tag="DehaBAV1_0028"
                     /note="Trk-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: TrkG;
                     COG0168"
                     /db_xref="CDD:223246"
     misc_feature    complement(26026..27462)
                     /locus_tag="DehaBAV1_0028"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     sig_peptide     complement(27364..27462)
                     /locus_tag="DehaBAV1_0028"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.857) with cleavage site probability 0.661 at
                     residue 33"
     gene            complement(27466..28830)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /db_xref="GeneID:5131227"
     CDS             complement(27466..28830)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="YP_001213499.1"
                     /db_xref="GI:147668681"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006036"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="GeneID:5131227"
                     /translation="MYIVIAGGGTVGYNIASMLVVEDHEVVVVEQSEKAVEYLNQQLD
                     IKTIFGNAAIPRILRDAEVQRADLVLAVTDRDETNMVICFIAKEMGAATTAARIRNSE
                     YTGYFIPPAKSTLSARRIIRPKSLGIDVFINPEVEMAREILGILSSFYSTPVEQLANG
                     LVQIRSFTIEGSPMAGKTLSELNFAKPCVVAAIARKEELLVPRPDLVLENEDALYLVA
                     ERDNMDYLGRMFSAIQRPARSVFILGGTQIGMLVAEGLADHDVVVKLIEPDEEKSQKA
                     AVRLEKAVVLKGDPTDRDFLTEQGVPSADAFVATTENDEFNILSCLVAKNLGVDRSLT
                     VINKPSYIPLAEAVDIDVAGSPAIITARKIAHFVLSGGAIAATLLESGQLEAVEFVVS
                     PQAGIINQKVSQIEIPKEATIGAVVQNNQVIIPPDEAVIHAGDHVIVVSQLNVLHDVE
                     KLFK"
     misc_feature    complement(27469..28830)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /note="potassium transporter peripheral membrane
                     component; Reviewed; Region: trkA; PRK09496"
                     /db_xref="CDD:236541"
     misc_feature    complement(28462..28824)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(28153..28341)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(27763..28113)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(27484..27672)
                     /gene="trkA"
                     /locus_tag="DehaBAV1_0029"
                     /gene_synonym="sapG"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            29308..29937
                     /locus_tag="DehaBAV1_0030"
                     /db_xref="GeneID:5132426"
     CDS             29308..29937
                     /locus_tag="DehaBAV1_0030"
                     /note="PFAM: protein of unknown function DUF47"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213500.1"
                     /db_xref="GI:147668682"
                     /db_xref="InterPro:IPR002727"
                     /db_xref="GeneID:5132426"
                     /translation="MPRISIIPREEKFFDLLEMSAKNMVITAQELDKLVNNWVNVDDQ
                     VARIADLEHEGDSIAHQIINLLHRTFVTPFDREDIALLAHTMDDVTDFIHSAADFMFI
                     YKTGRPGERAKELAAIIVLAAKEVSLAVPHLRHKSEMKQVISHCVEINRLENLADVAF
                     RAALGELFTDSKDMANIIKWREIFEHMETATDRCEDVANVLEGVALKNA"
     misc_feature    29329..29931
                     /locus_tag="DehaBAV1_0030"
                     /note="Phosphate transport regulator (distant homolog of
                     PhoU) [Inorganic ion transport and metabolism]; Region:
                     COG1392"
                     /db_xref="CDD:224310"
     misc_feature    29416..29913
                     /locus_tag="DehaBAV1_0030"
                     /note="TIGR00153 family protein; Region: TIGR00153"
                     /db_xref="CDD:232846"
     gene            29930..30931
                     /locus_tag="DehaBAV1_0031"
                     /db_xref="GeneID:5132398"
     CDS             29930..30931
                     /locus_tag="DehaBAV1_0031"
                     /note="PFAM: phosphate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter"
                     /protein_id="YP_001213501.1"
                     /db_xref="GI:147668683"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="InterPro:IPR002345"
                     /db_xref="GeneID:5132398"
                     /translation="MPDASFLPYLLIILLAIGFAFVNGTNDTANAIATVVGTRVLSPR
                     KAIIMAAVANLAGVFTGTAVARTIGKGILGPESLTYETVIAGLIAAVIWSVVATRKGL
                     PVSLTHCLVAGLAMAGVAMAGFGSVDWGILLKIIAAVGIAPIMGMAGGYLLMVALLWI
                     FRRSVPSKTNGLFSHLQIFSAAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIP
                     FWIIVLSALSISAGTAIGGWKVIQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIP
                     VSSTHAISSAIMGVGATRRLSAVRWGVAGNIVGAWLLTFPICGVLGFLVAGLFKLIF"
     misc_feature    29996..30895
                     /locus_tag="DehaBAV1_0031"
                     /note="Phosphate transporter family; Region: PHO4;
                     pfam01384"
                     /db_xref="CDD:250576"
     gene            complement(30928..31545)
                     /gene="gmk"
                     /locus_tag="DehaBAV1_0032"
                     /db_xref="GeneID:5132357"
     CDS             complement(30928..31545)
                     /gene="gmk"
                     /locus_tag="DehaBAV1_0032"
                     /EC_number="2.7.4.8"
                     /note="Essential for recycling GMP and indirectly, cGMP"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_001213502.1"
                     /db_xref="GI:147668684"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="GeneID:5132357"
                     /translation="MTNWNFNKAEKPLLLIVSGPSGVGKDAVLARMKERKLPLTYIVT
                     TTTRPKRETETEGVDYNFIRPAEFQELISQNELLEWANVYGNFYGVPKAPIRQALSRG
                     SDVIVKVDVQGAASIKKIVPNAVFIFLMPPDMDELTRRLEHRLTESPESLRRRLATAP
                     LEIEKLPDFDYVVVNPEGEIDNAVREIMSIIAAEHCRIQPRLIEL"
     misc_feature    complement(30964..31506)
                     /gene="gmk"
                     /locus_tag="DehaBAV1_0032"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(31147..31506)
                     /gene="gmk"
                     /locus_tag="DehaBAV1_0032"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(31282..31284,31297..31299,31366..31368,
                     31393..31395,31402..31404,31423..31425,31471..31473,
                     31489..31491))
                     /gene="gmk"
                     /locus_tag="DehaBAV1_0032"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(31471..31473,31489..31491))
                     /gene="gmk"
                     /locus_tag="DehaBAV1_0032"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            complement(31526..31816)
                     /locus_tag="DehaBAV1_0033"
                     /db_xref="GeneID:5131172"
     CDS             complement(31526..31816)
                     /locus_tag="DehaBAV1_0033"
                     /note="PFAM: protein of unknown function DUF370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213503.1"
                     /db_xref="GI:147668685"
                     /db_xref="InterPro:IPR007169"
                     /db_xref="GeneID:5131172"
                     /translation="MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLI
                     DMTNGRKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL"
     misc_feature    complement(31544..31816)
                     /locus_tag="DehaBAV1_0033"
                     /note="hypothetical protein; Provisional; Region:
                     PRK04323"
                     /db_xref="CDD:179823"
     gene            32025..32873
                     /locus_tag="DehaBAV1_0034"
                     /db_xref="GeneID:5131171"
     CDS             32025..32873
                     /locus_tag="DehaBAV1_0034"
                     /EC_number="1.97.-.-"
                     /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP(+) reductase subunit alpha"
                     /protein_id="YP_001213504.1"
                     /db_xref="GI:147668686"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="GeneID:5131171"
                     /translation="MYTIIERQDLLPKVHLLKIQAPKVAAAAAAGQFVILRVDTEGER
                     FPLTIADWDAQAGTVTVIYMEIGVSTRKLAKLGKGDAILDFAGPLGKPTEIENFGTVV
                     CVSGGFAMATIVPIARAMKEAGNRVISIVGARSKDLFFWHDRLTKYSDEMIVCTDDGS
                     AGIKGLVTEPLRDLLSSDTKLDRVIVIGPSVMMKFCSKTTQPFGVKTIVSLNPIMIDG
                     TGMCGCCRVSLDGQTRFACVDGPEFDGHKVDWDGLLVRQKSYVAEEAVASERCRCKEE
                     GCGNHG"
     misc_feature    32025..32867
                     /locus_tag="DehaBAV1_0034"
                     /note="ferredoxin-NADP(+) reductase subunit alpha;
                     Reviewed; Region: PRK06222"
                     /db_xref="CDD:235747"
     misc_feature    32028..32771
                     /locus_tag="DehaBAV1_0034"
                     /note="FAD/NAD binding domain in the electron transfer
                     subunit of dihydroorotate dehydrogenase-like proteins.
                     Dihydroorotate dehydrogenases (DHODs) catalyze the only
                     redox reaction in pyrimidine de novo biosynthesis. They
                     catalyze the oxidation of (S)...; Region:
                     DHOD_e_trans_like1; cd06219"
                     /db_xref="CDD:99815"
     misc_feature    order(32151..32153,32157..32168,32208..32216,32226..32234,
                     32346..32348,32661..32666)
                     /locus_tag="DehaBAV1_0034"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99815"
     misc_feature    order(32157..32159,32163..32168)
                     /locus_tag="DehaBAV1_0034"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99815"
     misc_feature    order(32229..32231,32238..32240,32247..32249,32259..32261,
                     32286..32288,32292..32294)
                     /locus_tag="DehaBAV1_0034"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99815"
     misc_feature    order(32331..32333,32343..32354,32358..32360)
                     /locus_tag="DehaBAV1_0034"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99815"
     misc_feature    order(32346..32351,32418..32426,32586..32591)
                     /locus_tag="DehaBAV1_0034"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99815"
     misc_feature    order(32673..32675,32688..32690,32697..32699,32733..32735)
                     /locus_tag="DehaBAV1_0034"
                     /note="Iron coordination center [ion binding]; other site"
                     /db_xref="CDD:99815"
     gene            32866..34263
                     /locus_tag="DehaBAV1_0035"
                     /db_xref="GeneID:5131169"
     CDS             32866..34263
                     /locus_tag="DehaBAV1_0035"
                     /EC_number="1.97.-.-"
                     /note="function undetermined; similar to glutamate
                     synthase beta subunit and related oxidoreductases which
                     transfer electrons from NADPH to an acceptor protein or
                     protein domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="YP_001213505.1"
                     /db_xref="GI:147668687"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR006004"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5131169"
                     /translation="MAKAGLNRIDMPKQAVAKRIQNFSEVATGYTPSDAHIEAARCLQ
                     CKKRYCVEGCPVNIDIPEFILALREGDMPEAARILKKTNSLPGVCGRVCPQETQCEQA
                     CILNKKEVPIAIGRLERFVADWEREHSAEVNLPKSLKPKSGKKAAVVGAGPAGLTASA
                     ELARLGHDVTLFESLHTAGGVLMYGIPEFRLPKDIVQGEVEYVKSLGVKIELNSVAGR
                     LFSLDDLFKQGFQAVFLATGAGLPLFLNVQGENLNGVYSANEFLTRINLMKAHSFPEY
                     DTPVKKGKKVAVIGGGNVAMDAARCALRLGAEEVSIIYRRSEVELPARKEEVENAREE
                     GIKFHFLTSPVRFLANEQGKVRAMDCQKMELGEPDASGRRRPIPVDGSEFEMDIDLAI
                     IALGTRPNPLVMQSAPDLQVNPNGTVAAGISGQTSHRAVWAGGDIVTGSDTVISAMGA
                     AKRSALVMDEYLRSL"
     misc_feature    32866..34257
                     /locus_tag="DehaBAV1_0035"
                     /note="dihydropyrimidine dehydrogenase subunit A;
                     Provisional; Region: PRK11749"
                     /db_xref="CDD:236967"
     misc_feature    32920..33249
                     /locus_tag="DehaBAV1_0035"
                     /note="Dihydroprymidine dehydrogenase domain II, 4Fe-4S
                     cluster; Region: Fer4_20; pfam14691"
                     /db_xref="CDD:258829"
     misc_feature    33304..33813
                     /locus_tag="DehaBAV1_0035"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    33718..33930
                     /locus_tag="DehaBAV1_0035"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(34260..34466)
                     /locus_tag="DehaBAV1_0036"
                     /db_xref="GeneID:5131166"
     CDS             complement(34260..34466)
                     /locus_tag="DehaBAV1_0036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213506.1"
                     /db_xref="GI:147668688"
                     /db_xref="GeneID:5131166"
                     /translation="MFRSALLFYVFAMLALCFIPAWHSFISQVTGSLDQNLSLVIKLI
                     ADPLEYVWKWVLAIFIILLLNRRN"
     sig_peptide     complement(34371..34466)
                     /locus_tag="DehaBAV1_0036"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.867) with cleavage site probability 0.402 at
                     residue 32"
     gene            complement(34582..35115)
                     /locus_tag="DehaBAV1_0037"
                     /db_xref="GeneID:5131165"
     CDS             complement(34582..35115)
                     /locus_tag="DehaBAV1_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213507.1"
                     /db_xref="GI:147668689"
                     /db_xref="GeneID:5131165"
                     /translation="MKIEPEVRKEINQVLDAMKEAVEAKNIEALVALVDSEPNILTVG
                     PCPDNVGLGQNGFRRWMQALLDKATPVKFKLGFTTIKGNGPVVWLDTHVTYTCKNGEN
                     QKDFDFYLSGVMEKVTNEWRWSQMHLSAPSELEFPEGPPPSPEAEKPAEKPKDTTENK
                     APNPEQGEDAPPEWNYM"
     misc_feature    complement(34723..35085)
                     /locus_tag="DehaBAV1_0037"
                     /note="SnoaL-like domain; Region: SnoaL_3; pfam13474"
                     /db_xref="CDD:257798"
     gene            complement(35186..35794)
                     /locus_tag="DehaBAV1_0038"
                     /db_xref="GeneID:5131162"
     CDS             complement(35186..35794)
                     /locus_tag="DehaBAV1_0038"
                     /note="PFAM: Methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="YP_001213508.1"
                     /db_xref="GI:147668690"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:5131162"
                     /translation="MLEINYSTAIDPFLRNIRSFIPDFGGIKPGERVLDVCSGSGAQV
                     GEYRKRGILGFGLDLSPDMLSLSRRLYDPALPSDSYFTEADARHLPFADASFDYTSTT
                     LALHDKPSQTCLEILAEMKRVVKPEGYILIADYTCPLPASFPGWIIRTIERLAGGEHY
                     RNFRQYLKHGGVPALFEELGIKPEGTQTTSYGLITVTKAKVS"
     misc_feature    complement(35384..35701)
                     /locus_tag="DehaBAV1_0038"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(35489..35491,35537..35545,35618..35623,
                     35669..35689))
                     /locus_tag="DehaBAV1_0038"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(35805..35999)
                     /locus_tag="DehaBAV1_0039"
                     /db_xref="GeneID:5131163"
     CDS             complement(35805..35999)
                     /locus_tag="DehaBAV1_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213509.1"
                     /db_xref="GI:147668691"
                     /db_xref="GeneID:5131163"
                     /translation="MFDFFFGGILGLISFAISLAFYFLPTIIALAKHRRNTLAIFLLN
                     FFLGWTFIGWVVALVWSVKK"
     misc_feature    complement(35811..35939)
                     /locus_tag="DehaBAV1_0039"
                     /note="Superinfection immunity protein; Region:
                     Imm_superinfect; pfam14373"
                     /db_xref="CDD:258543"
     gene            36141..36512
                     /locus_tag="DehaBAV1_0040"
                     /db_xref="GeneID:5131854"
     CDS             36141..36512
                     /locus_tag="DehaBAV1_0040"
                     /note="PFAM: protein of unknown function DUF1025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213510.1"
                     /db_xref="GI:147668692"
                     /db_xref="InterPro:IPR010428"
                     /db_xref="GeneID:5131854"
                     /translation="MDIEQFKQLVGEAVDSLPEEFLALLDNVEILVADRPSRVQRRNL
                     DMQAGEELLGLYEGVPLTERHASYGMVTPDRITIFRLAILDTVKSEDDIKDEVRRVVK
                     HEVAHHFGISDERLEEMGGPV"
     misc_feature    36144..36494
                     /locus_tag="DehaBAV1_0040"
                     /note="Minimal MMP-like domain found in Acidothermus
                     cellulolyticus hypothetical protein ACEL2062 and similar
                     protein; Region: MMP_ACEL2062; cd12952"
                     /db_xref="CDD:240572"
     gene            36648..37094
                     /locus_tag="DehaBAV1_0041"
                     /db_xref="GeneID:5131875"
     CDS             36648..37094
                     /locus_tag="DehaBAV1_0041"
                     /note="TIGRFAM: C_GCAxxG_C_C family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="C_GCAxxG_C_C family protein"
                     /protein_id="YP_001213511.1"
                     /db_xref="GI:147668693"
                     /db_xref="InterPro:IPR010181"
                     /db_xref="GeneID:5131875"
                     /translation="MSDIAVSAQILHEKGFNCAQSLLAAFAPSLGIETGTALKLASAF
                     GGGMAARGDTCGVISGGLMVIGLKFGQASVEDKAAREKCNRLGREFLKQFEAEFGATA
                     CRDLIKCNIGTPEGAKMVKEKGLREGLCSKLVYRGAEILSALIEQI"
     misc_feature    36693..37082
                     /locus_tag="DehaBAV1_0041"
                     /note="Putative redox-active protein (C_GCAxxG_C_C);
                     Region: C_GCAxxG_C_C; pfam09719"
                     /db_xref="CDD:255505"
     gene            complement(37091..38194)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /db_xref="GeneID:5131853"
     CDS             complement(37091..38194)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="translation-associated GTPase; the crystal
                     structure of the Haemophilus influenzae YchF protein
                     showed similarity to the yeast structure (PDB: 1NI3);
                     fluorescence spectroscopy revealed nucleic acid binding;
                     the yeast protein YBR025c interacts with the translation
                     elongation factor eEF1"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-dependent nucleic acid-binding protein EngD"
                     /protein_id="YP_001213512.1"
                     /db_xref="GI:147668694"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="GeneID:5131853"
                     /translation="MAVTIGIIGLAKSGRTTIFNAATRSNAATGSYSQSSSANVGIVK
                     VPDARLSPLEEMFHPKKLTPAEIKYFDVGASLKGGTKDSSFSGELLTQLQNVDALLNV
                     IRAFEDTAIPLPAGGINAERDLTTMNAELIFSDLTIIEKRLNRIGSQMKSAKPPERAA
                     LEREKELMARIKEAMEKDIPVRDMEVDEEEAKILSGYQFLSNKPVLMVINIGEDDLPK
                     AAEMEAELNTRYGGKNYRVIVMCGKLEAELINMDEAEATEFRSSYGLKETGLDRTIRA
                     SYDLLDLISFFTVGPDEVRAWTITRGTISQKAAGKIHSDIERGYIRAEIVHVGDLLTA
                     GSLAEVRKRGQLRLEGKTYIVQDGDTANFLFNV"
     misc_feature    complement(37094..38194)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="GTP-binding protein YchF; Reviewed; Region:
                     PRK09601"
                     /db_xref="CDD:236583"
     misc_feature    complement(37352..38182)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="YchF GTPase; Region: YchF; cd01900"
                     /db_xref="CDD:206687"
     misc_feature    complement(38147..38170)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="G1 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(37466..37474,37556..37558,37562..37567,
                     38144..38155,38159..38161))
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206687"
     misc_feature    complement(38081..38104)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(38090..38092)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="G2 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(37910..37939,37958..37987))
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(37973..37984)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="G3 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(37556..37567)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="G4 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(37466..37474)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="G5 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(37100..37348)
                     /locus_tag="DehaBAV1_0042"
                     /gene_synonym="ychF"
                     /note="TGS_YchF_C: This subfamily represents TGS
                     domain-containing YchF GTP-binding protein, a universally
                     conserved GTPase whose function is unknown. The N-terminal
                     domain of the YchF protein belongs to the Obg-like family
                     of GTPases, and some members of the...; Region:
                     TGS_YchF_C; cd04867"
                     /db_xref="CDD:133440"
     gene            complement(38216..38458)
                     /locus_tag="DehaBAV1_0043"
                     /db_xref="GeneID:5131872"
     CDS             complement(38216..38458)
                     /locus_tag="DehaBAV1_0043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213513.1"
                     /db_xref="GI:147668695"
                     /db_xref="GeneID:5131872"
                     /translation="MPEEVVMPYELRKHIAIANDMEIAPEIREKTIKHIARFGSYEAL
                     CALLDIACNTKANYGERDLALKVSRDVLKNSRKNDI"
     gene            38586..39614
                     /locus_tag="DehaBAV1_0044"
                     /db_xref="GeneID:5131871"
     CDS             38586..39614
                     /locus_tag="DehaBAV1_0044"
                     /note="TIGRFAM: DNA polymerase III, delta subunit;
                     PFAM: DNA polymerase III, delta"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta"
                     /protein_id="YP_001213514.1"
                     /db_xref="GI:147668696"
                     /db_xref="InterPro:IPR005790"
                     /db_xref="InterPro:IPR010372"
                     /db_xref="GeneID:5131871"
                     /translation="MLYIFTGSDDFSLKERLKQIKQALGDESLASANTTLLEAKNLTA
                     AELLNYVQTIPFLAPARLVIVNGLLERFEGAKGKTAAKDTANKNSPDEFARALDNLPP
                     TTLAVLLDYTTAKDGDYREKEKVSALATNPLFKIIGSRAEVKHFAPLSAQNLPGWVMQ
                     RAKQSSIQMSVPAARLLGRLAGPDLWALSTEIEKLGLYAQGRVIEEADVQAMVGYAQE
                     VNIFSLVDAILDCKVKEAQQSLAAFTSAGGSPGFLLFMLVRQLRLMVRYTALKKRGLK
                     EAEVFKVMGGSEYALRKTASQAVCQNMDSLKNIYTKLLETDLYIKTGRFEPELALSLL
                     VAELCGRK"
     misc_feature    38592..39176
                     /locus_tag="DehaBAV1_0044"
                     /note="DNA polymerase III, delta subunit; Region:
                     DNA_pol3_delta; cl19912"
                     /db_xref="CDD:268265"
     misc_feature    38628..39602
                     /locus_tag="DehaBAV1_0044"
                     /note="DNA polymerase III, delta subunit; Region: holA;
                     TIGR01128"
                     /db_xref="CDD:233280"
     gene            39616..40227
                     /locus_tag="DehaBAV1_0045"
                     /db_xref="GeneID:5131848"
     CDS             39616..40227
                     /locus_tag="DehaBAV1_0045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213515.1"
                     /db_xref="GI:147668697"
                     /db_xref="GeneID:5131848"
                     /translation="MEEKQKQSLREQLKTVKWGSLLLTFGALIALSFLLAWGLNSLVD
                     SLDIPLDEYAWLTYLLVFVMSILANATVIAPVPFAISIMVAAATNFNPVLVALFGALG
                     GSLGEMSGYFAGRLGKKLAIPEGLVGYNRVEIWIQKYGAWAIAFLAAQPIVPFDVGGL
                     IAGLARMPVHKFLPALFLGKFPKYIILIYAGIGLMDWLPFLKA"
     sig_peptide     39616..39726
                     /locus_tag="DehaBAV1_0045"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.918) with cleavage site probability 0.491 at
                     residue 37"
     misc_feature    39841..40194
                     /locus_tag="DehaBAV1_0045"
                     /note="SNARE associated Golgi protein; Region:
                     SNARE_assoc; pfam09335"
                     /db_xref="CDD:255296"
     gene            40262..41269
                     /locus_tag="DehaBAV1_0046"
                     /db_xref="GeneID:5131879"
     CDS             40262..41269
                     /locus_tag="DehaBAV1_0046"
                     /EC_number="2.7.1.2"
                     /note="PFAM: ROK family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="YP_001213516.1"
                     /db_xref="GI:147668698"
                     /db_xref="InterPro:IPR000600"
                     /db_xref="GeneID:5131879"
                     /translation="MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCA
                     LNGVTGVFESICLVLDRLLERNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRD
                     VPLRDMLTERYLKTFIINDASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNEL
                     YLGQSGCAGEIGHMCLDINGKEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSVLVE
                     RFKADYSALTAEDIGRAASEGDRLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGV
                     SKLGEIFIEPARQVLYKRAFRLAGDDVRLIVSVLGDNAGVIGAALYAYACLDSANNQP
                     Q"
     misc_feature    40298..41233
                     /locus_tag="DehaBAV1_0046"
                     /note="Transcriptional regulator/sugar kinase
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: NagC; COG1940"
                     /db_xref="CDD:224851"
     misc_feature    40301..>40705
                     /locus_tag="DehaBAV1_0046"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(40310..40321,40325..40327,40331..40333,40622..40624,
                     40694..40705)
                     /locus_tag="DehaBAV1_0046"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     misc_feature    <40613..41221
                     /locus_tag="DehaBAV1_0046"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     gene            41385..44000
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /db_xref="GeneID:5131843"
     CDS             41385..44000
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /EC_number="6.1.1.7"
                     /note="Catalyzes a two-step reaction, first charging an
                     alanyl molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="YP_001213517.1"
                     /db_xref="GI:147668699"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="GeneID:5131843"
                     /translation="MFSSDELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTTAGMV
                     QFKPYYLGVAKPENPRMASCQKCFRTTDIESVGDASHLTMFEMLGNFSIGNYFKKEAI
                     AWAWEYVTQRLNIPAERLWITVYLDDDEAIALWKEQGVPENRIVRLGAADNFWGPAGD
                     SGPCGPCSEIHYDFGQETGCGKADCNPSCKCGRFCEIWNLVFVQFNQDKSGKRQNLPA
                     PSIDTGMGLERLTILMQSKKNVYETDIFAPIVEKACLLSGRKYGCDAATDRALRIVSE
                     HSRGITFLIADGVIPDKAGRGYVLRRLLRRAVLFGRRLGLERPFLVDMAGAVINRMSG
                     IYPELKKRQTYVLEMIASEEARFSETLATGLELLEEIVRQTKGGRISGQDAFKLYDTY
                     GFPVEMTTEIAAEKGLSVDLDGFESEMEIQRTKARSSRKFSFDAAATAEAVKNMRHAE
                     KTCFVGYELAIQKSTIKDILTEGGTVDSIEEGDEASIVLDESPFYAEMGGQVGDTGEI
                     ITDAGRFEVKNTLHLPNGVFLHQGRVINGCLKISEAATAHINEERRRDIARNHTATHI
                     LQTALREVLGEQVQQRGSVVTPDRLRFDFSHLKPMSKDEMRRVEEFVNDKIRRNLPVY
                     AEEMPYRHALEEGVTALFGEKYGDRVRVLRVGRPAVSAELCGGTHVTASGEIALFKIM
                     SESSVGAGLRRIEAVTGREAEAFINLQQDSLSELSGMLESTAEESPRKLAELKEEIDT
                     LKKAVQNLERQMSRGEAEELLSKAEDYKGVKLLVSRMTSVNADTLRETADFLRDKLGS
                     GVIVLGTVTEDKPFFLCMVTPDLIAKGYHAGNIVKKLSQIAGGGGGGKPNMAQGGGRD
                     KSKLDEALQAVKGMI"
     misc_feature    41385..43997
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="alanyl-tRNA synthetase; Reviewed; Region: alaS;
                     PRK00252"
                     /db_xref="CDD:234701"
     misc_feature    41394..42095
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="Alanyl-tRNA synthetase (AlaRS) class II core
                     catalytic domain. AlaRS is a homodimer. It is responsible
                     for the attachment of alanine to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: AlaRS_core;
                     cd00673"
                     /db_xref="CDD:238360"
     misc_feature    41448..41462
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="motif 1; other site"
                     /db_xref="CDD:238360"
     misc_feature    order(41529..41531,41535..41537,41589..41591,41637..41639,
                     41643..41645,41649..41657,41970..41975,41985..41987,
                     42042..42047,42057..42062,42069..42071)
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="active site"
                     /db_xref="CDD:238360"
     misc_feature    41586..41594
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="motif 2; other site"
                     /db_xref="CDD:238360"
     misc_feature    42054..42071
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="motif 3; other site"
                     /db_xref="CDD:238360"
     misc_feature    42843..43427
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; cl08469"
                     /db_xref="CDD:263673"
     misc_feature    <43503..43748
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="FlxA-like protein; Region: FlxA; pfam14282"
                     /db_xref="CDD:258463"
     misc_feature    43776..43988
                     /gene="alaS"
                     /locus_tag="DehaBAV1_0047"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            44047..44448
                     /locus_tag="DehaBAV1_0048"
                     /db_xref="GeneID:5131866"
     CDS             44047..44448
                     /locus_tag="DehaBAV1_0048"
                     /note="PFAM: Holliday junction resolvase YqgF;
                     SMART: Resolvase, RNase H domain protein fold"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase YqgF"
                     /protein_id="YP_001213518.1"
                     /db_xref="GI:147668700"
                     /db_xref="InterPro:IPR005227"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="GeneID:5131866"
                     /translation="MGDKWIGAALSDPLRILASPLVILRRDDDTKTLENIESLVKTHQ
                     PDLLIIGLPISLNGTIGPQAEKVKSFSELLSRHLNIEIIYRDERFSTDEARRKMNDSG
                     KNNKTVRDDAAAAAVILQDYLDETNPPCCQP"
     misc_feature    44050..44421
                     /locus_tag="DehaBAV1_0048"
                     /note="Uncharacterized protein family (UPF0081); Region:
                     UPF0081; pfam03652"
                     /db_xref="CDD:252086"
     gene            44470..45648
                     /gene="tgt"
                     /locus_tag="DehaBAV1_0049"
                     /db_xref="GeneID:5131803"
     CDS             44470..45648
                     /gene="tgt"
                     /locus_tag="DehaBAV1_0049"
                     /EC_number="2.4.2.29"
                     /note="Exchanges the guanine residue with
                     7-aminomethyl-7-deazaguanine in tRNAs with GU(N)
                     anticodons (tRNA-Asp, -Asn, -His and -Tyr)"
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="YP_001213519.1"
                     /db_xref="GI:147668701"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="InterPro:IPR004803"
                     /db_xref="GeneID:5131803"
                     /translation="MDKSFILNKTSSRSLARRGQLFTAHGKVETPVFCPVGSQATVKT
                     LTPEDLKSVNINMILSNTYHLYLRPGIPIIKEMGGLHKFMNWDGVILTDSGGYQIFSL
                     ANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVL
                     AAMERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPELRRQSAEYLASLDFPGYALGGLS
                     LGEPKDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARN
                     GAFFSRLGRLNIRNAAFATQKGPIDPDCNCYTCRNYSAAYLHHLFRCEEILAYRLATI
                     HNIAFLSNLMQEIRTSIEKDCFEEFKADFLSRYQPTNEAIRIEQKQKWLFGRNGEPPS
                     "
     misc_feature    44470..45567
                     /gene="tgt"
                     /locus_tag="DehaBAV1_0049"
                     /note="queuine tRNA-ribosyltransferase; Provisional;
                     Region: tgt; PRK00112"
                     /db_xref="CDD:234642"
     misc_feature    44494..45570
                     /gene="tgt"
                     /locus_tag="DehaBAV1_0049"
                     /note="Queuine/archaeosine tRNA-ribosyltransferase
                     [Translation, ribosomal structure and biogenesis]; Region:
                     Tgt; COG0343"
                     /db_xref="CDD:223420"
     gene            45743..46885
                     /locus_tag="DehaBAV1_0050"
                     /db_xref="GeneID:5131800"
     CDS             45743..46885
                     /locus_tag="DehaBAV1_0050"
                     /note="PFAM: iron-containing alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="YP_001213520.1"
                     /db_xref="GI:147668702"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="GeneID:5131800"
                     /translation="MITTFDLSTRIIFGVGSISSLNHEASLLGRHALLVTGKGAVRRL
                     GILERALFLLKEACIQTTLFDHVEPNPRSSTVDEGIKLARAKGVDLIIALGGGSAMDA
                     AKAIAFGLACNGPVWDYIQQEEYPEGDLLPLIMIPTVAASGSEANGNAVISNWEKHEK
                     RVISDNRLQPKVSLVDPLLTLSLPPRQTAQGGVDIFCHIAEPYLTAADTSPLRDGMAE
                     LAMRLVVEYLPKAVQTPHDLQSRTQLSWLSTIACSQFMSLGGKSGNMTMHGLEHALSG
                     YYDIAHADGLAALLPAYMRNLYPVRRHRIEMLGEKVFGQTDGILAVENWLKKNNINFS
                     LKDLGVAEAKIEEIAAAAIVMSPWVKNHPGVLDKRVATSLYSTAFN"
     misc_feature    45752..46762
                     /locus_tag="DehaBAV1_0050"
                     /note="Dehydroquinate synthase-like (DHQ-like) and
                     iron-containing alcohol dehydrogenases (Fe-ADH); Region:
                     DHQ_Fe-ADH; cl02872"
                     /db_xref="CDD:261488"
     misc_feature    order(45851..45853,46028..46036,46043..46045,46052..46054,
                     46154..46159,46163..46165,46220..46225,46277..46279,
                     46301..46303,46322..46324,46334..46336,46544..46546,
                     46556..46558,46586..46588)
                     /locus_tag="DehaBAV1_0050"
                     /note="active site"
                     /db_xref="CDD:173927"
     misc_feature    order(45851..45853,46028..46036,46154..46159,46163..46165,
                     46277..46279,46586..46588)
                     /locus_tag="DehaBAV1_0050"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173927"
     misc_feature    order(46322..46324,46544..46546,46586..46588)
                     /locus_tag="DehaBAV1_0050"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173927"
     gene            47151..50104
                     /locus_tag="DehaBAV1_R0001"
                     /db_xref="GeneID:5131798"
     rRNA            47151..50104
                     /locus_tag="DehaBAV1_R0001"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:5131798"
     gene            50199..50321
                     /locus_tag="DehaBAV1_R0002"
                     /db_xref="GeneID:5132014"
     rRNA            50199..50321
                     /locus_tag="DehaBAV1_R0002"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:5132014"
     gene            50498..52972
                     /locus_tag="DehaBAV1_0051"
                     /db_xref="GeneID:5132170"
     CDS             50498..52972
                     /locus_tag="DehaBAV1_0051"
                     /note="PFAM: AAA ATPase, central domain protein; Clp N
                     terminal domain protein; ATPase associated with various
                     cellular activities, AAA_5; ATPase AAA-2 domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_001213521.1"
                     /db_xref="GI:147668703"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="GeneID:5132170"
                     /translation="MSSRFDKFSERARRVLTYAQEEAQSLNHNYIGTEHILLGLVREE
                     EGVAARVLVNMDVNLAKVRSAVEFILGRGEHPATSETGLTSRAKKVIELGIDEARNLG
                     HNYIGTEHLLLGLLREGEGAAAGVLESFGVTVEKVRTEVGRILNQGLNKPKASRTTPS
                     RTPQLDQLGFDLTAAAKAGKLDPVIGRSKEIERVVQILSRRTKNNPALIGEPGVGKTS
                     IVEGLAQRIVSGDVPETLEQKHIISLDVASLVAGTKYRGEFEERLKKVIEEIKNAGNI
                     ILFIDEFHTMVGAGAAEGAVDAANILKPSLARGEVQVIGATTLDDFRKYVERDAALER
                     RFQPVLVEEPAIEDTLSILRGIKERYEEHHKLIISDEAIIAAANMAARYIPDRFLPDK
                     AIDLVDEAASRVRIKKRTKPVSLKEMKAIEDSYRRDKEAALATQQYDYASELRERELQ
                     IAEKIRRMEDEWQTEQAMDKPVVGEEDIAQVVSMWTGVPLVQLTGDETERLLHMEDAL
                     HERIIGQEEAIVTISKAVRRARAGLKDPRHPIGNFVFLGPTGVGKTELARALAQFMFG
                     SEDSLVRLDMSEFMEKFAVSRLVGAPPGYVGYDEGGQLTEAVRRKSYCLILLDEIEKA
                     HPDVFNILLQIFDDGHLTDAKGRRVDFRNTIIIMTSNIGAELIRKGSGTIGFATQTDE
                     SKAQQTNFEHMKDKLLGELKKSFRPEFLNRIDSVVVFHSLNKEQIRSIVDLMLKSVVK
                     QMAEKGIGLEVTESAKDLLGKKGYDEVYGARPLRRTIQTMIEDRLSEDLLRAKFKAGD
                     KVIVDTAEDEIIVRLAEPAELSQATP"
     misc_feature    50510..52942
                     /locus_tag="DehaBAV1_0051"
                     /note="Clp protease ATP binding subunit; Region: clpC;
                     CHL00095"
                     /db_xref="CDD:214361"
     misc_feature    50552..50710
                     /locus_tag="DehaBAV1_0051"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    51050..51529
                     /locus_tag="DehaBAV1_0051"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    51125..51148
                     /locus_tag="DehaBAV1_0051"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(51128..51151,51338..51340,51449..51451)
                     /locus_tag="DehaBAV1_0051"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    51326..51343
                     /locus_tag="DehaBAV1_0051"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    51500..51502
                     /locus_tag="DehaBAV1_0051"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    52034..52480
                     /locus_tag="DehaBAV1_0051"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    52136..52159
                     /locus_tag="DehaBAV1_0051"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(52139..52162,52352..52354,52478..52480)
                     /locus_tag="DehaBAV1_0051"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    52340..52357
                     /locus_tag="DehaBAV1_0051"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    52661..52903
                     /locus_tag="DehaBAV1_0051"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            53418..54812
                     /locus_tag="DehaBAV1_0052"
                     /db_xref="GeneID:5131818"
     CDS             53418..54812
                     /locus_tag="DehaBAV1_0052"
                     /EC_number="2.1.1.63"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_001213522.1"
                     /db_xref="GI:147668704"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004504"
                     /db_xref="GeneID:5131818"
                     /translation="MDKSRNVYICSNCGHESLKWLGRCPGCQEWNTLEETTIAAPLGR
                     KNAPARVISPAAELSSLNASDTTRRSLSISEFNRVLGGGIVPGSLMLLGGEPGIGKST
                     LLLQVAASVAQSGGKVVYVSGEENPAQIKMRAQRLGISGEGLFLMAETDLNAILAQLS
                     VLCPSLVVIDSIQTVFLPELEAAPGAINQVRESALRLMQWAKSSGASVFITAHVTKEG
                     NIAGPRILEHIVDVVMYFEGESQSAYRLIRSVKNRFGSTNEVGIFEMKSEGLVEVANP
                     SQIFLSNRQANTVGSAVTAVLEGSRPLLVEVQALTNTTSFGQPRRTANGVDFNRTIMI
                     AAVLSKRLSMRLGTQDIIVNATGGIRLDEPAADLAIALAIASSYRDIGVCPETIALGE
                     IGLSGELRTIPHLERRLSEASRLGFTRALVPAGANCQNININGIQIIAVSTVKEAIKL
                     ALTGVKTETEDVFE"
     misc_feature    53418..54773
                     /locus_tag="DehaBAV1_0052"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    53439..54509
                     /locus_tag="DehaBAV1_0052"
                     /note="Sms (bacterial radA) DNA repair protein. This
                     protein is not related to archael radA any more than is to
                     other RecA-like NTPases. Sms has a role in recombination
                     and recombinational repair and is responsible for the
                     stabilization or processing of...; Region: Sms; cd01121"
                     /db_xref="CDD:238541"
     misc_feature    53697..53720
                     /locus_tag="DehaBAV1_0052"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238541"
     misc_feature    order(53700..53702,53712..53720,53775..53777,53781..53783,
                     53925..53930)
                     /locus_tag="DehaBAV1_0052"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238541"
     misc_feature    53916..53927
                     /locus_tag="DehaBAV1_0052"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238541"
     misc_feature    <54534..54692
                     /locus_tag="DehaBAV1_0052"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            54799..55482
                     /gene="ispD"
                     /locus_tag="DehaBAV1_0053"
                     /db_xref="GeneID:5131809"
     CDS             54799..55482
                     /gene="ispD"
                     /locus_tag="DehaBAV1_0053"
                     /note="4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
                     MEP cytidylyltransferase; MCT; catalyzes the formation of
                     4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and
                     2-C-methyl-D-erythritol 4-phosphate; involved in
                     isoprenoid and isopentenyl-PP biosynthesis; forms
                     homodimers"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="YP_001213523.1"
                     /db_xref="GI:147668705"
                     /db_xref="InterPro:IPR001228"
                     /db_xref="GeneID:5131809"
                     /translation="MFLNEKVGAVIVAAGQSRRMEGQDKIFALLAGKPVLAHTLSVFQ
                     ESPQVDDIALVMAEHNIEKAKELVKEYNFSKVIAICSGGTLRQDSVRSGLSALCDCGW
                     ILIHDGARPLLEPDSIPEGLEAAKLCGSAIAAVPLKDTIKEISPEGLVEKTLPRERLI
                     SVQTPQVFRADIIQKAYQRVGIIATDDAQLVEKLKLPVRIFSGACANIKITTPEDLLM
                     AEILLKKGR"
     misc_feature    54817..55455
                     /gene="ispD"
                     /locus_tag="DehaBAV1_0053"
                     /note="CDP-ME synthetase is involved in
                     mevalonate-independent isoprenoid production; Region:
                     CDP-ME_synthetase; cd02516"
                     /db_xref="CDD:133009"
     misc_feature    order(54832..54834,54838..54855,54871..54873,55045..55056,
                     55063..55065,55117..55125,55423..55425)
                     /gene="ispD"
                     /locus_tag="DehaBAV1_0053"
                     /note="substrate binding site; other site"
                     /db_xref="CDD:133009"
     misc_feature    order(55126..55128,55183..55185,55207..55209,55213..55215,
                     55267..55284,55351..55356,55360..55365,55372..55374,
                     55387..55398,55408..55413)
                     /gene="ispD"
                     /locus_tag="DehaBAV1_0053"
                     /note="dimer interface; other site"
                     /db_xref="CDD:133009"
     gene            55488..55961
                     /gene="ispF"
                     /locus_tag="DehaBAV1_0054"
                     /db_xref="GeneID:5131815"
     CDS             55488..55961
                     /gene="ispF"
                     /locus_tag="DehaBAV1_0054"
                     /EC_number="4.6.1.12"
                     /note="catalyzes the conversion of
                     4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate
                     into 2-C-methyl-D-erythritol 2,4-cyclodiphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="YP_001213524.1"
                     /db_xref="GI:147668706"
                     /db_xref="InterPro:IPR003526"
                     /db_xref="GeneID:5131815"
                     /translation="MRIGNGYDVHRLAPGQKLVLGGVEIPFECGLIGWSDADVLTHAI
                     MDSLLGAAALGDIGLYFPPGDPKYKGISSLKLLEQVTDLLAKKGFGIINVDSVIVAEE
                     PKLRGHIDTMRKYLAKAMGIDPGRVGIKASTSEQLGFVGRQEGMVAWAVALVDEK"
     misc_feature    55491..55949
                     /gene="ispF"
                     /locus_tag="DehaBAV1_0054"
                     /note="MECDP_synthase
                     (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase),
                     encoded by the ispF gene, catalyzes the formation of
                     2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the
                     non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid
                     biosynthesis; Region: MECDP_synthase; cd00554"
                     /db_xref="CDD:100025"
     misc_feature    order(55491..55496,55500..55502,55506..55508,55512..55520,
                     55530..55532,55635..55637,55641..55646,55650..55655,
                     55764..55766,55770..55772,55776..55778,55797..55799,
                     55803..55805,55869..55871,55875..55880,55887..55895,
                     55932..55934,55938..55940,55944..55946)
                     /gene="ispF"
                     /locus_tag="DehaBAV1_0054"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100025"
     misc_feature    order(55509..55511,55515..55517,55611..55613)
                     /gene="ispF"
                     /locus_tag="DehaBAV1_0054"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:100025"
     misc_feature    order(55653..55655,55659..55661,55785..55790,55794..55805,
                     55878..55886)
                     /gene="ispF"
                     /locus_tag="DehaBAV1_0054"
                     /note="CDP-binding sites; other site"
                     /db_xref="CDD:100025"
     gene            55965..57338
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /db_xref="GeneID:5131829"
     CDS             55965..57338
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /EC_number="6.1.1.16"
                     /note="catalyzes a two-step reaction; charges a cysteine
                     by linking its carboxyl group to the alpha-phosphate of
                     ATP then transfers the aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="YP_001213525.1"
                     /db_xref="GI:147668707"
                     /db_xref="InterPro:IPR002308"
                     /db_xref="GeneID:5131829"
                     /translation="MKIYNTLSGKLEEFVPLENDKVKMYVCGITPQSEPHIGHAMSYI
                     NFDVIRRYLTYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAAL
                     NITPADYYPRATQEVPKIIEIVSGLIDKGYAYAVDGSVYLRVQKVDGYGKLSHRTLEQ
                     MMAGARVEIDEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQ
                     IDIHGGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTI
                     KEALSRYSADALRIFVLSSSYRNPLTYSEEALEAAEKGAERLRQTAARKDNPQFKETT
                     VDTKAYRERFTQYMDNDFNTSAALATIFDLSRELNRIEGEAGKSTDGQKLFKELADIL
                     GLSLIVAESKTGTDVAPFIELLIELRKDLRVAKQYQLADKIRTSLDTAGILLEDSAGG
                     TVWKVKK"
     misc_feature    55965..57332
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="cysteinyl-tRNA synthetase; Validated; Region: cysS;
                     PRK00260"
                     /db_xref="CDD:234705"
     misc_feature    55968..56876
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="catalytic core domain of cysteinyl tRNA synthetase;
                     Region: CysRS_core; cd00672"
                     /db_xref="CDD:173899"
     misc_feature    order(56043..56054,56070..56072,56076..56081,56088..56093,
                     56157..56159,56163..56165,56571..56573,56583..56585,
                     56634..56639,56643..56648,56658..56660,56733..56741)
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="active site"
                     /db_xref="CDD:173899"
     misc_feature    56070..56081
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173899"
     misc_feature    56757..56771
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173899"
     misc_feature    56877..57323
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     misc_feature    order(56880..56882,56892..56894,56901..56903,56910..56912,
                     56922..56924,56931..56933,56937..56942,57039..57041,
                     57060..57062,57069..57071,57078..57080)
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153408"
     misc_feature    order(56910..56912,56919..56924,56937..56942,57078..57080)
                     /gene="cysS"
                     /locus_tag="DehaBAV1_0055"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153408"
     gene            57444..57519
                     /locus_tag="DehaBAV1_R0003"
                     /note="tRNA-Ala1"
                     /db_xref="GeneID:5131810"
     tRNA            57444..57519
                     /locus_tag="DehaBAV1_R0003"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:5131810"
     gene            57557..58555
                     /locus_tag="DehaBAV1_0056"
                     /db_xref="GeneID:5132001"
     CDS             57557..58555
                     /locus_tag="DehaBAV1_0056"
                     /note="PFAM: phage integrase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="YP_001213526.1"
                     /db_xref="GI:147668708"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="GeneID:5132001"
                     /translation="MNDRLTHKNSYDYPIVASDLLTTPDDLRLCLSTYLLMAKVGQLS
                     PATISNYRYMCGKFVDFCQEHGVTKPAQITSIHLGLFLQQLQLTNGPQSVTDYFKQIR
                     PFINWLKDNGQITVDPLKQVRLPKVPRKVIQPFTQEHCQRLLALVSGETFEDKRNKAL
                     ILLLLDTGLRLRECTELKWSDINYDSELVKVMGKGAKERIVRIGPKVQRALLEYQYLK
                     IQSFPGDKTPDVWVSRHKTRYSDKECHPLTKNGIMQTIVVLGKRAGITNIRCSPHTFR
                     HTFATMCLRNGAGEFEVQSLMGHSTLTQTRKYAASLNSEVAVQGHKKFSPVDNLKL"
     misc_feature    57626..58480
                     /locus_tag="DehaBAV1_0056"
                     /note="Site-specific recombinase XerC [DNA replication,
                     recombination, and repair]; Region: XerC; COG4973"
                     /db_xref="CDD:227307"
     misc_feature    57653..58480
                     /locus_tag="DehaBAV1_0056"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(58064..58069,58136..58138,58367..58375,58478..58480)
                     /locus_tag="DehaBAV1_0056"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(58064..58066,58136..58138,58373..58375,58382..58384,
                     58451..58453,58478..58480)
                     /locus_tag="DehaBAV1_0056"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(58064..58066,58373..58375,58382..58384,58451..58453,
                     58478..58480)
                     /locus_tag="DehaBAV1_0056"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(58582..59448)
                     /locus_tag="DehaBAV1_0057"
                     /db_xref="GeneID:5131817"
     CDS             complement(58582..59448)
                     /locus_tag="DehaBAV1_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213527.1"
                     /db_xref="GI:147668709"
                     /db_xref="GeneID:5131817"
                     /translation="MNESNQLEPIPEGEIQISLFKNKEIRRVLHDGEWFFSVVDIIEA
                     ITDSIRPRQYWTDLKSKIIKEGANELYENIVQLKMPASDGKERDTDAADAETVFRIIQ
                     SIPSPKAEPFKRWLAKTAYDRIEEFQNPEIAIKRAILDYQIQGRTDEWIKARIRTLTS
                     RTELTDEWQKRGIAGAEYGILTNVISKETFDIDTTEHKEIKGLAKRHNLRDHMTDMEL
                     ILTMLGETSTAELARSRDAKGFQENEQAAHAGGRIAGDTRRNFEKQLGESVVSKNNFL
                     PKHPDQPKLEEG"
     misc_feature    complement(59095..59379)
                     /locus_tag="DehaBAV1_0057"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     smart01040"
                     /db_xref="CDD:214989"
     gene            complement(59840..60553)
                     /locus_tag="DehaBAV1_0058"
                     /db_xref="GeneID:5131804"
     CDS             complement(59840..60553)
                     /locus_tag="DehaBAV1_0058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213528.1"
                     /db_xref="GI:147668710"
                     /db_xref="GeneID:5131804"
                     /translation="MCVMWDSFVGNQIRRCNRNLLVTIILIALIFIAIASFSYTDPAV
                     TWIILGAGIVILLYPIICYLRQINSFSNHPVMKTLRKYDDLPELLHAIDEEVKSESSI
                     KSSSKLILTPNWAICLTMYGIKIVNLTELVWVYPKKTTHTVNFILPLYSSNSLCICAT
                     PIESRNSNGNMKNSIYPTQIEIDVTKEQCNEYMQSLQSYAPWVLYGYADDIESCWKKQ
                     PLALLQAVLNRKEELSKVE"
     sig_peptide     complement(60431..60553)
                     /locus_tag="DehaBAV1_0058"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.637) with cleavage site probability 0.404 at
                     residue 41"
     gene            complement(60568..60753)
                     /locus_tag="DehaBAV1_0059"
                     /db_xref="GeneID:5131813"
     CDS             complement(60568..60753)
                     /locus_tag="DehaBAV1_0059"
                     /note="PFAM: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001213529.1"
                     /db_xref="GI:147668711"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:5131813"
                     /translation="MIKTLRDHRLDKFWSQAELAKQAGIGADTVNRLENGKQNPSFIT
                     IRKLAKALNVKPEDIEF"
     misc_feature    complement(60577..60747)
                     /locus_tag="DehaBAV1_0059"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60649..60651,60724..60726,60736..60738))
                     /locus_tag="DehaBAV1_0059"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60652..60654,60727..60729))
                     /locus_tag="DehaBAV1_0059"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60646..60651,60661..60663,60670..60672,
                     60703..60708))
                     /locus_tag="DehaBAV1_0059"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            60861..61205
                     /locus_tag="DehaBAV1_0060"
                     /db_xref="GeneID:5131827"
     CDS             60861..61205
                     /locus_tag="DehaBAV1_0060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213530.1"
                     /db_xref="GI:147668712"
                     /db_xref="GeneID:5131827"
                     /translation="MVIRTGKEVVLPYAPEDPVKAEYLPYLLEDIGISQTLMQGFAKS
                     PQEWLAANATKDFIYQFYNYIETGNLSPSTTMSELQNIANMFYTGYEVAQHDVSQIFK
                     IPDTSALKDRNR"
     gene            complement(61286..66757)
                     /locus_tag="DehaBAV1_0061"
                     /db_xref="GeneID:5131833"
     CDS             complement(61286..66757)
                     /locus_tag="DehaBAV1_0061"
                     /note="PFAM: metallophosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_001213531.1"
                     /db_xref="GI:147668713"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:5131833"
                     /translation="MGILGFPSQGSSGKILSYGPPRQPNNQVAINAALQSVDSSDSKK
                     ITTVEMKDGKWTITTDGAVYNIDTNGQTADTVQYITNYLTSRGASADIIKSVTEQIPI
                     ITTRESGNVVKKKTSATITDPNDTTKKYTAEPVNEPANDSTGEGDTQTNTDVSVTVDN
                     STAWTFTTPNGTVYTVPMAGLAWSDPAKMHEYITNSLNSIGAPANVIMEAVSRMPDVM
                     GDTGLREPRTDEFGNLIDNTQEIKDIIAGSDQSLASITALKAFLDAKGFSNLSPEEQF
                     NKAIEYGLIPTDSVYVPPDAGYNVGQNAPPGMPDDVAVSLGLLPSGEQIEYNIPNFNW
                     AYMPKNEADKYFAELKEIVGYDVTSANLKQAIKEAREIITDQILKQSNFEWRLNKGYL
                     IKLPNNEYMETSEFNKLSQSMQAYIKTNGIEAAKARQAWAENVLDKYSSGSGDDKNIN
                     IQSALNSYDKDVYEALQFLFPDVWDGLKRKPEISGATVAELDKIINASWFSESDNQQE
                     IKTLLRRMGYWTGVGGKLSDKWNELSEDDKQKVADNYLKNINDRWLREMGDIQVTFAN
                     AITDIVTAVDGMSQSDKEIANWLVFSPPLNFMKQYLKPEAWEKITDWLKNAGDKVIQS
                     QESFKEWIDKQPDATKIPLSAVRGIYDTLTAIGASIPLALMETATGYDPKNPTPSIKR
                     ILDMGAGLVTWPTTLPYEIAQDPKTGIPYTMGLALSLVIGPKTIIKLGQSLGRKIFIP
                     KGYEIGAIRLDIDLPGGIGPEKMSEVTAHSLQNVLQDMLSKLSDPKNKGAMTDQIITD
                     PVSGATIRVTPLQRAEKALAKDAGNWSYSVDLNYQWLAEQIKKNGKAIADVPNRGDWG
                     AGVYSSDSAWLTRLETAQDKSAGVYKPAIVAIKYNELKKVPKEVQELFEQGKFDEARA
                     LFAEMERAGKIEPGAYEMWKHWVDKNGRLIMEREIYFAKGTEFLPIQPTFWNRTKAVG
                     DLTASNFTWADRDLKRPDVNGKETVVVKKGERVPIIWIAAKGAKRSAPRLAVRQLSSF
                     VYQPYTTLRRMGRVPKGKVSLQLGYGDVQLPELPGIEYKHRNTGYDYLANNEHPSVTS
                     LEIKQIGGKGDWGTTVIGDLHGDYTDLLKDINSGYERPLIRGRDGNITNWKWNGEKQS
                     VVQVGDIVDRGAHYDQIRTTFNRLADEAAQTGGRVERLIGNHELAYLTGEKIHGIDYS
                     NAAAIKKGILEDINAGKLKAAEAINGELYTHAGVSLEKFPEWKGKDAAYIAAEINRRF
                     NKALAQNKWTDRIFDKGSGERGYKGIGGPFWLRTKETSAEALNLGYKQYFGHTPRPSG
                     INEEAPNAINVDIGRQWTESWAGKIGAYQRTPKLETVERGTNLIESLGESPVHGTGFM
                     PVQFSLDIPTIEEGAISQTIKSLSRHDRGQIDWLRPEDIKATMEPPTNLTPNQIGAAN
                     RLIKSVWDQNGMVDMQFKGVIGISKDGMPAYNRQNILWQGEASLLNSNPKNPAYIAMP
                     LVSKSQKLFENQREIDAGLKRLGINANYAEFRPAIILGKFKPKISMKDRMGYMEKVMK
                     NQPRSAVMIRAEKVELLKAKPGKNSKKSNKTNNKIDENYDENRYEGSENSKEYTKLEL
                     GPKPGYKPQDYEDYSKEYPANKLYYPIHESKYASATEESHEPDYTASEQLPTYSSPKY
                     STTGYNPKNYEGKDSPIETIPPPVIPTDDNQITKRQDSKATSKQDRPKLGNGDVAWKQ
                     GELGTGENKRPVWYIQRADGDVDIVFQPPEDAPRLEGTPAETFFTRGKKPPTNLTQKM
                     GVTTAKINLQDNPEIKFIQTKSPKFKQSIPRHIRRSIGM"
     misc_feature    complement(<63041..63448)
                     /locus_tag="DehaBAV1_0061"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    complement(order(63053..63055,63194..63199,63302..63304,
                     63431..63433,63437..63439))
                     /locus_tag="DehaBAV1_0061"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    complement(order(63053..63055,63197..63199,63302..63304,
                     63431..63433,63437..63439))
                     /locus_tag="DehaBAV1_0061"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            complement(67261..68091)
                     /locus_tag="DehaBAV1_0062"
                     /db_xref="GeneID:5131820"
     CDS             complement(67261..68091)
                     /locus_tag="DehaBAV1_0062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213532.1"
                     /db_xref="GI:147668714"
                     /db_xref="GeneID:5131820"
                     /translation="MIWGYIGHEGAGKSAAMCYFDLLHIAKGGGLFTFPGFEVFNPNI
                     TLDDGNHPRLGKSIDMKEFIFSFSDEQKLRNVFVSMDEIQNFFGSDKYMTMYNSLITK
                     YSMQRRKLNFGINYTVQSWNWIDPRLRQLTHFLTVCKDLSRTPWGKEAGLKRGQLIDL
                     VTYDCKGFITGEEWAPLKHFNLNILPVRDWYDSYSTVDPLESFRKLVIKKPEDILDMR
                     EGMPRFNPLDDSPLENVPDDVREISQENNARILSKLEEQVDPATLIQVSKALRKVNAK
                     "
     gene            complement(68088..68522)
                     /locus_tag="DehaBAV1_0063"
                     /db_xref="GeneID:5131824"
     CDS             complement(68088..68522)
                     /locus_tag="DehaBAV1_0063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213533.1"
                     /db_xref="GI:147668715"
                     /db_xref="GeneID:5131824"
                     /translation="MAGFKRKNGGPATGGTTDTLGIQDTIGAAGGNGFKSGLLDFDAL
                     EKLLGNPQTVSLAKEFTSPGDNVRGLLMRADFKDAKQVLAMIEYLHRCKEIHYKRGED
                     RLLDFIAALPAIQARRINLLAKVLTHGVMEASSRQQKERRPE"
     gene            complement(68535..68987)
                     /locus_tag="DehaBAV1_0064"
                     /db_xref="GeneID:5131840"
     CDS             complement(68535..68987)
                     /locus_tag="DehaBAV1_0064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213534.1"
                     /db_xref="GI:147668716"
                     /db_xref="GeneID:5131840"
                     /translation="MTKASTIEKNQELIAGFKTPEEIISSRMQSDQRAKREPDALVYD
                     MRLGWAPEYIDNPIGHRKSFRNKRLCPIIRRWKQLPTGEWESKIEPVPEPEDMEASPQ
                     SLYRMLHWEPLVKSAFGGLGDIWQKLKVGLLVVLVGIGIFALYLFTQS"
     gene            complement(68993..69451)
                     /locus_tag="DehaBAV1_0065"
                     /db_xref="GeneID:5131796"
     CDS             complement(68993..69451)
                     /locus_tag="DehaBAV1_0065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213535.1"
                     /db_xref="GI:147668717"
                     /db_xref="GeneID:5131796"
                     /translation="MKILWMQFGRDKTRTQDVHVLTEDGRIVEVSADVLYGCVSVDEW
                     GQAWVLRGADLCPSRDGKGDILLVNERSLAPIAFDGRPARTHEEALKLKDDIGAEACE
                     SVHFNRDREIKKETMANVLQVLIIGLFGTVCVIALIGVYASGNAKLPWVG"
     gene            complement(69766..70215)
                     /locus_tag="DehaBAV1_0066"
                     /db_xref="GeneID:5131805"
     CDS             complement(69766..70215)
                     /locus_tag="DehaBAV1_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213536.1"
                     /db_xref="GI:147668718"
                     /db_xref="GeneID:5131805"
                     /translation="MGKAMSTVMLIVGIAVSVLFFPMVLSSMDSIQFASNTGTYAAVT
                     TGVGETTADVVLSTALYNDDNGHVTSITSTVGTDVPVAGTYVAATKTLTVTGLTASES
                     RTLTVIYDSDNLSDYTGLGTIVSLSPLIIWLVILGALGIGLYSNVKS"
     sig_peptide     complement(70132..70215)
                     /locus_tag="DehaBAV1_0066"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.935) with cleavage site probability 0.515 at
                     residue 28"
     gene            70367..70630
                     /locus_tag="DehaBAV1_0067"
                     /db_xref="GeneID:5131776"
     CDS             70367..70630
                     /locus_tag="DehaBAV1_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213537.1"
                     /db_xref="GI:147668719"
                     /db_xref="GeneID:5131776"
                     /translation="MEEQKIIVPAKIPGLLEALKNEDAFPDNLRYIMQTHGIGATAIS
                     RIYGISRMQVYRYLKGEDLPREPAIYMSVNEWADYLRKSIKAS"
     misc_feature    70448..>70549
                     /locus_tag="DehaBAV1_0067"
                     /note="Cro/C1-type HTH DNA-binding domain; Region: HTH_26;
                     pfam13443"
                     /db_xref="CDD:257768"
     gene            70591..71598
                     /locus_tag="DehaBAV1_0068"
                     /db_xref="GeneID:5131786"
     CDS             70591..71598
                     /locus_tag="DehaBAV1_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213538.1"
                     /db_xref="GI:147668720"
                     /db_xref="GeneID:5131786"
                     /translation="MGRLFTKIYKGVIVACLCLASLPPAAVLAVDPAAPTTFTIDDVQ
                     VAHNIVETGDSLVSFKYTIAYSSGQPTTPANKLFHFRLMDTDGIIQLGAIEPYAYYNA
                     GYDMGYSAFYFAADDAPEWETALILKMVGNPQYWEIPPEVNYTLTTSDYSQLETKKEN
                     QTLMGSWIIEVCRALEINWVQKLLTETDQGTVFNEYGSAYGKGTIPGLQTMCPKIFST
                     QTQGLDMTRRVWVMTKLDEWAHQWDGTIIGDILEGLASIFNNVTSWQMITSLICIVMV
                     IGLFIWGRVKYANNHGAMIASSYILAGGTDMGLFNGVLLAMIVTIYAAYASYVLMGRH
                     A"
     sig_peptide     70591..70680
                     /locus_tag="DehaBAV1_0068"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.984 at
                     residue 30"
     gene            71595..73340
                     /locus_tag="DehaBAV1_0069"
                     /db_xref="GeneID:5131808"
     CDS             71595..73340
                     /locus_tag="DehaBAV1_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213539.1"
                     /db_xref="GI:147668721"
                     /db_xref="GeneID:5131808"
                     /translation="MKKLIISVGMLILATIIGPGTILASTITDAIYQANIRATNASYT
                     ATHVAAPFTWATDSLLDGYYIDSEFNNLAMRDSIGNDIPFMPGQGSDPWIMWIDQIAQ
                     NSAINYNLYTGGETAMGGKLAYCPDTAGMTVADAASLELGNSFEIELSGRFNDGYNLS
                     KFGAFWIYTSGTDVSAGNSSSYTETPYNGTASSATSMYGANWIAQTFQFSNDVAVNQF
                     TFRTQRVGNPTGNFNYAIYATSGDVPTGSALVSGSVVASTISTSAVNHTFDFSNIINL
                     TAGTRYAIVLSLPNGDSSNKLTHWYNPTNPYANGRYCTTNNSGSSWSGTATTDINISI
                     TGNANNTIVTAADISSSEHVYKISLSAGTMNIYIDGLLEGSAAFAVSITDNANNLVIG
                     ANGSMPYLYYAKITVGGVLRGSWEWQYAATFTDLSGNGNDATPSFRTTTTDADVSVSV
                     ISYTACNQSAFITGEDDEAVEIVTDDDIGEMPDGWYGDLHPENLPGGQAISDFLENMD
                     FPPAFFWYSLVYLGAAIVTMVSLGLTSELLPCAAAGLIWQIFFCAIIGTSWWVLLPEG
                     IIIIGEMVNRKLASY"
     sig_peptide     71595..71669
                     /locus_tag="DehaBAV1_0069"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.997 at
                     residue 25"
     gene            73340..73684
                     /locus_tag="DehaBAV1_0070"
                     /db_xref="GeneID:5131831"
     CDS             73340..73684
                     /locus_tag="DehaBAV1_0070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213540.1"
                     /db_xref="GI:147668722"
                     /db_xref="GeneID:5131831"
                     /translation="MRQQWLVWLAFTYIVGQFMCLILEGTWLGDPEQSFFNALLGFSV
                     MQYSDSVLGNLFVTVVNIVGGVYGLLTYAIPRLLFWDYSFLAGTASLAKWLFFYPVSA
                     GTVWGLYTSLRR"
     gene            complement(74225..74767)
                     /locus_tag="DehaBAV1_0071"
                     /db_xref="GeneID:5131822"
     CDS             complement(74225..74767)
                     /locus_tag="DehaBAV1_0071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213541.1"
                     /db_xref="GI:147668723"
                     /db_xref="GeneID:5131822"
                     /translation="MKTVLTKIKGITPLLMHRFPMAGADDTSKRRTGVPDWKAEAELA
                     LYKDDHGQIYQPASHIEAALKEASKTLKIPGKRGATYSKLIGSAVSVSPDAITHLVQD
                     YEIDSRPVVIQKARIVRYRPVFKDWELEFDINIGDDQIPIEVIKQALDHAGLYVGIGD
                     FRPGRGGKFGKFMVVRFEEK"
     gene            complement(75294..75611)
                     /locus_tag="DehaBAV1_0072"
                     /db_xref="GeneID:5131816"
     CDS             complement(75294..75611)
                     /locus_tag="DehaBAV1_0072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213542.1"
                     /db_xref="GI:147668724"
                     /db_xref="GeneID:5131816"
                     /translation="MKQLKPKCRHKFYQAGSIYYCSRYAIEGTDFCKVHNPESVAAKE
                     KERELANLEHFRQARNELIRQIIITEIFSGITTEEIRKNKAKLKAVFKTVFKTEALLE
                     HFQ"
     misc_feature    complement(75345..>75512)
                     /locus_tag="DehaBAV1_0072"
                     /note="Lipopolysaccharide-assembly; Region: LptE; cl01125"
                     /db_xref="CDD:260798"
     gene            complement(75785..76420)
                     /locus_tag="DehaBAV1_0073"
                     /db_xref="GeneID:5131868"
     CDS             complement(75785..76420)
                     /locus_tag="DehaBAV1_0073"
                     /note="PFAM: Resolvase, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="YP_001213543.1"
                     /db_xref="GI:147668725"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="GeneID:5131868"
                     /translation="MKVALYARVSTRDKNQDPEVQLMELRKYCQENGMEITREYIDHA
                     SANDFVRRTAWKQLLVDASARKFRGLLVWKLDRAFRDITVATSSVKMLRNAGIDFIVT
                     TVPVLSVQGPAGDLMFNIYAAFAQFEKDTIIERVNAGLSRAKAKGKAFGRPRKAIDFN
                     KVLEAHEIACSRVNRITKENQGYSETARILSEQTGLRITAGWVYNRIKAGN"
     misc_feature    complement(75791..76420)
                     /locus_tag="DehaBAV1_0073"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(76004..76414)
                     /locus_tag="DehaBAV1_0073"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(76181..76183,76190..76195,76391..76393,
                     76397..76399))
                     /locus_tag="DehaBAV1_0073"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(76391..76393)
                     /locus_tag="DehaBAV1_0073"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(76037..76039,76049..76054,76058..76063,
                     76196..76198))
                     /locus_tag="DehaBAV1_0073"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(76031..76033,76040..76042,76049..76054,
                     76061..76066,76073..76075,76160..76165,76178..76180))
                     /locus_tag="DehaBAV1_0073"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(76016..76018,76028..76030,76037..76039,
                     76049..76051,76058..76063,76070..76075,76100..76108))
                     /locus_tag="DehaBAV1_0073"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(76016..76018,76028..76030,76037..76039,
                     76049..76051,76058..76060,76106..76108))
                     /locus_tag="DehaBAV1_0073"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(76013..76018,76034..76036))
                     /locus_tag="DehaBAV1_0073"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     gene            complement(76799..79402)
                     /locus_tag="DehaBAV1_0074"
                     /db_xref="GeneID:5131865"
     CDS             complement(76799..79402)
                     /locus_tag="DehaBAV1_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213544.1"
                     /db_xref="GI:147668726"
                     /db_xref="InterPro:IPR002694"
                     /db_xref="GeneID:5131865"
                     /translation="MTIATRKYTIDDILAKLQGVKKNGSGFMACCPAHEDKNPSLSIS
                     EKDGKVLLKCFAGCSYEQIMTALNMPINAAAQDTTATSSKKPKESTKREIKQTYDYTD
                     RSGQLIFQVVRFEPKSFSQRHPGGKTGWVWNMKDIEPVIYHLPDVLEAVKTGQTIWIT
                     EGEKDADNARAMGLVATTSPMGAGKWRDNYTNDLLGASQVVVIADKDAPGRKHASDIA
                     MSCRRQRIPVKIIEVPGDAKDFTEWLEAGGQTSELDDLVATAKSYTPSKNQSLYFLSD
                     GKFSIEAGRIIYHSYRDNVPYDAPLCNFVAAVKEEIIKDNGINRKTFFRIGGTDCTGR
                     PFPDIEVPSENFSSMSWALSQWGIKAMIEPSPSAERLLRGAMQYMSMEAPCRIIYENT
                     GWTNINGKDVYLTPHGAIGADNVEVEMPSNISHYDIPSPEQNDDVKSFIEASFNFLKV
                     AKLYITLPLFAAMYMTPLSDAIDTNFNLWLIAGSGSLKTTIASLALCHYGNFDYTCVP
                     AAWRDTQNTLERILFTCKDMPVLVDDWSPGQTTASQKEFDAKADYVCRGQANRQGRKR
                     MSADTSMRQEYVPRGFLISTSEGQPPGESNNARFLIIEMSKTDIEFPCLTLSQKEDHL
                     YRRAMAHYLAWLQADWPAKKVYLRQRYQEVFEQFTESLRGENVHLRLPRSIALLYIGL
                     EMAIRWAEENGAADIFDRFIDESGNGENDSVGSAYLLKQAREVFIEMAKRQGARIDEA
                     TPSKKFVNALNAALIAGTAYLDVKDGANPRSASPGQTLIGWDDRTNGHVSLHNDLAYQ
                     VANQHYQKINEAFVKKDAVFMDLVKRGYVDPGKDGKTTVFEYIPVIAKACRVLHIKRE
                     FLGRDEQKRGE"
     misc_feature    complement(<79229..79378)
                     /locus_tag="DehaBAV1_0074"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     misc_feature    complement(78719..78940)
                     /locus_tag="DehaBAV1_0074"
                     /note="TOPRIM_primases: The topoisomerase-primase (TORPIM)
                     nucleotidyl transferase/hydrolase domain found in the
                     active site regions of bacterial DnaG-type primases and
                     their homologs. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_primases; cd01029"
                     /db_xref="CDD:173779"
     misc_feature    complement(order(78776..78778,78782..78784,78788..78790,
                     78908..78910,78917..78922))
                     /locus_tag="DehaBAV1_0074"
                     /note="active site"
                     /db_xref="CDD:173779"
     misc_feature    complement(order(78788..78790,78920..78922))
                     /locus_tag="DehaBAV1_0074"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173779"
     misc_feature    complement(order(78860..78862,78890..78895,78911..78916))
                     /locus_tag="DehaBAV1_0074"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173779"
     misc_feature    complement(77801..>78313)
                     /locus_tag="DehaBAV1_0074"
                     /note="Domain of unknown function (DUF927); Region:
                     DUF927; cl12098"
                     /db_xref="CDD:264546"
     gene            complement(79846..80181)
                     /locus_tag="DehaBAV1_0075"
                     /db_xref="GeneID:5131857"
     CDS             complement(79846..80181)
                     /locus_tag="DehaBAV1_0075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213545.1"
                     /db_xref="GI:147668727"
                     /db_xref="GeneID:5131857"
                     /translation="MTSGMVILAEIRTETEQGRPAPTPGWEWSPGCTPIKDPSPGKWI
                     VRRSIDSFDVIFHSYLTPEAREGGPEYLIDSFNPTDAGELGAREMALKLRKESYRQEA
                     ERNGHSDIE"
     gene            complement(80178..80450)
                     /locus_tag="DehaBAV1_0076"
                     /db_xref="GeneID:5131849"
     CDS             complement(80178..80450)
                     /locus_tag="DehaBAV1_0076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213546.1"
                     /db_xref="GI:147668728"
                     /db_xref="GeneID:5131849"
                     /translation="MVLRRLRIMGHSDYGGQENGDGASMKLLAVFKQSHFLLAFGIIF
                     LTAGVGGFGRITEWPELIMCILATLVALYILYAAYKQACKEAEVKK"
     gene            81298..81921
                     /locus_tag="DehaBAV1_0077"
                     /db_xref="GeneID:5131845"
     CDS             81298..81921
                     /locus_tag="DehaBAV1_0077"
                     /note="PFAM: helix-turn-helix domain protein; peptidase
                     S24, S26A and S26B"
                     /codon_start=1
                     /transl_table=11
                     /product="phage repressor like transcriptional regulator"
                     /protein_id="YP_001213547.1"
                     /db_xref="GI:147668729"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR006198"
                     /db_xref="GeneID:5131845"
                     /translation="MDIQIGLKVKQLRIARGMTQAKLADASGLTRGYISMLELRKSTM
                     PSYEALSKIARALGVDIKEFKTDPEIVRLESPEEVLRKYQLMAPVSIPVYDHFYVHAG
                     DAALAPIEYIYRARESFAPQNIEAYKVRGNCMEPVISEGDILLIDRDRTPQKGNILLC
                     VVDGEVIVGKLIEQNGVLYLKNGHGTHSLSDCQASAVVVEVNKKLIF"
     misc_feature    81307..>81552
                     /locus_tag="DehaBAV1_0077"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    81313..81489
                     /locus_tag="DehaBAV1_0077"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(81325..81327,81337..81339,81415..81417)
                     /locus_tag="DehaBAV1_0077"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(81334..81336,81409..81411)
                     /locus_tag="DehaBAV1_0077"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(81355..81360,81391..81393,81400..81402,81415..81420)
                     /locus_tag="DehaBAV1_0077"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    81673..>81840
                     /locus_tag="DehaBAV1_0077"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    order(81694..81696,81802..81804)
                     /locus_tag="DehaBAV1_0077"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            82056..83015
                     /locus_tag="DehaBAV1_0078"
                     /db_xref="GeneID:5131832"
     CDS             82056..83015
                     /locus_tag="DehaBAV1_0078"
                     /note="PFAM: phage integrase family protein; phage
                     integrase domain protein SAM domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="YP_001213548.1"
                     /db_xref="GI:147668730"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="GeneID:5131832"
                     /translation="MLSYHLTTSGSHEQPQAKTYHLTNFKNLSGRLNAFVLTCKVARL
                     SPHTIRYYTYALNSFLGYCQTLGINTVEEIEANHVRLYLVKLQERNNPTSVLDYYKAV
                     KRFFNWLIEEGVLSKSPLATIKPPRTEQKIIRPFTRQQIEDLLATCGDSPIGLRNKAM
                     ILTMLDTGLRVSEMSAIQLKDVDFDKETIIVMGKGAKQRVVRIGHKAQETILRYLLTR
                     QDECPALWMSTTGSGLSTEGIKVVVRELGKRAGLTGVRCSPHTFRHTFATQALINGAG
                     EFEVQSLLGHSTLVMTKRYTASLKSEHAVQEHKKFSPVDNMRL"
     misc_feature    82131..82994
                     /locus_tag="DehaBAV1_0078"
                     /note="Site-specific recombinase XerD [DNA replication,
                     recombination, and repair]; Region: XerD; COG4974"
                     /db_xref="CDD:227308"
     misc_feature    82182..82943
                     /locus_tag="DehaBAV1_0078"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(82563..82568,82635..82637,82827..82835,82938..82940)
                     /locus_tag="DehaBAV1_0078"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(82563..82565,82635..82637,82833..82835,82842..82844,
                     82911..82913,82938..82940)
                     /locus_tag="DehaBAV1_0078"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(82563..82565,82833..82835,82842..82844,82911..82913,
                     82938..82940)
                     /locus_tag="DehaBAV1_0078"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(83602..84609)
                     /locus_tag="DehaBAV1_0079"
                     /db_xref="GeneID:5131142"
     CDS             complement(83602..84609)
                     /locus_tag="DehaBAV1_0079"
                     /note="TIGRFAM: DNA-cytosine methyltransferase;
                     PFAM: C-5 cytosine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-cytosine methyltransferase"
                     /protein_id="YP_001213549.1"
                     /db_xref="GI:147668731"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="GeneID:5131142"
                     /translation="MQIISLFSGAGGLDLGFEKAGFNVVWANEYDKTIWDTYQHNFPN
                     TNLDTRSITEIPSTEIPTSDGIIGGPPCQSWSEAGALRGINDHRGQLFFEYIRILKDK
                     QPSFFLAENVSGILFERHREAFSEIIKQFNEIGYNVSYYLLNAHDYSVPQDRKRVIIV
                     GYHVKTELYFTPPKPIAHKPLLRDAIWDLRETAKPGGKTNKSIGNLEFPNHEYMVGGF
                     STIFMSRNRVRSWEEPSFTIQAGGRHAPIHPQAPKMQLVSKDKMEFKPGDQHLYRRLS
                     IRECARIQTFPDNFVFKYAGLADGYKMVGNAVPVEFAYNIAMKISEDLRSYEKRTDTK
                     R"
     misc_feature    complement(83644..84609)
                     /locus_tag="DehaBAV1_0079"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(84397..84399,84403..84405,84460..84471,
                     84517..84528,84574..84591))
                     /locus_tag="DehaBAV1_0079"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(83692..83694,83890..83895,83899..83904,
                     83923..83925,83929..83931,84142..84144,84148..84150,
                     84271..84276,84280..84282,84346..84348,84364..84366,
                     84373..84384,84391..84396,84403..84405))
                     /locus_tag="DehaBAV1_0079"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(83692..83694,84142..84144,84148..84150,
                     84274..84276,84280..84282,84382..84384,84394..84396,
                     84403..84405))
                     /locus_tag="DehaBAV1_0079"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            complement(84613..85461)
                     /locus_tag="DehaBAV1_0080"
                     /db_xref="GeneID:5131146"
     CDS             complement(84613..85461)
                     /locus_tag="DehaBAV1_0080"
                     /EC_number="3.1.21.4"
                     /codon_start=1
                     /transl_table=11
                     /product="type II site-specific deoxyribonuclease"
                     /protein_id="YP_001213550.1"
                     /db_xref="GI:147668732"
                     /db_xref="REBASE:DspBAVPRF79P"
                     /db_xref="GeneID:5131146"
                     /translation="MATNILTAIAHLVENPNTQLHQHNKSKTRANAMGDSLEEYIKDL
                     FANSLNENDVVKKNEIYNQKFCYFGNQNNPPDFIIKNGDAVEVKKIETMESSLALNSS
                     YPKDKLYSTSNMITDACRTCEPWSIKDLLYAIGTVKDGNLKALWMVYGDCYAADRSVY
                     ERIQTVISDGVNGIEDIQFSPSKELGRVNKVDPLGITYMRIRGMWGIENPNKVFNYIV
                     NIDKNARISVNSIMLKSKYDSFSTLDKAKIASLANKGLGIKDIRIKSPNNPANLLDAK
                     LISFRM"
     misc_feature    complement(84667..85455)
                     /locus_tag="DehaBAV1_0080"
                     /note="NgoPII restriction endonuclease; Region: RE_NgoPII;
                     pfam09521"
                     /db_xref="CDD:255409"
     gene            complement(85567..85848)
                     /locus_tag="DehaBAV1_0081"
                     /pseudo
                     /db_xref="GeneID:5131147"
     gene            85925..86209
                     /locus_tag="DehaBAV1_0082"
                     /db_xref="GeneID:5132050"
     CDS             85925..86209
                     /locus_tag="DehaBAV1_0082"
                     /note="PFAM: transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001213551.1"
                     /db_xref="GI:147668733"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:5132050"
                     /translation="MEENRRKHSPSFKAKVALEAIKGEETIAQLASRFDVHPSQVHKW
                     KKELAEGAVGIFGDERKHQKPDNQQLVSQLYQQIGQLKVERDFLENALGR"
     misc_feature    85925..>86200
                     /locus_tag="DehaBAV1_0082"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    85937..86134
                     /locus_tag="DehaBAV1_0082"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            86347..87135
                     /locus_tag="DehaBAV1_0083"
                     /db_xref="GeneID:5131177"
     CDS             86347..87135
                     /locus_tag="DehaBAV1_0083"
                     /note="PFAM: Integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001213552.1"
                     /db_xref="GI:147668734"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:5131177"
                     /translation="MKLIDRQYLATPFYGARKIALELKKQAGLTVNRKRVRRLMQLMG
                     IRAIYRRPRTSTPATGHKVYPYLLRELEITRPNQVWAADITYIPMSRGFLYLVAIIDW
                     YSRYVISWRLSNTLDADFCVAALEEALSKGTPEIFNTDQGSQFTSEAFTALLKEHNVG
                     ISMDGKGSYNDNLFIERLWRTVKYEEVYLKAYQDGREARISLCKYFRFYNTNRIHQSL
                     GYLTPVEVYAGAMDKTCNDVVKSSITKPAGMAELSLNKVPILSY"
     misc_feature    86347..86505
                     /locus_tag="DehaBAV1_0083"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    86566..86901
                     /locus_tag="DehaBAV1_0083"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    86575..86994
                     /locus_tag="DehaBAV1_0083"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     misc_feature    86815..87015
                     /locus_tag="DehaBAV1_0083"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(87298..88449)
                     /locus_tag="DehaBAV1_0084"
                     /db_xref="GeneID:5131769"
     CDS             complement(87298..88449)
                     /locus_tag="DehaBAV1_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213553.1"
                     /db_xref="GI:147668735"
                     /db_xref="GeneID:5131769"
                     /translation="MYTVINSGIDSLVIGFNVSAYRDPESLKLLEQAKEEAGEKLFGG
                     NGTGIDWHGKPFVVHARGAKGYEWVLENADVSICIARKPENGRIYPELYVTFRAEYLW
                     SSNARNVVYDLKHWLSTWAIITGDKVSRCDLCIDLQMDMPQINLANDVVTRARGKTEY
                     YGSLPAEHYVNGKRDTGYRFGQGTIISRIYDKSLEVVISQKEWFQTLWSANGWDGESA
                     ITRVEFQCRRDFLKEMGVDDFWSLTERIGDIWRYCAQDWLTIRTPGNDSHRHRWQMTN
                     WWNVIAESFYFFGELYGVLRYKQKKCKYDHLMRQARGVLLTAAALCCVSTGTIHAFTQ
                     VNQETAQWFKSDEFRIEVQNRMVQVGGMNEEKLPRLVEEAINLGGQLLR"
     misc_feature    complement(87571..88071)
                     /locus_tag="DehaBAV1_0084"
                     /note="Replication initiation factor; Region: Rep_trans;
                     pfam02486"
                     /db_xref="CDD:251326"
     gene            complement(89033..89578)
                     /locus_tag="DehaBAV1_0085"
                     /db_xref="GeneID:5131782"
     CDS             complement(89033..89578)
                     /locus_tag="DehaBAV1_0085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213554.1"
                     /db_xref="GI:147668736"
                     /db_xref="GeneID:5131782"
                     /translation="METDRLIEGVVKIRGYMRCGKTASMVALAVNEIQQGHYSPDKVI
                     SNVSIPSYGIVQKRNTEIIDFLARMKEDQLRGWLILIDEADQLFSHRGYSSKQQSQVL
                     VNVWQAMKLDNMIIYTMHEGLGVDLIFRDATLMSLLPEIVGNKIVIYTIDGRYGGEPY
                     LLEIAPASEVFKLYNTKEAVY"
     misc_feature    complement(<89294..>89536)
                     /locus_tag="DehaBAV1_0085"
                     /note="ATPases of the AAA+ class [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     SpoVK; COG0464"
                     /db_xref="CDD:223540"
     gene            complement(89582..89908)
                     /locus_tag="DehaBAV1_0086"
                     /db_xref="GeneID:5131109"
     CDS             complement(89582..89908)
                     /locus_tag="DehaBAV1_0086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213555.1"
                     /db_xref="GI:147668737"
                     /db_xref="GeneID:5131109"
                     /translation="MSYLEDQEKIEIHPSQLGNKNVSSQMLEYSSTNRNCPVALARTL
                     LLCHMTSEVLGISCFHQIADQCERYAHTADTLVRDQAATVAKYEAVALEEKRKQGFMQ
                     FGIGKV"
     gene            complement(89909..90487)
                     /locus_tag="DehaBAV1_0087"
                     /db_xref="GeneID:5131108"
     CDS             complement(89909..90487)
                     /locus_tag="DehaBAV1_0087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213556.1"
                     /db_xref="GI:147668738"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="GeneID:5131108"
                     /translation="MRDLEIFRPSNRCYVMVNYMDRRILEKGLVTDVTDKGVHFEYKK
                     NGVNHVYHEHADGYHIPQIWNRPLFAHVYGSAVDYDLVTGQAMFDGNMFNQAVNGKIT
                     SDALKEVKGLNKKSSVNLVTILLVVAIAIGGMFVFQNKDKIFTTGNSEPVPEQTIPNN
                     PVYPENPVDNPSDGTEIPEGDYIPTNPPSGGS"
     gene            complement(91006..92598)
                     /locus_tag="DehaBAV1_0088"
                     /db_xref="GeneID:5131107"
     CDS             complement(91006..92598)
                     /locus_tag="DehaBAV1_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213557.1"
                     /db_xref="GI:147668739"
                     /db_xref="GeneID:5131107"
                     /translation="MYKTKHLKRIIGVISSLAVMLVTLLPGTVSATETLQTKMFTAGS
                     AYEYYADNLNLTWSDLAVSGDPFQTSIANSIMLADHGGTFNNGYTCATATSIADAQNL
                     SQNGDYQQIYANYKRGQSFTALGTGGCQYVTLKIARVGNPGDLQVILYAYGSPTSLGA
                     VLGSITTPQAQIGTTTADYQLPLGNPSITQGQKYVIMAYCPTGNTSNYYKVFDSNSNP
                     YSGGTLISDDGSQVWESNPYDYYFKITRTSGLMALDDYYRNVMYFNLDGLLDTSKIRS
                     IEIVLHQSGTIYHKTKAVLVWNPANLESQTDGRWFMANAYSSTDYNPLGQTDADKGAN
                     GIHTWDIVPTEWDLANQTQWLNSYLDDDNNLRVGMILENAMIGYPSYDSYGNVLWSSG
                     DAYIDEWLSPGCSDIPVGSETVKVEPYIIVNYVNGAFFVPPPETTDISDIIQIIPNFI
                     NNIGEQDSGVRWLIMLAAVAAAIALCWRVQIMAIVTPLLVVGAFIAMGWIDIWLVLLL
                     AALGAFIIWQTAGGKRLVGGDG"
     sig_peptide     complement(92503..92598)
                     /locus_tag="DehaBAV1_0088"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.994 at
                     residue 32"
     gene            complement(92675..93010)
                     /locus_tag="DehaBAV1_0089"
                     /db_xref="GeneID:5131787"
     CDS             complement(92675..93010)
                     /locus_tag="DehaBAV1_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213558.1"
                     /db_xref="GI:147668740"
                     /db_xref="GeneID:5131787"
                     /translation="MVKLLKRIKHAMSIEQMVNGIPLKKQAAQWLDNLVTCQTGSMNI
                     GGLVMLFMAALMLMALTPSLVDANAVIQTDTGSGDMVKMIMNLLVWAIPLGGGVGIIM
                     AAINLFKND"
     gene            complement(93066..93458)
                     /locus_tag="DehaBAV1_0090"
                     /db_xref="GeneID:5131768"
     CDS             complement(93066..93458)
                     /locus_tag="DehaBAV1_0090"
                     /note="PFAM: single-strand binding protein/Primosomal
                     replication protein n"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein/primosomal
                     replication protein n"
                     /protein_id="YP_001213559.1"
                     /db_xref="GI:147668741"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR010913"
                     /db_xref="GeneID:5131768"
                     /translation="MDQKYERKSYCEMKIHRARVTKEPVMTYTPTGKAVTRFSVSYGG
                     YWDKEKKEETVASTWKNIKCWGTLAENTYRELKKGQFVYLEGIEDTSEYKGKKYDSLT
                     AEDVQIELETGERQLLAESNNKEKAGKH"
     misc_feature    complement(93135..93404)
                     /locus_tag="DehaBAV1_0090"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(93153..93155,93159..93161,93183..93188,
                     93192..93194,93198..93200,93222..93227,93264..93266,
                     93270..93272,93276..93278,93282..93284,93288..93293,
                     93324..93329,93348..93350,93378..93380,93396..93404))
                     /locus_tag="DehaBAV1_0090"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    complement(<93201..93404)
                     /locus_tag="DehaBAV1_0090"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    complement(order(93162..93164,93189..93191,93216..93218,
                     93279..93281,93285..93287,93327..93335))
                     /locus_tag="DehaBAV1_0090"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(93138..93140,93204..93206,93210..93212,
                     93216..93218))
                     /locus_tag="DehaBAV1_0090"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            complement(93499..93825)
                     /locus_tag="DehaBAV1_0091"
                     /db_xref="GeneID:5131779"
     CDS             complement(93499..93825)
                     /locus_tag="DehaBAV1_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213560.1"
                     /db_xref="GI:147668742"
                     /db_xref="GeneID:5131779"
                     /translation="MAVYIVVFETVFGYIIGNSVVFITFGCEMKQKLTNKEIGRLGGL
                     KTVALYGREHMKELGKLGGRPRLPTLQEIRDRKAKASNINNNKGVATGGYSLKELKLM
                     WASRTA"
     gene            93922..94554
                     /locus_tag="DehaBAV1_0092"
                     /db_xref="GeneID:5131181"
     CDS             93922..94554
                     /locus_tag="DehaBAV1_0092"
                     /note="PFAM: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001213561.1"
                     /db_xref="GI:147668743"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:5131181"
                     /translation="MSNLGLIIKELRERRGWPQTELADRAGISRSSLATIEIGRSVPK
                     VETSIKIAKVFGMTVEELYSKAGYETGKTVVETTEDILERLRLASPIAVPVYTDFVIH
                     AGDNVEAPIEYIYLARPKAVGKNIEAYLIKGQCMEPDIQDGDIAIVDRDIAPEKGNII
                     LCLINSEIVIGRYLLDKEGKPYIQNGHGKHTLKECQATAVVTGISRNMRH"
     misc_feature    93931..>94176
                     /locus_tag="DehaBAV1_0092"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    93934..94107
                     /locus_tag="DehaBAV1_0092"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(93946..93948,93958..93960,94033..94035)
                     /locus_tag="DehaBAV1_0092"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(93955..93957,94030..94032)
                     /locus_tag="DehaBAV1_0092"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(93976..93981,94012..94014,94021..94023,94033..94038)
                     /locus_tag="DehaBAV1_0092"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    94312..>94473
                     /locus_tag="DehaBAV1_0092"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    order(94324..94326,94432..94434)
                     /locus_tag="DehaBAV1_0092"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            94704..95195
                     /locus_tag="DehaBAV1_0093"
                     /db_xref="GeneID:5131111"
     CDS             94704..95195
                     /locus_tag="DehaBAV1_0093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213562.1"
                     /db_xref="GI:147668744"
                     /db_xref="GeneID:5131111"
                     /translation="MSMRRLPGNIQRILTKDEEVLDQFNLKGSLGSPRQKVYCTNKRI
                     IVSEHGAVLFGSHLFDADYNHISSIDLKTQPRIALLFIATLLILFSIPFWRNILGYTD
                     GSYMILATMFTASGFIFVLIAFIFRTYRLEIFTTGRNKPIAIKSSRIDLEQILMFTRE
                     RRL"
     gene            95226..96302
                     /locus_tag="DehaBAV1_0094"
                     /db_xref="GeneID:5131123"
     CDS             95226..96302
                     /locus_tag="DehaBAV1_0094"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213563.1"
                     /db_xref="GI:147668745"
                     /db_xref="GeneID:5131123"
                     /translation="MKGLPLNVKDSLTKANESALAAVSLYNHPGIPFRSGGYIVLMII
                     AWTSLFHAIFFKDNKKPFYMDTKKSHGKYIRYQKIDGENKAWELTTCLKEYYGNENPS
                     ERDNLRFFLGLRNKIEHRSMPEIDEQIFGECQAMLFNYESTVAKNFGYKYAINESLSM
                     SLQFSAAYNSQKKEALRKLHSKTYKNIIDYMNDFRSSLSSNSLESMDYSYKVFLIPKT
                     ANHSNTADFVSEFINPNKLTNEARAKLKEVLILFKDRNSGDINQNNYRASFIKENVQR
                     KLGQKFSMKDFVTCYKHFKIRPNYGAEIKEPIISKYCAYDLAHGDYVYKPALVEFLVS
                     ELSDEKKYENILGRKPIPISSNIL"
     misc_feature    95340..95579
                     /locus_tag="DehaBAV1_0094"
                     /note="Protein of unknown function (DUF3644); Region:
                     DUF3644; pfam12358"
                     /db_xref="CDD:257004"
     gene            96364..97416
                     /locus_tag="DehaBAV1_0095"
                     /db_xref="GeneID:5131611"
     CDS             96364..97416
                     /locus_tag="DehaBAV1_0095"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213564.1"
                     /db_xref="GI:147668746"
                     /db_xref="GeneID:5131611"
                     /translation="MKLNKELETENIQSAKEWLEQANQDFSVFQKLVHLHFEFDTNIK
                     CNYPANAVSLLQQTIEKSIKAVAAATGEYNEEETIKTYGHNSAALILDILSKMIIQAD
                     FLDLNAIARLNNIDISVKLPELITLKNQVKKGILVSKDNKKVDIRSEVINLSDSQINS
                     VLMMLITIRNYILKIVDVTFESLKKLGINNYKIRIKDQELFLKALSDLIYKEFNQNPL
                     SDKQIKILLDSLSVIEITNSSDNTAKHKNFEIIRKREFTHLFLGVWAIISLVLLGYIT
                     FGHESSSRYPSQKSKGIKTSEVGCNDYNENMGIVRRLSQIGYLTDLLLKELSGYIDTV
                     ALLFAMEKDNFSNKRS"
     gene            complement(97959..98744)
                     /locus_tag="DehaBAV1_0096"
                     /db_xref="GeneID:5131652"
     CDS             complement(97959..98744)
                     /locus_tag="DehaBAV1_0096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213565.1"
                     /db_xref="GI:147668747"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:5131652"
                     /translation="MTARQPGNIHPRTIPSQYLLSGLAFCGCGASLTGHSAKSGRHFY
                     YQCNRKFKQGNEVCNGQAIPKSKLESAVITQIKSRILTEENLENLVSLVNKDLELASV
                     QYNERLAVIDTELEDIRQRLNRLYEAIESGKLDYSDLSPRIKDLRSRQSDLEKSRIVA
                     EAELLASGSESIKIEQVKAYAGDLKQLLAEAEISECKAFLKTFVKKIEINGNKATLKY
                     RLPLPGLKNGKEVLPIETLGGAEGIRTLYLLTASYGSSKQPMH"
     sig_peptide     complement(98634..98744)
                     /locus_tag="DehaBAV1_0096"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.601) with cleavage site probability 0.502 at
                     residue 37"
     misc_feature    complement(98514..98690)
                     /locus_tag="DehaBAV1_0096"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     gene            complement(98940..99575)
                     /locus_tag="DehaBAV1_0097"
                     /db_xref="GeneID:5131633"
     CDS             complement(98940..99575)
                     /locus_tag="DehaBAV1_0097"
                     /note="PFAM: Resolvase, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="YP_001213566.1"
                     /db_xref="GI:147668748"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="GeneID:5131633"
                     /translation="MKVALYARVSSEAQDVELSIAAQLRALRDYAAKNEQQIVYEFID
                     EAESGRTASRPEFKKMIALAKSNTSPFEAILVWKYSRFARNRVDSITYKTLLQKKGIK
                     VISINEPLDDTPTGKLMEGIIESLDEFYSANLGQDIKRGMKENALRGFFNGSQPPLGY
                     RIIKVKDGPKQRNRLEPESDTSSGIKTVRHIFSLADKGQGCKEIAVTLNRE"
     misc_feature    complement(<99054..99575)
                     /locus_tag="DehaBAV1_0097"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(99153..99563)
                     /locus_tag="DehaBAV1_0097"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    complement(order(99324..99326,99333..99338,99546..99548,
                     99552..99554))
                     /locus_tag="DehaBAV1_0097"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    complement(99546..99548)
                     /locus_tag="DehaBAV1_0097"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     gene            complement(99572..100531)
                     /locus_tag="DehaBAV1_0098"
                     /db_xref="GeneID:5132380"
     CDS             complement(99572..100531)
                     /locus_tag="DehaBAV1_0098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213567.1"
                     /db_xref="GI:147668749"
                     /db_xref="GeneID:5132380"
                     /translation="MPRKKAPSIKETREWLDLYESGWSEALLAQRKGRDIRTIRRYLA
                     KAQDERRLDLVESELIKSALAKHQEQLLLTLDNLYSAIALPEPYLSLNSTGNNGRIEL
                     NSGRVVVTQVAESTGVAVHLESEDSVLFSLVEEHLDHDLLFLMLNEWKSKLENYVRAC
                     SYIKESRTERLSRRGADERSYNIKEKSADEQICKSICMSDLSEFIYKNSLNYIIKNDK
                     SVLTKARERLAINKERGELILKPGNTLLSCPGKEAEYLQKTLELLTEESLQEHKGPIQ
                     QAYRKLEDETSKLKKVIEEIKLCNFIPGECRVCRRLKGQGGLR"
     gene            100651..100776
                     /locus_tag="DehaBAV1_0099"
                     /db_xref="GeneID:5131641"
     CDS             100651..100776
                     /locus_tag="DehaBAV1_0099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213568.1"
                     /db_xref="GI:147668750"
                     /db_xref="GeneID:5131641"
                     /translation="MGRKKIAKTTTIDPQVKQRLEILSRIITRQYLIDKAKKRAR"
     gene            complement(100821..101420)
                     /locus_tag="DehaBAV1_0100"
                     /db_xref="GeneID:5131650"
     CDS             complement(100821..101420)
                     /locus_tag="DehaBAV1_0100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213569.1"
                     /db_xref="GI:147668751"
                     /db_xref="GeneID:5131650"
                     /translation="MEDILVIKFIRSVATGLLIIMAGLALLNWVNSSESDNPISSTVA
                     YIPTKSSILQSPLALDSLKTSAHYADGYVFLDFYDPYRLSNYLNKYDYSETHQPYAEG
                     ERYGMYFSDVFYLVPGDNLKIVIYSDVPLGTDLACEISEYKNNGVSGSTPAYTVERYE
                     NGYRAIISCHATESGEYQFKLWHRDKSQSERCAIVFYFE"
     gene            101503..101718
                     /locus_tag="DehaBAV1_0101"
                     /db_xref="GeneID:5131697"
     CDS             101503..101718
                     /locus_tag="DehaBAV1_0101"
                     /note="PFAM: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001213570.1"
                     /db_xref="GI:147668752"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:5131697"
                     /translation="MTKKTIEQRFGERIRVLRKKAEISQEELAFRAGVHRTYLGGIER
                     GERNPSLKNIEAIAKALEVPISDLFIN"
     misc_feature    101533..101706
                     /locus_tag="DehaBAV1_0101"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(101545..101547,101557..101559,101632..101634)
                     /locus_tag="DehaBAV1_0101"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(101554..101556,101629..101631)
                     /locus_tag="DehaBAV1_0101"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(101575..101580,101611..101613,101620..101622,
                     101632..101637)
                     /locus_tag="DehaBAV1_0101"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(102397..103161)
                     /locus_tag="DehaBAV1_0102"
                     /db_xref="GeneID:5131684"
     CDS             complement(102397..103161)
                     /locus_tag="DehaBAV1_0102"
                     /note="PFAM: protein of unknown function DUF105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213571.1"
                     /db_xref="GI:147668753"
                     /db_xref="InterPro:IPR002808"
                     /db_xref="GeneID:5131684"
                     /translation="MLQELKTDTYKELGCFHGVRAGIAYHKALGVSTNTLVIELPEER
                     NILSTRTGLGKAKYILNTHIPPELWDFMHDNSADWQTAYSVVLEEVLKRYDTDLDNVS
                     FLSTGVDQDNIAWAEETYEEFWVLAFATAGVKTNAMRIGCDEASGIERNGKFEKIGTI
                     NVILLTGSSLETPTLASSYITLTEAKNVALQELDIRSAAHPDWQATGTGTDQIITVSG
                     TGGKYTYVGGHTKLGEMMARATTRAVKQAIRNCRGY"
     misc_feature    complement(102430..103053)
                     /locus_tag="DehaBAV1_0102"
                     /note="Adenosylcobinamide amidohydrolase; Region: CbiZ;
                     pfam01955"
                     /db_xref="CDD:250991"
     gene            complement(103248..103544)
                     /locus_tag="DehaBAV1_0103"
                     /db_xref="GeneID:5131564"
     CDS             complement(103248..103544)
                     /locus_tag="DehaBAV1_0103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213572.1"
                     /db_xref="GI:147668754"
                     /db_xref="GeneID:5131564"
                     /translation="MWSLYTMIWMLIGIALGVGFTALVNMLNKRGISVRFYEWLIGIT
                     GLVLFLFTIQNFYTAFQEFYTKAAWMFLLVTGIPAVILLAISWQLVSRRVSNKA"
     sig_peptide     complement(103470..103544)
                     /locus_tag="DehaBAV1_0103"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.603) with cleavage site probability 0.540 at
                     residue 25"
     gene            complement(103582..105129)
                     /locus_tag="DehaBAV1_0104"
                     /db_xref="GeneID:5131704"
     CDS             complement(103582..105129)
                     /locus_tag="DehaBAV1_0104"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213573.1"
                     /db_xref="GI:147668755"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5131704"
                     /translation="MSAFHSTLSRRDFMKAVGLAGAGIGAASAASPVFHDLDEASQIG
                     GVAEKRPWYVRELEYAKPTVEIDWNMIQRQTHYNNWEDHLDQTEKDNRAHMYYDNTKK
                     MVLENNPGNTMFDVAIRHPAWTAVRRNMDYFFGVEGIMKDTPPGFEMGFDPESGHCMM
                     SPVWATDLFGIITPGNMGVPRWEGTPEQNAALIRMAARWCGGAEVGYLKADEYTKKLV
                     HKTCGILPILADKNGREVVWENVDQPYETDKKLVIPEKCDNIIVVTIREERNPALMAP
                     SYRADATTAKSYARSIAFDIHFRGFLHAIGYTSAGSGWGPWNNVPFGVLSGIGELGRM
                     RGQITPSCGPLIRKVEVFFTDLPLPPTNPIDFGANRFCRDCGLCAKACPASAIPTFRE
                     PTYDITPADDANSNPTKLHPEYFNLSGKKVWPNNDFACHNFWVTSGKHGCAACVASCV
                     FSKDIKSSIHEVVKGVVSQTGMFNGFFANMDHAFGYGIVSDQDMWNNFWFEPDKYWPL
                     EGIDTNL"
     sig_peptide     complement(105040..105129)
                     /locus_tag="DehaBAV1_0104"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.996) with cleavage site probability 0.927 at
                     residue 30"
     misc_feature    complement(104056..104985)
                     /locus_tag="DehaBAV1_0104"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(103669..104589)
                     /locus_tag="DehaBAV1_0104"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(103774..104019)
                     /locus_tag="DehaBAV1_0104"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            complement(105240..106106)
                     /locus_tag="DehaBAV1_0105"
                     /db_xref="GeneID:5131584"
     CDS             complement(105240..106106)
                     /locus_tag="DehaBAV1_0105"
                     /note="TIGRFAM: putative ATP binding protein;
                     PFAM: protein of unknown function DUF71, ATP-binding
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP binding protein"
                     /protein_id="YP_001213574.1"
                     /db_xref="GI:147668756"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="GeneID:5131584"
                     /translation="MNNFDLSPSRTGILEDNTRFYGNSEASLSLKSPITEYSLSPNAN
                     NLTNLPWQPGAVNQRVLVSWSGGKDCCLSCYLAMLAGLDIRCLLSVIDHTGRLGAHSL
                     APQILHAQAEAIGIPLVTRQVRVSEYDADYCRVVKELKEQEGISGGVFGDVNIGNSEA
                     ELHETWVKRIGNSAGIQAHLPLWNINRENILRMLISYGFEVLMIVTDNSELGKEWLGR
                     RIDMETLAELKSRYESSENGRVGYYHTLVVDGPIFQKKLQIEKTSRIFKEDEWGANWY
                     LDIEKCSLSSKH"
     misc_feature    complement(105246..105932)
                     /locus_tag="DehaBAV1_0105"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases, ATP sulphurylases Universal
                     Stress Response protein and electron transfer flavoprotein
                     (ETF). The domain forms a apha/beta/apha fold which  binds
                     to Adenosine nucleotide; Region: AANH_like; cl00292"
                     /db_xref="CDD:260331"
     misc_feature    complement(order(105837..105839,105843..105845,
                     105897..105908,105915..105920))
                     /locus_tag="DehaBAV1_0105"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     gene            complement(106418..107101)
                     /locus_tag="DehaBAV1_0106"
                     /db_xref="GeneID:5131710"
     CDS             complement(106418..107101)
                     /locus_tag="DehaBAV1_0106"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001213575.1"
                     /db_xref="GI:147668757"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5131710"
                     /translation="MKIVIIEDEEEIVKILKLTFQIRWPSAEILAANYGSKGIQIVEK
                     ESPDLVILDLGLPDMDGFDVLDQIRAFSSEVPVLILTVTNDEHCIVRALESGADEYII
                     KPFHQLELLSRVKVLLRRRLMDSEEVAINVGPFRLSKYSNTLMVDNRRLILTNTEKII
                     MSHLLSNAGNLVPATLLAEAIWGHNYTNAKDAVRVHIWRLRRKVEPNPQTPCFIITVS
                     HLGFKLALS"
     misc_feature    complement(106433..107050)
                     /locus_tag="DehaBAV1_0106"
                     /note="DNA-binding transcriptional regulator PhoP;
                     Provisional; Region: PRK10816"
                     /db_xref="CDD:182755"
     misc_feature    complement(106748..107020)
                     /locus_tag="DehaBAV1_0106"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(106790..106795,106802..106804,
                     106859..106861,106919..106921,106943..106945))
                     /locus_tag="DehaBAV1_0106"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(106943..106945)
                     /locus_tag="DehaBAV1_0106"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(106919..106927,106931..106936))
                     /locus_tag="DehaBAV1_0106"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(106787..106795)
                     /locus_tag="DehaBAV1_0106"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(106430..106714)
                     /locus_tag="DehaBAV1_0106"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cl17355"
                     /db_xref="CDD:266645"
     misc_feature    complement(order(106439..106441,106454..106456,
                     106490..106495,106517..106519,106526..106528,
                     106580..106585,106640..106642))
                     /locus_tag="DehaBAV1_0106"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(107082..108308)
                     /locus_tag="DehaBAV1_0107"
                     /db_xref="GeneID:5131708"
     CDS             complement(107082..108308)
                     /locus_tag="DehaBAV1_0107"
                     /EC_number="2.7.3.-"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region, ATPase domain protein; histidine
                     kinase A domain protein; PAS fold-3 domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_001213576.1"
                     /db_xref="GI:147668758"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="GeneID:5131708"
                     /translation="MSDNSKGDSILNSQISQSQVESMLFRCFAEELNDIVWEGSNTIA
                     VTFVNSKVYDIWGYKPEELIGKNFLDFMVPSKREEQKKVIDSMVENKAAVNGIHLYYQ
                     HRNGKTLIFETRAKPILDNNGKCVGHRGIFRDVTNYILQEKRLQKLYKQEKAAFTELE
                     NQMQQRLEFTRALAHELKTPLTVIQAANELMGTQILSPELTNISDSIARGVQSLQKRV
                     NELLDLAKGEVGILTVNRKLIKTLPYITNLINDLKPMVKMRNRNLLTNIPNSLPNICA
                     DEQRLTQIISNLVDNSIKYSTEKAAITISVRQDTNLDNILFQVTDTGFGIPPDKQIEI
                     FNPYARIRKAEEHTTGLGIGLSLSRTLVELHGGQIWFETSEGIGSSFYFTMPKYARKR
                     MITAVKKRQPDENCHN"
     misc_feature    complement(107874..108239)
                     /locus_tag="DehaBAV1_0107"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(107904..108215)
                     /locus_tag="DehaBAV1_0107"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(107991..107993,108006..108008,
                     108087..108098,108135..108137,108153..108155,
                     108165..108167))
                     /locus_tag="DehaBAV1_0107"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(107964..107966,107970..107972,
                     108057..108062,108069..108071,108093..108095,
                     108105..108107))
                     /locus_tag="DehaBAV1_0107"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(107133..>107882)
                     /locus_tag="DehaBAV1_0107"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(107631..107822)
                     /locus_tag="DehaBAV1_0107"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(107646..107648,107658..107660,
                     107667..107669,107679..107681,107688..107690,
                     107700..107702,107748..107750,107757..107759,
                     107769..107771,107778..107780,107790..107792,
                     107802..107804))
                     /locus_tag="DehaBAV1_0107"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(107784..107786)
                     /locus_tag="DehaBAV1_0107"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(107157..107468)
                     /locus_tag="DehaBAV1_0107"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(107166..107168,107172..107177,
                     107190..107192,107196..107198,107244..107255,
                     107331..107336,107340..107342,107346..107348,
                     107352..107354,107427..107429,107436..107438,
                     107448..107450))
                     /locus_tag="DehaBAV1_0107"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(107436..107438)
                     /locus_tag="DehaBAV1_0107"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(107247..107249,107253..107255,
                     107334..107336,107340..107342))
                     /locus_tag="DehaBAV1_0107"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(108405..109889)
                     /locus_tag="DehaBAV1_0108"
                     /db_xref="GeneID:5131487"
     CDS             complement(108405..109889)
                     /locus_tag="DehaBAV1_0108"
                     /note="PFAM: cobalamin B12-binding domain protein; Radical
                     SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_001213577.1"
                     /db_xref="GI:147668759"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:5131487"
                     /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYIASVLERAGHEVRIFD
                     NVVSELTPPDYAKDFAPEVVGFSVLTGPCIGNALVQSKEFKALLPGVKVVWGNVHATC
                     TTEQTLKEEAIDFVVRGDGEYTFLDLIDHLEKGEENYAEIQGLAWKDREGRVTINQPR
                     PFIHNLDELPNPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHHGHRADLSVERI
                     VAQIEHLQKNYKVKFIRFFEDNFTFNRKRMREFCQTVIDRRIKIKWDTESRADMSEED
                     VALMAKAGCTSVGIGVETGSKRMLEYLNKGVDLDEMGRTFWRFVKHGIMPRLYIMLAV
                     PTETVEDFTETQDMLHRMEDPPFMYMRFVPYPGTPLYNQLVQDNRIKPPESLGEWAKF
                     SVYFATKGNLSELSDEVINQAISHWAHSYASRRVMFTLRHNPRYLLSAVKNPAEFFKA
                     VSSLIKNSLPVVFNKNTNIKPLVLEAVPNKMHGKQEPRLISNYE"
     misc_feature    complement(109440..109823)
                     /locus_tag="DehaBAV1_0108"
                     /note="B12 binding domain_like associated with radical SAM
                     domain. This domain shows similarity with B12
                     (adenosylcobamide) binding domains found in several
                     enzymes, such as glutamate mutase, methionine synthase and
                     methylmalonyl-CoA mutase, but it lacks the...; Region:
                     radical_SAM_B12_BD; cd02068"
                     /db_xref="CDD:239019"
     misc_feature    complement(108717..109820)
                     /locus_tag="DehaBAV1_0108"
                     /note="B12-binding domain/radical SAM domain protein,
                     MJ_1487 family; Region: B12_SAM_MJ_1487; TIGR04013"
                     /db_xref="CDD:234440"
     misc_feature    complement(108732..109331)
                     /locus_tag="DehaBAV1_0108"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(108804..108809,108897..108899,
                     109017..109019,109083..109091,109170..109175,
                     109179..109181,109287..109295,109299..109301,
                     109305..109307,109311..109313))
                     /locus_tag="DehaBAV1_0108"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(109912..110661)
                     /locus_tag="DehaBAV1_0109"
                     /db_xref="GeneID:5131588"
     CDS             complement(109912..110661)
                     /locus_tag="DehaBAV1_0109"
                     /note="PFAM: Radical SAM domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_001213578.1"
                     /db_xref="GI:147668760"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:5131588"
                     /translation="MKVYHLIYEPSYKSAVFHHWTECNLDCKGCFCRVEKLDFGLFPD
                     ALERLKDKAPETAPTDFLESPEEALKLLEGCELERAVFIGTEPALDPDLPALAKALHQ
                     KYGSYNVLLTNGVRLCDLSDIDEIIFSLKAVTNAIYQDYTGRSNEKTLDNFKKVHASG
                     KKLQAECLLIPGLIEADEVEKIAKFIATVDKDITLRIDGYFPIPGCPWRGATPKEVTE
                     ASQRAGKHLAKVNYLSADLPRQGEKPLRLFG"
     misc_feature    complement(110047..110595)
                     /locus_tag="DehaBAV1_0109"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(110062..110067,110158..110160,
                     110275..110277,110323..110331,110404..110409,
                     110413..110415,110569..110577,110581..110583,
                     110587..110589,110593..110595))
                     /locus_tag="DehaBAV1_0109"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(110104..110595)
                     /locus_tag="DehaBAV1_0109"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     gene            complement(110658..111404)
                     /locus_tag="DehaBAV1_0110"
                     /db_xref="GeneID:5131466"
     CDS             complement(110658..111404)
                     /locus_tag="DehaBAV1_0110"
                     /note="TIGRFAM: putative ATP binding protein;
                     PFAM: protein of unknown function DUF71, ATP-binding
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP binding protein"
                     /protein_id="YP_001213579.1"
                     /db_xref="GI:147668761"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="GeneID:5131466"
                     /translation="MTEVIVSWSGGKDCTLACYKAIKSGLKVRYLASIITRSTGKLWP
                     HLLTPEVLRMQAEAIGIPLLEWPSATEGYDDNYRRMLGQLKTEGVEGVVFGDVNIGNS
                     FAVKHLNWIKSVCEPTGMDYHLPLWQDNRATLLSELIDLGFEVRILAADSTELGESWL
                     GRKLDKDMLAELKIRHSLSPNGNVGYYHTFVTDGPLFKSRLVIEEWGRVFDEQAQFGG
                     MGVWYMDIKRCRLESKAKPETLVLLSAEAL"
     misc_feature    complement(110814..111395)
                     /locus_tag="DehaBAV1_0110"
                     /note="This is a subfamily of Adenine nucleotide alpha
                     hydrolases superfamily.Adeninosine nucleotide alpha
                     hydrolases superfamily  includes N type ATP PPases and ATP
                     sulphurylases. It forms a apha/beta/apha fold which  binds
                     to Adenosine group.  This subfamily; Region:
                     Alpha_ANH_like_IV; cd01994"
                     /db_xref="CDD:238952"
     misc_feature    complement(order(111303..111305,111309..111311,
                     111363..111374,111378..111386))
                     /locus_tag="DehaBAV1_0110"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238952"
     gene            complement(111488..111757)
                     /locus_tag="DehaBAV1_0111"
                     /db_xref="GeneID:5131560"
     CDS             complement(111488..111757)
                     /locus_tag="DehaBAV1_0111"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213580.1"
                     /db_xref="GI:147668762"
                     /db_xref="GeneID:5131560"
                     /translation="MWFFIGLIIGVALLALVLWLKRKVIRLSWYDWVIGFIAFIFGVL
                     AVQHYMASVSHGELKAGLLGLGIFGVIAIVLALLDWQLIARRKKV"
     gene            complement(111779..113299)
                     /locus_tag="DehaBAV1_0112"
                     /db_xref="GeneID:5132438"
     CDS             complement(111779..113299)
                     /locus_tag="DehaBAV1_0112"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213581.1"
                     /db_xref="GI:147668763"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5132438"
                     /translation="MSQFHSILSRRDFMKSLGLASAGIGAASLGGVNATAPFFHDVDE
                     ITSSPSAITKKPWWVKLQDKPTVPMDLSLLEPGRTKVWCMPPDDPSGPVTLRAPGYSE
                     EETRQKFTDYFKKEWGTWDPGPTMEGFGDFPERTTEHIGPIRDNALLAGLMPFLFGKL
                     PDEIIAAEKGQYLSYLLDKPCGWRYAAPLEQRGGTKWQGTPEENLRTVRAAARFYGAD
                     DVGAIEVDEDFLRVMWGVSRFPFIPVPVQFEWGDVDDFVPTPSATRPTKIIIPRRCKY
                     FVHWTMRQPPSRLKHDSGTQQGPSQGWTYSRNPMVNVNIQEFLWGLGYIALTNWSGYL
                     IPTGYAGVASGAGELSRWSGVLTPKFGNQVRGMYGFLTDLPLAPTKPINFGGYEFCKT
                     CGICADACPMGAIQKGEPSWDASEIWQNPGYLGWRLDLTKCSHCPVCQGVCPFNTTDD
                     SFVHNLVKGTIPNVKLFNGFFANMERDFGYGRKPYEDWWENAADGKEPVFGIDSTQ"
     sig_peptide     complement(113195..113299)
                     /locus_tag="DehaBAV1_0112"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.810 at
                     residue 35"
     misc_feature    complement(112172..113149)
                     /locus_tag="DehaBAV1_0112"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(111857..112714)
                     /locus_tag="DehaBAV1_0112"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(111962..112135)
                     /locus_tag="DehaBAV1_0112"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            complement(113374..113997)
                     /locus_tag="DehaBAV1_0113"
                     /db_xref="GeneID:5131429"
     CDS             complement(113374..113997)
                     /locus_tag="DehaBAV1_0113"
                     /note="PFAM: protein of unknown function UPF0153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213582.1"
                     /db_xref="GI:147668764"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="InterPro:IPR005358"
                     /db_xref="GeneID:5131429"
                     /translation="MKELLSSNSKPKPHINGMSYSEQTYWQLMAAEYEAHVAQIGKQQ
                     PNAASTNVSKCIRCGLCCYQYPCIPRPEEIEPIAQYLELTTLDLINKYMVINTADCKV
                     YFLRWAKHGEEDLTGKMIPPARTFDRGYCVFYDQKSRSCCIHPIRPQEARVIKCWEKN
                     NGMDKSLWGITGWNSQDILRFLPDFSPRIYADNKYLPPKSSMPPRKY"
     misc_feature    complement(<113554..113838)
                     /locus_tag="DehaBAV1_0113"
                     /note="Putative zinc- or iron-chelating domain; Region:
                     CxxCxxCC; pfam03692"
                     /db_xref="CDD:252103"
     gene            114086..114973
                     /locus_tag="DehaBAV1_0114"
                     /db_xref="GeneID:5131439"
     CDS             114086..114973
                     /locus_tag="DehaBAV1_0114"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: PAS fold-3 domain protein; PAS fold-4 domain
                     protein; PAS fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PAS/PAC sensor protein"
                     /protein_id="YP_001213583.1"
                     /db_xref="GI:147668765"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5131439"
                     /translation="MKRPPKVYFKNESINTNKYLVTLFKIHQPQNPNSCDIIQCVRDS
                     RFKSLQPNAKQFTIVNKLLLNDIRDYIFILDMDGKIMFVNEQACKARGYTQEELIGRS
                     ILELDTPETAALAFQKIQEAKEKGFALHNIAHKCKNGAIKISELLTRIVEIEGKEYVF
                     GLAKDISEVQARVAAYVNAQEKEREWVSIEIHDRVIQNLTGISHKIDALSSAKESCVS
                     KQIELKELSKQMQASIAEARNIMRELYPNTLARYGLIKLIQEELARLQDELNCNTSLN
                     NSIVNLIPPYLETTMTCPR"
     misc_feature    114284..>114403
                     /locus_tag="DehaBAV1_0114"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    114290..114589
                     /locus_tag="DehaBAV1_0114"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    114632..114832
                     /locus_tag="DehaBAV1_0114"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     gene            complement(114986..115681)
                     /locus_tag="DehaBAV1_0115"
                     /db_xref="GeneID:5131425"
     CDS             complement(114986..115681)
                     /locus_tag="DehaBAV1_0115"
                     /note="PFAM: Integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001213584.1"
                     /db_xref="GI:147668766"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:5131425"
                     /translation="MADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEGL
                     RVPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTRE
                     CLAITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTLF
                     IEPGSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGYR
                     PPAPEAIMAVVTT"
     misc_feature    complement(115526..115672)
                     /locus_tag="DehaBAV1_0115"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(115133..115483)
                     /locus_tag="DehaBAV1_0115"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(115022..115222)
                     /locus_tag="DehaBAV1_0115"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(115822..116100)
                     /locus_tag="DehaBAV1_0116"
                     /db_xref="GeneID:5131415"
     CDS             complement(115822..116100)
                     /locus_tag="DehaBAV1_0116"
                     /note="PFAM: transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001213585.1"
                     /db_xref="GI:147668767"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:5131415"
                     /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYR
                     WRQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
     misc_feature    complement(115873..116094)
                     /locus_tag="DehaBAV1_0116"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            116258..116575
                     /locus_tag="DehaBAV1_0117"
                     /db_xref="GeneID:5131409"
     CDS             116258..116575
                     /locus_tag="DehaBAV1_0117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213586.1"
                     /db_xref="GI:147668768"
                     /db_xref="GeneID:5131409"
                     /translation="MCKKCAVNCPAGAISMEDEPSEVVKSARFIGWDTDSHKCLTERI
                     VHGCSTCQAICPWSKPDTIIHEIGRTFGQNKALAPFLVKLDDFFYGSKPEGYDVATWA
                     PWR"
     misc_feature    116261..116431
                     /locus_tag="DehaBAV1_0117"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            116611..116883
                     /locus_tag="DehaBAV1_0118"
                     /db_xref="GeneID:5131393"
     CDS             116611..116883
                     /locus_tag="DehaBAV1_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213587.1"
                     /db_xref="GI:147668769"
                     /db_xref="GeneID:5131393"
                     /translation="MTLILLLVGVAMGIFGTWLWNAKNKKNIKLTFIEYLLLAFAVII
                     FSAGVLFVKTFVEESETNVALMSGLVSSITALILLATTWQLVKRHN"
     gene            complement(117096..118538)
                     /locus_tag="DehaBAV1_0119"
                     /db_xref="GeneID:5131444"
     CDS             complement(117096..118538)
                     /locus_tag="DehaBAV1_0119"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213588.1"
                     /db_xref="GI:147668770"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5131444"
                     /translation="MTKSGFDVIKADAMANIGTNFKDLDELKSDSLAVEKLPWWIKQK
                     EFWDFTTEMDWSAQKPFEYSIRNFNQHLSPKQAKQYNSRYTQVMEWRKTSKVPGFTHR
                     DYAMKCGANTITLLSDLAGIDKNGESALYWTGSPKLMDVTPTPEEMGCPKYEATPEEN
                     LLMIRTFLKVCGASKVGAVPVDVKFKSTQPKFYADKIPLVYENVDKPYITRSKYVIPD
                     RMKWAIVFSTEGGNDLTGRGNNWVGALGASLYSGGPSDYIQIQVQRFLKALGYSSVVS
                     GICYNLQNWPAMGVASGMGELGRMQISVSPFLKWDRAIRCIITDLPVSFTLPIDAGIT
                     RFCIDCGRCASVCPVSAINSSRESSWDIWPKDPKNPNLRPELFNNPGKKTWYFGHHLC
                     GAFGRDANDSKCGICMLNCVFNRGTDTILYPFIKPVGANKSALANFLKDMKKNFSCTG
                     FESSMPLGEEDQYTLAGESLVENFWNQDSS"
     misc_feature    complement(117570..118442)
                     /locus_tag="DehaBAV1_0119"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(117201..118085)
                     /locus_tag="DehaBAV1_0119"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(117297..117533)
                     /locus_tag="DehaBAV1_0119"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            complement(118864..119136)
                     /locus_tag="DehaBAV1_0120"
                     /db_xref="GeneID:5131421"
     CDS             complement(118864..119136)
                     /locus_tag="DehaBAV1_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213589.1"
                     /db_xref="GI:147668771"
                     /db_xref="GeneID:5131421"
                     /translation="MWLLLGILIGIIALGIIWWARKSNTSLQWYDWVISLAGLAMLLF
                     TVQNYFASVAEGESKAASMFLLVAGLPALILLAVVWQLVIRRVKKA"
     gene            complement(119160..120704)
                     /locus_tag="DehaBAV1_0121"
                     /db_xref="GeneID:5131472"
     CDS             complement(119160..120704)
                     /locus_tag="DehaBAV1_0121"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213590.1"
                     /db_xref="GI:147668772"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5131472"
                     /translation="MNKFHSSVSRRDFMKGLGIAGAGLGAAAATVPVFHDLDEAVSAP
                     VAGGFRRPWWVKEREYEDPTCEVDWSQIERSDNSWIMHGVRNGVKGGYLFAGQKYLDW
                     QKEGSDRAFNGVKNNEPGLTLRDMALEGGASPLLMGLNKVVNFVLPEIDQDQVLAQFG
                     FTAAAWPNASSFWVASAPPDFWGVPKWQGTPEENSRMLRSAMRFFGASEVRFAELNEK
                     TKKLIFTHHVHNTPIVFEDVDKAYEVAGQKFVLPDKPLYIVSVAVQMSKEMYRQGNAG
                     IRFAANNMRYRLNNVVQVATQSFLKGIGYQGIGYPSESLFHGMMPSQADAILTGFAEM
                     ARNNNYCISPEFGTVAGYYSILTDLPLAPDKPIDAGYFRFCHTCRKCAEACPSQAISF
                     DSEPTWDIPPSSVDPAKATLYSTPGKKVFHTDSPACYSRWIGLHGCARCMGTCVFNTN
                     SSAMVHDMVRATIGTTGLFNGFLWNADKAFGYGLIPPEKWEEWWDKDYPVLGQDSTIG
                     SYYGGY"
     sig_peptide     complement(120618..120704)
                     /locus_tag="DehaBAV1_0121"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.985) with cleavage site probability 0.850 at
                     residue 29"
     misc_feature    complement(119622..120566)
                     /locus_tag="DehaBAV1_0121"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(119256..120149)
                     /locus_tag="DehaBAV1_0121"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(119361..119585)
                     /locus_tag="DehaBAV1_0121"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            complement(120715..120942)
                     /locus_tag="DehaBAV1_0122"
                     /db_xref="GeneID:5131502"
     CDS             complement(120715..120942)
                     /locus_tag="DehaBAV1_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213591.1"
                     /db_xref="GI:147668773"
                     /db_xref="GeneID:5131502"
                     /translation="MTVTNLYRNFIIYNRKYILLLLGCWYTPLKRLFPATLIIGFIIS
                     GKGVQVNKNGGENGIKDVVPLGKPQIFMVLI"
     gene            120969..122270
                     /locus_tag="DehaBAV1_0123"
                     /db_xref="GeneID:5131483"
     CDS             120969..122270
                     /locus_tag="DehaBAV1_0123"
                     /EC_number="2.7.3.-"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region, ATPase domain protein; histidine
                     kinase A domain protein; PAS fold-3 domain protein; PAS
                     fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_001213592.1"
                     /db_xref="GI:147668774"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5131483"
                     /translation="MRFKEHLMKMPSPERIGTADYCSQIVKIMQHNTLVGITIVDQKM
                     HQIIRVNQALCKMLGYRKKELLGKTMFDITHPDDMEISYKHAMKIWDDEHCYSKIIKR
                     YSKKDGGFIWAESEGFLLKDNADNGILSVTFIKDITKETTLSSSTPLSISSNPASSSQ
                     ENPDIDVNKLLSDEINKRKLIYNQLMVSYENEKKLRKRIQTEMKSRLEFTRIVVHDLK
                     TPLTSIISSSGVLSNIAADGKYKALASNIYESTMNLNIRLDELLDMAQCEVRDPKLNK
                     SRFNIKEMLEHIISIQQEICNTNHIVFNIVIAPEVTFIIADEDRLKQILDNLIDNAIK
                     YSADSGIISINISHDQNNVLFSISDSGIGIEPGEIKNIFKPYYRVENRQRKLQGLGLG
                     LSIVRTYVKLHGGRIWVESECGKGTTFLFTIPQPPSKATPA"
     misc_feature    121071..121385
                     /locus_tag="DehaBAV1_0123"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    121071..121379
                     /locus_tag="DehaBAV1_0123"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(121116..121118,121128..121130,121146..121148,
                     121185..121196,121275..121277,121290..121292)
                     /locus_tag="DehaBAV1_0123"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(121176..121178,121188..121190,121212..121214,
                     121224..121229,121311..121313,121317..121319)
                     /locus_tag="DehaBAV1_0123"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    <121566..122258
                     /locus_tag="DehaBAV1_0123"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    121575..121766
                     /locus_tag="DehaBAV1_0123"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(121593..121595,121605..121607,121617..121619,
                     121626..121628,121638..121640,121647..121649,
                     121695..121697,121707..121709,121716..121718,
                     121728..121730,121737..121739,121749..121751)
                     /locus_tag="DehaBAV1_0123"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    121611..121613
                     /locus_tag="DehaBAV1_0123"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    121929..122237
                     /locus_tag="DehaBAV1_0123"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(121947..121949,121959..121961,121968..121970,
                     122037..122039,122043..122045,122049..122051,
                     122055..122060,122136..122147,122193..122195,
                     122199..122201,122214..122219,122223..122225)
                     /locus_tag="DehaBAV1_0123"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    121959..121961
                     /locus_tag="DehaBAV1_0123"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(122049..122051,122055..122057,122136..122138,
                     122142..122144)
                     /locus_tag="DehaBAV1_0123"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            122267..122944
                     /locus_tag="DehaBAV1_0124"
                     /db_xref="GeneID:5131486"
     CDS             122267..122944
                     /locus_tag="DehaBAV1_0124"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001213593.1"
                     /db_xref="GI:147668775"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5131486"
                     /translation="MKLLFIEDDKKIVESIFLLFKSFWPDMETKAVHLGKTGIETAYK
                     EDFDIAIIDLGLPDIDGINVLKQIRAFSSLPILILTARNNEQEIFTAFELGADDYITK
                     PFQPLELIARVKSLLKRLSRASQDLGVKYGHWKFGTSLKEISYNNIRVNLTVTEGQLL
                     HILLTKAGSTVSYADISKSIWGRNEYYAKETIKTHIMRIRQKLSRIDNSKEFIINIPG
                     VGYQIVE"
     misc_feature    122267..122941
                     /locus_tag="DehaBAV1_0124"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    122276..122617
                     /locus_tag="DehaBAV1_0124"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(122285..122290,122423..122425,122447..122449,
                     122504..122506,122561..122563,122570..122575)
                     /locus_tag="DehaBAV1_0124"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    122423..122425
                     /locus_tag="DehaBAV1_0124"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(122432..122437,122441..122449)
                     /locus_tag="DehaBAV1_0124"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    122570..122578
                     /locus_tag="DehaBAV1_0124"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    122651..122935
                     /locus_tag="DehaBAV1_0124"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cl17355"
                     /db_xref="CDD:266645"
     misc_feature    order(122723..122725,122780..122785,122837..122839,
                     122846..122848,122870..122875,122909..122911,
                     122924..122926)
                     /locus_tag="DehaBAV1_0124"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            123332..123655
                     /locus_tag="DehaBAV1_0125"
                     /db_xref="GeneID:5132427"
     CDS             123332..123655
                     /locus_tag="DehaBAV1_0125"
                     /note="PFAM: TM2 domain containing protein+B7201"
                     /codon_start=1
                     /transl_table=11
                     /product="TM2 domain-containing protein"
                     /protein_id="YP_001213594.1"
                     /db_xref="GI:147668776"
                     /db_xref="InterPro:IPR007829"
                     /db_xref="GeneID:5132427"
                     /translation="MYCSKCGKQVDDSVSFCPACGNQLHTSGTTATEYPERKSRIAAG
                     LLGIFLGSIGVHRFYLGYVGIGIAQIIVSFVTLGIGSIWGFIEGILILTGSFQYDAKG
                     IPLRD"
     misc_feature    123335..123403
                     /locus_tag="DehaBAV1_0125"
                     /note="zinc-ribbon domain; Region: zinc_ribbon_2;
                     pfam13240"
                     /db_xref="CDD:257597"
     misc_feature    123338..>123409
                     /locus_tag="DehaBAV1_0125"
                     /note="Double zinc ribbon; Region: DZR; pfam12773"
                     /db_xref="CDD:257289"
     misc_feature    123437..123598
                     /locus_tag="DehaBAV1_0125"
                     /note="TM2 domain; Region: TM2; pfam05154"
                     /db_xref="CDD:253047"
     gene            123743..124000
                     /locus_tag="DehaBAV1_0126"
                     /db_xref="GeneID:5131459"
     CDS             123743..124000
                     /locus_tag="DehaBAV1_0126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213595.1"
                     /db_xref="GI:147668777"
                     /db_xref="GeneID:5131459"
                     /translation="MPKIGPIEIIIIIILIMIPVGLIWGLIYLFNKLNKKKITGRNMP
                     LDIIEINKGVQYCTRCGQKLEANIQFCPVCGTEKLHAPKIP"
     misc_feature    <123881..123982
                     /locus_tag="DehaBAV1_0126"
                     /note="Hydrogenase expression/synthesis hypA family;
                     Region: HypA; cl19201"
                     /db_xref="CDD:267554"
     gene            124013..124354
                     /locus_tag="DehaBAV1_0127"
                     /db_xref="GeneID:5131490"
     CDS             124013..124354
                     /locus_tag="DehaBAV1_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213596.1"
                     /db_xref="GI:147668778"
                     /db_xref="GeneID:5131490"
                     /translation="MVRLIIGILLGLWGLPVLVFSIQNLIGSLSETEPQVAGMFFFVT
                     GLPALVMLLGAFLLIRSYLKNPSKPAHPVQSRLSTPDSQNTSGQYCTKCGIGLAADVV
                     FCPNCGQKITP"
     misc_feature    124277..124345
                     /locus_tag="DehaBAV1_0127"
                     /note="zinc-ribbon domain; Region: zinc_ribbon_2;
                     pfam13240"
                     /db_xref="CDD:257597"
     gene            124563..125747
                     /locus_tag="DehaBAV1_0128"
                     /db_xref="GeneID:5131492"
     CDS             124563..125747
                     /locus_tag="DehaBAV1_0128"
                     /note="PFAM: HI0933 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213597.1"
                     /db_xref="GI:147668779"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5131492"
                     /translation="MPRKTTLIIGGGAAGMVASISKARRGEPVMILEKTAQLGKKILA
                     SGNGRCNLLNEALDSSSYNPEARPLVNSVFSRFGRDDILNFFSELGLHYYSQDGRIFP
                     FTNQAASVQKVLALEIKRLGVQVEYGFDCVSIQKTQTGFSLGAADGKQQTGHSLILTG
                     GGSTYPSFGSDGSGYKLASSLGHRIIKPVPSTVPLVVKDPLCHLLQGQRIIARAQSRI
                     QGKIGNPVDGELLFTKYGLSGSLILDISQEISLAINRLNIKDVSLETDLIPFMEQKQL
                     ETELTNRHKMGLTPEDMLTGILPGKLCLAFKQLFEKENPSKAAVKLKNWRFEVSGTRG
                     WNEAEFTAGGIDTKEVDPQTLESKLVKGLYLAGEVLDVNGKRGGYNLGFAWASGYVAG
                     LS"
     sig_peptide     124563..124634
                     /locus_tag="DehaBAV1_0128"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.856) with cleavage site probability 0.519 at
                     residue 24"
     misc_feature    124581..125741
                     /locus_tag="DehaBAV1_0128"
                     /note="flavoprotein, HI0933 family; Region: TIGR00275"
                     /db_xref="CDD:232901"
     misc_feature    124581..>124679
                     /locus_tag="DehaBAV1_0128"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    124638..125741
                     /locus_tag="DehaBAV1_0128"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            125873..126727
                     /locus_tag="DehaBAV1_0129"
                     /db_xref="GeneID:5131495"
     CDS             125873..126727
                     /locus_tag="DehaBAV1_0129"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213598.1"
                     /db_xref="GI:147668780"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:5131495"
                     /translation="MKSFKVIAPLISLLMLLSLALGGCSSGTADNDSPDTNNLPVSDT
                     TPTGSQLIASILAASPNITSFDTTSVIDMTMQVSGMSIKTVMTANGKEDLSSKKAYLT
                     SSIIMTGDLASTMEMETYLIDSFQYFRITSTDQNTGMQLNTWYKMLMDTQMQTQTWNS
                     QSQQNNYLFSKSSITVDGSETINGTSCWKVTITPDLTELIKYLNEQQAIEDPSAITNP
                     ADSLKNIKLTAWVAKDTSYVIKMNMSMDMLIEAQTLSMVMSTTITNINQPVSITLPPE
                     AVNAIQVG"
     sig_peptide     125873..125962
                     /locus_tag="DehaBAV1_0129"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.677 at
                     residue 30"
     gene            126795..128852
                     /locus_tag="DehaBAV1_0130"
                     /db_xref="GeneID:5131500"
     CDS             126795..128852
                     /locus_tag="DehaBAV1_0130"
                     /note="PFAM: SMC domain protein; ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_001213599.1"
                     /db_xref="GI:147668781"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5131500"
                     /translation="MSYTSFGGGGFLLYNGYYTKTNMLNIQNLSKSFGVRSLYTGVNL
                     NIGARDRLALLGPNGSGKTTLFEMIAGRLEPDEGKIILRRGTTVGYLEQDIKPSSKQP
                     LLKAVSSASDRLRSLSHKISLLQGELAEEKDGSESNRLMNELGELQHSFEALGGYNAE
                     QEAKLILAGLGFKPADFDRPLHEFSGGWLMRAELAKLLFLSPDILILDEPTNHLDLES
                     TRWFESYLKQYSGSVLFTSHDRAFLNSIATKILSLEEQKARLYTGNYDSYLRERELRL
                     IQLESQSRRQQELIDKETKFIERFRYKATKASQVQSRIKKLDKLSAIVIPRQTKKMHF
                     NFPEPERSGHDVIKLRNLTKSYGDMVIYQGLELVLNRGDKVALVGPNGAGKTTLLKIL
                     AGVMLFDSGYRNLGVNVNTAYFAQYYVESLCPSNNLIQELETILPDAPEQQLRGMLGA
                     FLFSGDDVKKRISVLSGGEKTRLAIAKMLLKPANLVLMDEPTNHLDIPAREILADALQ
                     AYKGTLCFITHDRTLIREVATKIIEVRNGKIRIFEGDYDAYLEFAAANPFEDEILKNR
                     TAVSSPRPAPVSASLSQKQRKTLEGQIRNQHYKETGALKQEISDTEEEITGLEKSKQE
                     LETLLADPDLYRSGQKVADASLEYKTCKERLIILGEKWLKLCQQNDTLKQKLEDTLKE
                     LDN"
     misc_feature    126861..128447
                     /locus_tag="DehaBAV1_0130"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    126864..127565
                     /locus_tag="DehaBAV1_0130"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    127545..127802
                     /locus_tag="DehaBAV1_0130"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    127833..128408
                     /locus_tag="DehaBAV1_0130"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            complement(128849..129427)
                     /locus_tag="DehaBAV1_0131"
                     /db_xref="GeneID:5131446"
     CDS             complement(128849..129427)
                     /locus_tag="DehaBAV1_0131"
                     /note="PFAM: Hly-III family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Hly-III family protein"
                     /protein_id="YP_001213600.1"
                     /db_xref="GI:147668782"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="GeneID:5131446"
                     /translation="MLALIVLVILSWGNWDIMAVSVIYALAVISLFSFSTIYHALKKK
                     ENEINVWRKLDHIAIFIMIAGTYTPMAYIYLDGGWRLGMLIATWVFVLAGVFQKIFFL
                     NAPRWLSPVTYLGMGWMAVVPLREFWLNMPSLVFWLIAAGGLAYSIGAVIYGLKKPNP
                     VPGAFGFHEIFHTLILLGWAFHLAAVILAILG"
     misc_feature    complement(128855..129427)
                     /locus_tag="DehaBAV1_0131"
                     /note="Haemolysin-III related; Region: HlyIII; cl03831"
                     /db_xref="CDD:261909"
     gene            129622..130902
                     /locus_tag="DehaBAV1_0132"
                     /db_xref="GeneID:5131460"
     CDS             129622..130902
                     /locus_tag="DehaBAV1_0132"
                     /note="PFAM: proteinase inhibitor I4, serpin"
                     /codon_start=1
                     /transl_table=11
                     /product="proteinase inhibitor I4, serpin"
                     /protein_id="YP_001213601.1"
                     /db_xref="GI:147668783"
                     /db_xref="InterPro:IPR000215"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:5131460"
                     /translation="MKIKHLFSLLAVASLFTLTACSGGVSAEELKSDKDRIANPNISQ
                     QDANIQAEANNDFAFKLYHFLKGTEEGNFFYSPFSISIALAMTYAGADTTTKTEMQNT
                     LNYLLPDANLHAFFNFIDQELNKRESQAEEADAGTFELKLVNAIWGQKNYTFLSDFLD
                     TLAQNYGAGLRVLDFAASSEDARRVINDWVSEATKDKIKDLIPSDGIDSTTRLVLTNA
                     IYFNAAWAAPFEEEDTQNGLFYLQNGSSVSVQMMHQSEGHGYYNGDDFQAVELAYAGN
                     SLSMVIILPDEGKFGQVEDALSGQMLTGILASIKYNQINLSLPKFSFESEFALKDALS
                     ALGMPTAFSGQADFSKMDGGYNLMIGDVFHKSFISVSEAGTEAAAATAVTMNLTSAPA
                     EPVTLSIDRAFIFCIVDMATGTTLFTGRVLNPGA"
     sig_peptide     129622..129705
                     /locus_tag="DehaBAV1_0132"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.989 at
                     residue 28"
     misc_feature    129778..130884
                     /locus_tag="DehaBAV1_0132"
                     /note="SERine Proteinase INhibitors (serpins) exhibit
                     conformational polymorphism shifting from native to
                     cleaved, latent, delta, or polymorphic forms. Many
                     serpins, such as antitrypsin and antichymotrypsin,
                     function as serine protease inhibitors which regulate...;
                     Region: SERPIN; cd00172"
                     /db_xref="CDD:238101"
     misc_feature    order(130741..130752,130810..130827)
                     /locus_tag="DehaBAV1_0132"
                     /note="reactive center loop; other site"
                     /db_xref="CDD:238101"
     gene            complement(130984..133176)
                     /locus_tag="DehaBAV1_0133"
                     /db_xref="GeneID:5131440"
     CDS             complement(130984..133176)
                     /locus_tag="DehaBAV1_0133"
                     /EC_number="5.4.3.2"
                     /note="TIGRFAM: lysine 2,3-aminomutase YodO family
                     protein;
                     PFAM: GCN5-related N-acetyltransferase; Radical SAM domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lysine 2,3-aminomutase"
                     /protein_id="YP_001213602.1"
                     /db_xref="GI:147668784"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR003739"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:5131440"
                     /translation="MVLADTKSEMPQYPQTEQDHQVMAHKISSDYHEDEWNNWKWHIS
                     HTIRDLTTVEKLLGVKFSAEKRRSLEDTILKFPMSITPYYFSLIDRKNFENDPVFIQS
                     VPSAAELNFSCYDKEDPLAEDVDSPAPGITHRYPDRVLFHVSNRCAMYCRHCTRKRKV
                     GDIDKNLSRDELKKGLEYIKNTPRVRDVLLSGGDPLLLPDSILEWLLSELKAIPHVQV
                     IRIGTRVPVVLPQRITPHLVKIIRKYHPVWINTHFNHPREITATSSRALGMLADAGIP
                     LGNQTVLLAKVNDCPRVMKALVHKLVENRVRPYYLYQCDPAQGLSHFRTSIGKGIEII
                     ENLIGHTSGFAVPTYVIDAPNGGGKIPIMPNYLISQSSSKVILRNYEGIITAYYQPED
                     YHPPKCGQDCSACNLDLDLNGAAEGALVGIARLLSNYEDTDYLVPTECDRMDRRKSGY
                     DQITTMGTSLIQHGKNSDRIYLMRLAAEEAATLITGMQALATENGYTKLFAKVPDDIK
                     PLFEADGFETEAVIPCFYGGSKTGYFMGKFIDKDRKIEENGELLEDVLKVAHSKAGKV
                     PVVKLPNGYTLRKCTAEDTSAMADVFSTVFASYPFPIFEPDYISRTMAESITYYGIWH
                     GDRLAALSSAEQYPLEGHVELTDFATLPVYRRRKLAGILLRTMEDEMKQKGFGVSYTS
                     AVAESYGMNISFARQGYKFAGRLKNNTQINGSIKSMNVWYKCLKKKTK"
     misc_feature    complement(131839..133089)
                     /locus_tag="DehaBAV1_0133"
                     /note="lysine-2,3-aminomutase; Region: lys_2_3_AblA;
                     TIGR03820"
                     /db_xref="CDD:163532"
     misc_feature    complement(132172..132756)
                     /locus_tag="DehaBAV1_0133"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(132235..132240,132331..132333,
                     132421..132423,132505..132513,132595..132600,
                     132604..132606,132712..132720,132724..132726,
                     132730..132732,132736..132738))
                     /locus_tag="DehaBAV1_0133"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(131803..132177)
                     /locus_tag="DehaBAV1_0133"
                     /note="Lysine-2,3-aminomutase; Region: LAM_C; pfam12544"
                     /db_xref="CDD:152978"
     misc_feature    complement(131002..131805)
                     /locus_tag="DehaBAV1_0133"
                     /note="putative beta-lysine N-acetyltransferase; Region:
                     GNAT_ablB; TIGR03827"
                     /db_xref="CDD:163539"
     misc_feature    complement(131149..131322)
                     /locus_tag="DehaBAV1_0133"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(131194..131199,131227..131235))
                     /locus_tag="DehaBAV1_0133"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(133630..134124)
                     /locus_tag="DehaBAV1_0134"
                     /db_xref="GeneID:5131733"
     CDS             complement(133630..134124)
                     /locus_tag="DehaBAV1_0134"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213603.1"
                     /db_xref="GI:147668785"
                     /db_xref="GeneID:5131733"
                     /translation="MADTEFITQQIQLLKDPDGLKRQSARLALEDLGKSSVPYLVAKL
                     DEYQGDALWESVKALSRIGDASSAGALVKLLSHEVSDIRWLASLGLIKIGKEGVKPLL
                     RDLSLSDARSPLLREEAHHVLTGLRDKQLKNSLSGVIKALESNSPRSDAPVAAEEALV
                     KLKF"
     misc_feature    complement(133768..133968)
                     /locus_tag="DehaBAV1_0134"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     gene            134276..134629
                     /locus_tag="DehaBAV1_0135"
                     /db_xref="GeneID:5131731"
     CDS             134276..134629
                     /locus_tag="DehaBAV1_0135"
                     /note="PFAM: protein of unknown function DUF134; Sigma-70,
                     region 4 type 2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213604.1"
                     /db_xref="GI:147668786"
                     /db_xref="InterPro:IPR002852"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="GeneID:5131731"
                     /translation="MPRPYKCRRISEIPKVAYYKPAGIPLSMLEENQLSTEEAEALRL
                     KDLLGLEQAQAALQMNISRPTFQRMLYSARYKVADALLNGKALRIEGGVFEIDARPCC
                     QRQTPSCQPDPPKQT"
     misc_feature    134276..134566
                     /locus_tag="DehaBAV1_0135"
                     /note="Predicted DNA-binding proteins [General function
                     prediction only]; Region: COG1342"
                     /db_xref="CDD:224261"
     misc_feature    <134369..134518
                     /locus_tag="DehaBAV1_0135"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    order(134378..134380,134408..134410,134426..134431,
                     134459..134461,134465..134470,134474..134482,
                     134486..134491,134495..134497)
                     /locus_tag="DehaBAV1_0135"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(134626..135600)
                     /locus_tag="DehaBAV1_0136"
                     /db_xref="GeneID:5131716"
     CDS             complement(134626..135600)
                     /locus_tag="DehaBAV1_0136"
                     /note="PFAM: aldo/keto reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="YP_001213605.1"
                     /db_xref="GI:147668787"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="GeneID:5131716"
                     /translation="MNNIIDKKWAYRELGKTGIGLSPIGLGGWQFSRGKGAAIGVWGM
                     LNQTKVNEIVLNSLGGGINWFDTAEAYGMGQSEEALAEALKQAGIQPGECFIATKWQL
                     TLRFASSIKTLLPMREGFLNPYKVDLYQVHFPSLFASIDAQMDNMAALYKEGRIRAIG
                     VSNFNASQMRIAQKRLNEHGLSLASNQVRYNLLDRQIETNGVLETARELGISLLAYSP
                     LGMGILSGKYQRNPEYLQQVPFIRRKSIRRALEKSMPIIATLSEIAGRYSADIAQVAL
                     AWVIYGQGDTVFAIAGASTPVQARENLKALDIKLTTAEIAELNKVSRL"
     misc_feature    complement(134638..135570)
                     /locus_tag="DehaBAV1_0136"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(134638..135570)
                     /locus_tag="DehaBAV1_0136"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    complement(order(134695..134700,134707..134709,
                     134722..134733,134785..134787,134938..134955,
                     135040..135042,135112..135117,135202..135207,
                     135304..135306,135388..135390,135403..135405,
                     135514..135522))
                     /locus_tag="DehaBAV1_0136"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(135205..135207,135304..135306,
                     135388..135390,135403..135405))
                     /locus_tag="DehaBAV1_0136"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(135870..136667)
                     /locus_tag="DehaBAV1_0137"
                     /db_xref="GeneID:5131737"
     CDS             complement(135870..136667)
                     /locus_tag="DehaBAV1_0137"
                     /note="PFAM: LmbE family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_001213606.1"
                     /db_xref="GI:147668788"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="GeneID:5131737"
                     /translation="MKLMKKNRARLFISLTVICLAGVSFFLWAMPAVLGQQYIKQLNY
                     LPSPQPGERILIFSPHPDDETIALGGYIDSACQAGAEVEIVLVTDGSKFTNKEIRYQE
                     FESACRLLGVAADHLVFLDFKDGSLRSVPVTLLIDCFGALINSFMPDIVFYPHPQDAH
                     DDHAAVSRAVRQCLKVTPGIRGYEYLVHYRIFFPQPRVFNQNLYLLPPLTLVNEDHNW
                     LKFDLSEEQLERKLAALSAYASQLKNPFLKPLMQSFIRQNELVCLPN"
     sig_peptide     complement(136578..136667)
                     /locus_tag="DehaBAV1_0137"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.785 at
                     residue 30"
     misc_feature    complement(136182..136505)
                     /locus_tag="DehaBAV1_0137"
                     /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; pfam02585"
                     /db_xref="CDD:251394"
     gene            136845..138170
                     /locus_tag="DehaBAV1_0138"
                     /db_xref="GeneID:5131505"
     CDS             136845..138170
                     /locus_tag="DehaBAV1_0138"
                     /note="PFAM: multi antimicrobial extrusion protein MatE;
                     polysaccharide biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="YP_001213607.1"
                     /db_xref="GI:147668789"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="InterPro:IPR002797"
                     /db_xref="GeneID:5131505"
                     /translation="MAYIFNKTRPDAVADMRVTTAKPYQLFGKLRSPLYINAIFLIIG
                     GGAGAALSFVFWILTARFFTPSAVGLAGAVISAISLLGTVSHLGLGFGIIRFLPQNIY
                     PAKSIINSSISLTLIVSILAGGIFLLGLGIWSPELLFLRQSPLLAVSFLAFTAATALN
                     SIADNSLIAHRHSGYSTLRVVAASGLRLILVIILASLFPQNGIFSAWGIALIATLFMA
                     IFGFIPKVSGGFRPGFEICYPYLKSSFGFSLSNNLSQFLGSAPALLLPLLVLGILGAE
                     SNAYFYIGWSTATALTTIPVSISTSLFTEGSHDEKGLSLHIQKSLKLSLGLIIPLVII
                     LFLLADKVLLFFGQEYAVSSSGLLRIMIVGLIPQSLNVIYMGSLRVIKQLKRLMLINC
                     LIAGLSLILSFGLIPVMGINGAGLAWVIAQSVCAVYVGFRLITNRSTSV"
     misc_feature    136932..138116
                     /locus_tag="DehaBAV1_0138"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    136953..138116
                     /locus_tag="DehaBAV1_0138"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            138170..139456
                     /locus_tag="DehaBAV1_0139"
                     /db_xref="GeneID:5131501"
     CDS             138170..139456
                     /locus_tag="DehaBAV1_0139"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein; coenzyme F420 hydrogenase/dehydrogenase beta
                     subunit domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420 hydrogenase/dehydrogenase subunit
                     beta"
                     /protein_id="YP_001213608.1"
                     /db_xref="GI:147668790"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR007516"
                     /db_xref="InterPro:IPR007525"
                     /db_xref="GeneID:5131501"
                     /translation="MNTPKEPKSILLTLRQQLCCGCGICQAICPAGAIKMQIAPDKGI
                     YLPWLNTSLCRSCGKCLKVCPGTGIDLDSYSQAIFGGASPSLIQNSCYTAFSSDHLQR
                     NLSTSGGVATALLNYALETGLIDGALVSGANPSSPLTPASFIARTPEELKQAAGSKYC
                     PVAAASAISEITAKPGRYAVVGLPCHIQAIRKAENQNPLLKERIVLHLGIVCSSTMSF
                     RGTEYILKQQGINKINLISLHYRTGGWPGDMHLEMACGDTQTLPLRNYHPYHGHGFFS
                     PRRCLMCTDQLNELADISLGDAWLRELEYDHEGTSAVIVRGDTGEDFYRNAVQYGCIK
                     SQPLSNKRVMEWRNKRQDYAAKKNILSLLGWKLPEYSHSCPPARKIAYLYTLEQVINY
                     HLGKTNSRLVIEPAKHFWVWLTRIAEKFISKQASRG"
     misc_feature    138221..139240
                     /locus_tag="DehaBAV1_0139"
                     /note="Coenzyme F420-reducing hydrogenase, beta subunit
                     [Energy production and conversion]; Region: FrhB; COG1035"
                     /db_xref="CDD:223966"
     misc_feature    138224..138364
                     /locus_tag="DehaBAV1_0139"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     misc_feature    138437..138679
                     /locus_tag="DehaBAV1_0139"
                     /note="Coenzyme F420 hydrogenase/dehydrogenase, beta
                     subunit N-term; Region: FrhB_FdhB_N; pfam04422"
                     /db_xref="CDD:252587"
     misc_feature    138698..139219
                     /locus_tag="DehaBAV1_0139"
                     /note="Coenzyme F420 hydrogenase/dehydrogenase, beta
                     subunit C terminus; Region: FrhB_FdhB_C; pfam04432"
                     /db_xref="CDD:252593"
     gene            complement(139431..140723)
                     /locus_tag="DehaBAV1_0140"
                     /db_xref="GeneID:5131728"
     CDS             complement(139431..140723)
                     /locus_tag="DehaBAV1_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213609.1"
                     /db_xref="GI:147668791"
                     /db_xref="GeneID:5131728"
                     /translation="MKENPDNKPPRILVLSNADFESRGFQAIVRGLEHCLGECLPGLT
                     LEYFSFAPKRYRYLESKGLKLISHPWANGNCETLNTFSYLVLIPKSLLRAVYYKLRPA
                     KNPYRHYNALLHINVDCLNETDYGFVCVCLNLLKSWAGLRAFGCPLLTAPVDIGPFNT
                     PVSRFMGRYILSRAKLVALRDELSYEYLLKLGLKPERLYLGADMAFLMPPASREVVKE
                     LFMAEGVENDNRFIIGISPSLFQMELKNIFADSAADKPEVYLMLIAELADFAASTFDA
                     GIYLIPHVHPDDSRVCHEVYARMQHKNRVHVFSGDYPSETVKGLIGECDIFISCRMHA
                     SIAALSQAIPTLTLGYQEKYWKLLGSYLGQSDYLVDIKKPNPRDIQDELKQKLSCMAA
                     NRPAISARIKERLGIINHRASVYGQRVAEVISRGKPVC"
     misc_feature    complement(139518..>140261)
                     /locus_tag="DehaBAV1_0140"
                     /note="Polysaccharide pyruvyl transferase; Region:
                     PS_pyruv_trans; cl09156"
                     /db_xref="CDD:263732"
     gene            complement(140704..141405)
                     /locus_tag="DehaBAV1_0141"
                     /db_xref="GeneID:5131723"
     CDS             complement(140704..141405)
                     /locus_tag="DehaBAV1_0141"
                     /note="PFAM: Methyltransferase type 11; Methyltransferase
                     type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="YP_001213610.1"
                     /db_xref="GI:147668792"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:5131723"
                     /translation="MNRVFVKKLLNLSHRYGGYVPLSRLNTVSCWLEGGGESLLDIGC
                     GGGEAMLFLNRRKSFKTCGVDINPILIAEAKNKSSHHQYFCRDILNLNLADKSYDTVI
                     CLELIEHLPKDEGLNLILRLEKIARKRVILSTPVGFSRVEGNHNEDGSAHQCGYLPFE
                     LKEMGYLVRGNRLRLERVWWPYLLKRSAALASVYWAFWLAAGVVFSPLAYFFPDRIAS
                     GMVCLKEVGYERKSG"
     misc_feature    complement(140962..141303)
                     /locus_tag="DehaBAV1_0141"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    complement(141040..141291)
                     /locus_tag="DehaBAV1_0141"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(141094..141096,141142..141150,
                     141208..141213,141262..141282))
                     /locus_tag="DehaBAV1_0141"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(141402..142616)
                     /locus_tag="DehaBAV1_0142"
                     /db_xref="GeneID:5131498"
     CDS             complement(141402..142616)
                     /locus_tag="DehaBAV1_0142"
                     /note="PFAM: glycosyl transferase, group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001213611.1"
                     /db_xref="GI:147668793"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5131498"
                     /translation="MNILHLGSGSLQTPPVGYGGIERYVFESARGLAARGNRVVIFDI
                     RLDRADLVSEQTGGIEIIRLHCLVAHRSSSLWLSNIYSVLNLLGFSLRARRYINKNSF
                     EVIHIHRTLVGLVLVLVLPSQREKMIYTVHSPVWVMQRGSFKDRLSRKLDIFIMKRVH
                     RVIAQSARIKNILERERAAPGRIRLLPCGVDTSAFNPASRCSFICRKYGIDDRLLVLF
                     VGRIVPYKGVEYLVRAANLVVNKAGFRKCAFLLAGPMAEHGLDALEHAAYPKKVSSLI
                     AEYNLGDFVFLSGSLPQDDLQMVFASADIFVLPSLAESSPAVVLQALASGCAVVASDI
                     SGIHEQVVEGVNGYLVKAGDETELAKRILELLQSPARRSAMGANGRELVKKEFDWGVI
                     CGRLEGIYREAT"
     misc_feature    complement(141405..142580)
                     /locus_tag="DehaBAV1_0142"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(141414..142565)
                     /locus_tag="DehaBAV1_0142"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     gene            complement(142616..143470)
                     /locus_tag="DehaBAV1_0143"
                     /db_xref="GeneID:5132443"
     CDS             complement(142616..143470)
                     /locus_tag="DehaBAV1_0143"
                     /note="PFAM: glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001213612.1"
                     /db_xref="GI:147668794"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5132443"
                     /translation="MEDYVPLSVIVCARNAEKTIGSCLESIMQNSPAEIILVDGDSTD
                     KTVSLAAAFTQHILNDRGRGTSFAHQIGSEIAGYDYIMFVDADVELPPYALGQMFAEL
                     KKAKLDGIYARTEGAGQGNFWERAATDFLSCRPNPAGIWFGAALVSRDIVLKYGFDSF
                     ISPGDDVDFNRRALSGGCVFGVSAVRVKHHHRTTFKNVVHQYIWYGKGNSRLAWKNGL
                     LILRFWPPFPAVYGLLHSLGHFKFRPVSLHLLAFVFQSWGMVCGLTELIFNPPPDRPR
                     RPCWKCGI"
     misc_feature    complement(142853..143455)
                     /locus_tag="DehaBAV1_0143"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    complement(142790..143449)
                     /locus_tag="DehaBAV1_0143"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    complement(order(143192..143194,143198..143200,
                     143360..143362,143429..143431,143435..143437))
                     /locus_tag="DehaBAV1_0143"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(143472..145091)
                     /locus_tag="DehaBAV1_0144"
                     /db_xref="GeneID:5132275"
     CDS             complement(143472..145091)
                     /locus_tag="DehaBAV1_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213613.1"
                     /db_xref="GI:147668795"
                     /db_xref="GeneID:5132275"
                     /translation="MKNESALLASSKLFCILALVLWGLSLSGDGFNPDMGTMLKPPML
                     LFVSGLGFLCLGSVFLWKMRASQTRLLCLYTFIMLAMLWLSPVIMQSSPVSAQWAYGI
                     YYPNTQFISQTGGIDPAGYTFHNWPGFFILDYSLSAVAGTSCLDFMAFYGPFLMQVLI
                     LVPLYCLFKNIIPNPNHRFAAIWVFYLANWVAQLYFVPQGVGVFFLICLLAIITSPGF
                     SASEGNAVSHRVVIILVLAALTVSHLLTSIVALLCVGALTLSRLVKGFNLGILAGMLV
                     GCWTIYGAATQFDSQLPDFANRAFELENLFQFSSSSGGVDAGAAFLEISRARFIFSGL
                     FAGLAVLGVLLSLKYRNRFDFSLFALEGVAIVILCSMLYGSEFWTRAFLFSLVPIAYF
                     AVKLLRNRLSTLVMAAVLLVAIPGHLLAHYGAIPDMVSRFDLAAWQYLENYTLRGYIS
                     GGISYIKPDYLSLPLKKLDWQDGLLVSQGYTGRYPQYLQIGRSTGVGWVYYNGDSQYV
                     PALEAALEDSASYGLIYQNGEMNIYFNQGAN"
     sig_peptide     complement(145005..145091)
                     /locus_tag="DehaBAV1_0144"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.939) with cleavage site probability 0.581 at
                     residue 29"
     gene            complement(145088..146011)
                     /locus_tag="DehaBAV1_0145"
                     /db_xref="GeneID:5132283"
     CDS             complement(145088..146011)
                     /locus_tag="DehaBAV1_0145"
                     /note="PFAM: glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001213614.1"
                     /db_xref="GI:147668796"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5132283"
                     /translation="MEKIMSLSVVICTRNSASTIKACLDSLMPAYRSSLIREIIIVDA
                     CSTDATCRIAGNYPVRIYYEPGKGVYFGYQYGWGICSGEYVLFLDSDAYLEKISLVGV
                     LNMFSDPQVGLVGVYSFSPDGSRLGRCAGQWWDYHRNRLLPKARSSLFGRWYHRVVGF
                     GAEYTSGPCFMASRQCLEATGGFAPELYLYYLYPKLAYPGDIILSGRAIQAGYKAVWA
                     NDGRVGHSPPGDLPALWRQRANWGRGDAAYLDICRTGFSKRVTCVLSRLASPVMALYL
                     AVKYRNLLHLWYLPLAQLAWLGGYFNFRLKR"
     misc_feature    complement(145280..145999)
                     /locus_tag="DehaBAV1_0145"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    complement(145235..145990)
                     /locus_tag="DehaBAV1_0145"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    complement(order(145721..145723,145727..145729,
                     145889..145891,145970..145972,145976..145978))
                     /locus_tag="DehaBAV1_0145"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(146027..146677)
                     /locus_tag="DehaBAV1_0146"
                     /db_xref="GeneID:5132284"
     CDS             complement(146027..146677)
                     /locus_tag="DehaBAV1_0146"
                     /note="PFAM: sugar isomerase (SIS)"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar isomerase (SIS)"
                     /protein_id="YP_001213615.1"
                     /db_xref="GI:147668797"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="GeneID:5132284"
                     /translation="MIISKPSNPGSKENTPKTTDSKPEKDMDCLLRGYLGGLSHCLEE
                     LTAQDICGVAELIYQAYTRRRQIFIVGNGGSASTASHMARDLRIGTSLRGKPRLRTCS
                     LADNVAFITSLANDVNYESIFTEQLIGQIEPGDVLIAISCSGNSANVVRAAEYANECG
                     ASTVGLTGFGGGRLLEICDICVVLSSCDYGQVEDVHLSLGHIFSCMVKARIEKETV"
     misc_feature    complement(146120..>146626)
                     /locus_tag="DehaBAV1_0146"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    complement(146051..146578)
                     /locus_tag="DehaBAV1_0146"
                     /note="Phosphoheptose isomerase is a member of the SIS
                     (Sugar ISomerase) superfamily. Phosphoheptose isomerase
                     catalyzes the isomerization of sedoheptulose 7-phosphate
                     into D-glycero-D-mannoheptose 7-phosphate. This is the
                     first step of the biosynthesis of...; Region: SIS_GmhA;
                     cd05006"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(146051..146053,146063..146065,
                     146075..146077,146084..146086,146096..146101,
                     146435..146440,146456..146458,146516..146518,
                     146525..146527,146561..146563,146573..146575))
                     /locus_tag="DehaBAV1_0146"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(146099..146101,146111..146113,
                     146240..146242,146249..146257,146456..146464))
                     /locus_tag="DehaBAV1_0146"
                     /note="active site"
                     /db_xref="CDD:240139"
     gene            complement(146706..147683)
                     /locus_tag="DehaBAV1_0147"
                     /db_xref="GeneID:5132302"
     CDS             complement(146706..147683)
                     /locus_tag="DehaBAV1_0147"
                     /note="PFAM: GHMP kinase; GHMP kinase, C terminal domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GHMP kinase"
                     /protein_id="YP_001213616.1"
                     /db_xref="GI:147668798"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001174"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="GeneID:5132302"
                     /translation="MIISRTPFRISFAGGGTDLRAFYSLKAGEVVSTAINKYMYITVN
                     KRFDSTIRISYSSTEIVNTVEEICHPIVREALKLTGISGGIEIVSIADIPAGTGLGSS
                     STFTVGLLNALYAYQGKLLSAEELAKQACRIEIDCLKEPIGKQDQYIAAYGGMCHFRF
                     EPDEYVGVSPLPLKTELKANLSESLLLFYTGSSRQAGTILAEQQATTTRPDSFKNLTY
                     LTELAVSCRECLLDHAVPKDIGAILHKGWLAKKNLSRGISNPYIDKCYQSALNAGAYG
                     GKILGAGGGGFLLVCAPPDRHTAIRKALSDLPQVDFEFEPEGSKIIYVL"
     misc_feature    complement(146712..147683)
                     /locus_tag="DehaBAV1_0147"
                     /note="Predicted kinase related to galactokinase and
                     mevalonate kinase [General function prediction only];
                     Region: COG2605"
                     /db_xref="CDD:225325"
     misc_feature    complement(147222..147428)
                     /locus_tag="DehaBAV1_0147"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:249743"
     gene            complement(147680..148390)
                     /locus_tag="DehaBAV1_0148"
                     /db_xref="GeneID:5131408"
     CDS             complement(147680..148390)
                     /locus_tag="DehaBAV1_0148"
                     /note="PFAM: Nucleotidyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase"
                     /protein_id="YP_001213617.1"
                     /db_xref="GI:147668799"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="GeneID:5131408"
                     /translation="MQAVILCGGLATRLRPITENIPKCLLPMAGRPFLHHQFRLLKSQ
                     GFDRAVLCIGHLGEMVKDSFMQGDEYGLKLVYSQETEKLLGTAGALKKAEEYLEDEFF
                     VINGDTYLEMDYLHAWQTYTQSGRDALMAVYDNRNGRINARNDVALDENMLVRCYEKD
                     SHLPELKFVNAGALILKKSLFATLEEGKPYSLERAILPVLANTRRMLAYPVKQCFYDV
                     GTVEGIYTFCNYLENQTA"
     misc_feature    complement(<147725..148390)
                     /locus_tag="DehaBAV1_0148"
                     /note="Nucleoside-diphosphate-sugar pyrophosphorylase
                     involved in lipopolysaccharide biosynthesis/translation
                     initiation factor 2B, gamma/epsilon subunits
                     (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis,
                     outer membrane / Translation, ribosomal structure...;
                     Region: GCD1; COG1208"
                     /db_xref="CDD:224129"
     misc_feature    complement(147707..148384)
                     /locus_tag="DehaBAV1_0148"
                     /note="WcbM_like is a subfamily of nucleotidyl
                     transferases; Region: NTP_transferase_WcbM_like; cd06915"
                     /db_xref="CDD:133065"
     misc_feature    complement(order(148070..148072,148076..148078,
                     148235..148237,148367..148375))
                     /locus_tag="DehaBAV1_0148"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133065"
     misc_feature    complement(order(147734..147736,147740..147742,
                     148070..148072))
                     /locus_tag="DehaBAV1_0148"
                     /note="metal-binding site"
                     /db_xref="CDD:133065"
     misc_feature    complement(order(147734..147736,147740..147742,
                     148070..148072))
                     /locus_tag="DehaBAV1_0148"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133065"
     misc_feature    complement(148070..148072)
                     /locus_tag="DehaBAV1_0148"
                     /note="metal-binding site"
                     /db_xref="CDD:133065"
     misc_feature    complement(148070..148072)
                     /locus_tag="DehaBAV1_0148"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133065"
     gene            complement(148393..149334)
                     /locus_tag="DehaBAV1_0149"
                     /db_xref="GeneID:5131442"
     CDS             complement(148393..149334)
                     /locus_tag="DehaBAV1_0149"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; 3-beta
                     hydroxysteroid dehydrogenase/isomerase; polysaccharide
                     biosynthesis protein CapD; dTDP-4-dehydrorhamnose
                     reductase; NmrA family protein; Male sterility C-terminal
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_001213618.1"
                     /db_xref="GI:147668800"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="GeneID:5131442"
                     /translation="MPEVLITGGCGFIGSHLADALLGQGFKVRVLDNLSNGSLENLKV
                     CDHGDELTVINGNLTNTNLLDSAVKGCEAVFHLAAHANVQNSARDTSIDLENNTLATH
                     NLLESMRKNGVGRLMFASSAAVYGESGLTVLDEDYGPLLPISLYGASKLAGEGLVSAY
                     SHLYGLKATMFRFANVVGSRRRNGVIYDFVNRLKKDPAALSVLGDGSQSKPYLHVSDC
                     VAGILLGFEKSTKTLGLYNLGTPDSVSVRDIACMVASEMGLKNVCYSYEGGERGWRGD
                     APQVRFDISRICSLGFKPRFSSLQAVKLAIKETLKEI"
     misc_feature    complement(148405..149328)
                     /locus_tag="DehaBAV1_0149"
                     /note="UDP-glucose 4 epimerase, subgroup 2, extended (e)
                     SDRs; Region: UDP_G4E_2_SDR_e; cd05234"
                     /db_xref="CDD:187545"
     misc_feature    complement(148399..149325)
                     /locus_tag="DehaBAV1_0149"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(order(148807..148818,148885..148887,
                     148897..148899,148975..148980,149047..149049,
                     149098..149106,149158..149169,149224..149241,
                     149296..149307,149311..149313))
                     /locus_tag="DehaBAV1_0149"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187545"
     misc_feature    complement(order(148630..148632,148843..148851,
                     148855..148863,148870..148872,148879..148884,
                     148891..148893,148900..148911,148954..148956,
                     149017..149019,149029..149031,149038..149043,
                     149053..149055,149062..149067))
                     /locus_tag="DehaBAV1_0149"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187545"
     misc_feature    complement(order(148885..148887,148897..148899,
                     148972..148974,149044..149046))
                     /locus_tag="DehaBAV1_0149"
                     /note="active site"
                     /db_xref="CDD:187545"
     misc_feature    complement(order(148705..148707,148729..148731,
                     148768..148770,148810..148812,148897..148899,
                     148972..148974))
                     /locus_tag="DehaBAV1_0149"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187545"
     gene            complement(149327..150322)
                     /locus_tag="DehaBAV1_0150"
                     /db_xref="GeneID:5131729"
     CDS             complement(149327..150322)
                     /locus_tag="DehaBAV1_0150"
                     /note="PFAM: glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001213619.1"
                     /db_xref="GI:147668801"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5131729"
                     /translation="MADPFISVVVSAYSMERYSDLLSLIDSLKSQSYTNFEVILVIEK
                     SGQLFSCLNRCLAQHPHNRNFKLFFNEGIPGLASARNLGVAKSQGEIMAFIDDDAAAS
                     PEWLACIAQCFGGDKKIIGLTGPALPWWEHPGLSWFPSEFNWVISSMPCLPRSRGYIR
                     NAWGTNMAFRREAFEGGQGFNPELGAKGGGCHGKSELVGEDTEFCLRICRLSGLHILY
                     APEVKVMHRVYKYRLKPGFIAKRAYWEGYTKAVFKYRLSKETNLNGVLSEERGLLKRI
                     ILHLLPLSLLNLPLKPRQSALTILTTLNILGSAGWGYLRGAASARFIADKEAVNA"
     misc_feature    complement(149492..150313)
                     /locus_tag="DehaBAV1_0150"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(149573..150310)
                     /locus_tag="DehaBAV1_0150"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    complement(order(150011..150013,150017..150019,
                     150203..150205,150284..150286,150290..150292))
                     /locus_tag="DehaBAV1_0150"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(150315..151547)
                     /locus_tag="DehaBAV1_0151"
                     /db_xref="GeneID:5131746"
     CDS             complement(150315..151547)
                     /locus_tag="DehaBAV1_0151"
                     /note="TIGRFAM: histidinol-phosphate phosphatase family
                     protein; hydrolase, HAD-superfamily, subfamily IIIA;
                     PFAM: glycosyl transferase, family 2; Polynucleotide
                     kinase 3 phosphatase, central region"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate phosphatase family protein"
                     /protein_id="YP_001213620.1"
                     /db_xref="GI:147668802"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR006543"
                     /db_xref="InterPro:IPR006549"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="GeneID:5131746"
                     /translation="MEQKAIFIDRDGTIVEDVPYCNSPRRVRLLDGVGKAIKRLNDQR
                     YLVILITNQSGVARGYFSEETLGKIHNKLKEELDCFGARLDDIFYCPHHPGQGCTCRK
                     PATGLIDMAVEKYGIDIGRSYFIGDRFIDIQAANRAGCQAVLVPYAPPETDYFKQEVA
                     PDSRPSFLAADFTTAVDWVLADAAGKASVSVVIPTLNEEKNIGCVLPRLRCVPGITEV
                     ILVDGKSTDRTVEKALQLWPEIKVINQPGRGKGNAMRAGFEAATGDIVVTLDADGSLA
                     PEELPRYIGPLFEGYQMVKGSRFCRGGGTSDMPLFRRFGNFIFTKMANLVCGCHYTDL
                     VYGYHAFRRQILDSLCLRSDGFEIDTEMYIRAARIGLKVKEVPSYEARRLAGTGKLRS
                     FHDGARILRTILRENFHG"
     misc_feature    complement(151008..151547)
                     /locus_tag="DehaBAV1_0151"
                     /note="hypothetical protein; Validated; Region: PRK06769"
                     /db_xref="CDD:180686"
     misc_feature    complement(151113..151535)
                     /locus_tag="DehaBAV1_0151"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(151392..151397,151515..151523))
                     /locus_tag="DehaBAV1_0151"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(151506..151523)
                     /locus_tag="DehaBAV1_0151"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(151395..151397)
                     /locus_tag="DehaBAV1_0151"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(150384..150989)
                     /locus_tag="DehaBAV1_0151"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    complement(150450..150977)
                     /locus_tag="DehaBAV1_0151"
                     /note="DPM_DPG-synthase_like is a member of the
                     Glycosyltransferase 2 superfamily; Region:
                     DPM_DPG-synthase_like; cd04179"
                     /db_xref="CDD:133022"
     misc_feature    complement(order(150732..150734,150960..150962,
                     150966..150968))
                     /locus_tag="DehaBAV1_0151"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(order(150732..150737,150879..150881))
                     /locus_tag="DehaBAV1_0151"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133022"
     misc_feature    complement(150732..150740)
                     /locus_tag="DehaBAV1_0151"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133022"
     gene            151751..152758
                     /locus_tag="DehaBAV1_0152"
                     /db_xref="GeneID:5131703"
     CDS             151751..152758
                     /locus_tag="DehaBAV1_0152"
                     /note="PFAM: glycosyl transferase, group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001213621.1"
                     /db_xref="GI:147668803"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5131703"
                     /translation="MIKICLIGDFKVCPDRSIYKMAAQLADFLSKEKDILLLLCPREH
                     FTRPRSLNRIRRFQPDIIHLLGKPDAAELFRLKMAKLSAPRAKTVISAQQPVNTRTVR
                     NMLPYIKPDMAICLSQKSASFFREAGIETVILPNGVDMATFQPVSPEIKAELRRRYCL
                     PHNKLLLLHVGPIRAGRGVDLLRRMQNPDTQVIMAVSNPGIFNRTLLENLRKSGCMIL
                     TSFRPNIADLYALADAYVYPMLLEEDANHQIFSSEMPLSVLEAMSANLPVITTPFGAL
                     PEVFPAGEGLYYAHDDFEFLKAFQAYTQNPPANTRHKVAACAWPLIITSLKELYTKLL
                     A"
     misc_feature    151871..152755
                     /locus_tag="DehaBAV1_0152"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    151871..152626
                     /locus_tag="DehaBAV1_0152"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(152771..153682)
                     /locus_tag="DehaBAV1_0153"
                     /db_xref="GeneID:5131736"
     CDS             complement(152771..153682)
                     /locus_tag="DehaBAV1_0153"
                     /note="PFAM: Protein of unknown function DUF1616"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213622.1"
                     /db_xref="GI:147668804"
                     /db_xref="InterPro:IPR011674"
                     /db_xref="GeneID:5131736"
                     /translation="MNFLRRYDLYLVLLFIVLAVLAAEGGWVLPLRLLFGVPLVLIVP
                     GYALMSVLYPSRLSLSRSGRFMMGLGLSLSVSILAGLALNYTVGLEQASVLYALSGFS
                     LVFCLIAIGRRQHLPPNEKPGLILTPPDTKRHLPPNTSQIFLNVILSVCLLGVGGVAA
                     KQLLQVYSPSEFTRFYLLGLNDTAENFPSLFILNGEQVAGVKYGNQPAVVAVSARFKL
                     VISNSGQSEMVYQVEALLNGQNYRFSLKEGGEFDGLVKVPVDTIKSLELYFAPFEAGD
                     NQVLEIWLYAGETAVFTKPLKIVFSTV"
     sig_peptide     complement(153614..153682)
                     /locus_tag="DehaBAV1_0153"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.986) with cleavage site probability 0.904 at
                     residue 23"
     misc_feature    complement(152777..153658)
                     /locus_tag="DehaBAV1_0153"
                     /note="Protein of unknown function (DUF1616); Region:
                     DUF1616; pfam07760"
                     /db_xref="CDD:254412"
     gene            complement(153774..154277)
                     /locus_tag="DehaBAV1_0154"
                     /db_xref="GeneID:5131623"
     CDS             complement(153774..154277)
                     /locus_tag="DehaBAV1_0154"
                     /note="PFAM: Rubredoxin-type Fe(Cys)4 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rubredoxin-type Fe(Cys)4 protein"
                     /protein_id="YP_001213623.1"
                     /db_xref="GI:147668805"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="GeneID:5131623"
                     /translation="MSSKLPEPSEGPVLFQARLKNEAEASGYHLNPDGSFVKMLAEGL
                     LANRQRYGYPSCPCRLAKGDKKADLDIICPCDYRDADLSEFGSCYCALYVNSHIAKGE
                     KKAQAVPERRHLPETRPETKPAEAPSGLAYPVWRCRVCGYLCGRDEAPDECPICKADK
                     ERFERFM"
     misc_feature    complement(153942..154226)
                     /locus_tag="DehaBAV1_0154"
                     /note="Ferredoxin thioredoxin reductase catalytic beta
                     chain; Region: FeThRed_B; cl01977"
                     /db_xref="CDD:242814"
     misc_feature    complement(153783..153884)
                     /locus_tag="DehaBAV1_0154"
                     /note="Rubredoxin [Energy production and conversion];
                     Region: COG1773"
                     /db_xref="CDD:224687"
     misc_feature    complement(153780..153881)
                     /locus_tag="DehaBAV1_0154"
                     /note="Rubredoxin, Small Modular nonheme iron binding
                     domain containing a [Fe(SCys)4] center, present in
                     rubrerythrin and nigerythrin and detected either N- or
                     C-terminal to such proteins as flavin reductase,
                     NAD(P)H-nitrite reductase, and...; Region: rubredoxin_SM;
                     cd00729"
                     /db_xref="CDD:238371"
     misc_feature    complement(order(153810..153812,153819..153821,
                     153858..153860,153867..153869))
                     /locus_tag="DehaBAV1_0154"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238371"
     gene            complement(154274..154549)
                     /locus_tag="DehaBAV1_0155"
                     /db_xref="GeneID:5132042"
     CDS             complement(154274..154549)
                     /locus_tag="DehaBAV1_0155"
                     /note="PFAM: glutaredoxin; Glutathione S-transferase,
                     N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="YP_001213624.1"
                     /db_xref="GI:147668806"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="GeneID:5132042"
                     /translation="MEKIIGRNAGKIKLYALSTCGWCRLTRQLLAELGVAYEFEYVDL
                     LTGAEREKAVKELTALNPSSSFPTMVIGENRVIIGYKESEIREALKA"
     misc_feature    complement(154283..154519)
                     /locus_tag="DehaBAV1_0155"
                     /note="NrdH-redoxin (NrdH) family; NrdH is a small
                     monomeric protein with a conserved redox active CXXC motif
                     within a TRX fold, characterized by a glutaredoxin
                     (GRX)-like sequence and TRX-like activity profile. In
                     vitro, it displays protein disulfide reductase...; Region:
                     NrdH; cd02976"
                     /db_xref="CDD:239274"
     misc_feature    complement(<154319..154516)
                     /locus_tag="DehaBAV1_0155"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    complement(order(154481..154483,154490..154492))
                     /locus_tag="DehaBAV1_0155"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239274"
     gene            complement(154740..155126)
                     /locus_tag="DehaBAV1_0156"
                     /db_xref="GeneID:5131402"
     CDS             complement(154740..155126)
                     /locus_tag="DehaBAV1_0156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213625.1"
                     /db_xref="GI:147668807"
                     /db_xref="GeneID:5131402"
                     /translation="MNIRVIVIGFQSRFFGVCDAASVTERNVVSMQMLLNQDIINKCV
                     CHKCPVQNQSECVHTQMAELKNSLKETPLDPHKIPKAYCVNGKSLCKGIDHSKPCICG
                     SCDVYAKYHLSEGEPGGFYCFEGKSV"
     misc_feature    complement(154761..154907)
                     /locus_tag="DehaBAV1_0156"
                     /note="Protein of unknown function (DUF2769); Region:
                     DUF2769; pfam10967"
                     /db_xref="CDD:151414"
     gene            complement(155284..155814)
                     /locus_tag="DehaBAV1_0157"
                     /db_xref="GeneID:5131410"
     CDS             complement(155284..155814)
                     /locus_tag="DehaBAV1_0157"
                     /note="PFAM: protein of unknown function UPF0157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213626.1"
                     /db_xref="GI:147668808"
                     /db_xref="InterPro:IPR007344"
                     /db_xref="GeneID:5131410"
                     /translation="MVRRVTVEEYNPCWAEQYDAEAVRLQALLADNLLEIHHIGSTAV
                     PGLSAKPIIDIMPVVKDISAIDRLQKTFERAGYLYLGEYGISGRRFLVRGTDKIRFAH
                     VHIFGVSSSDIERHLAFRDYLRCHAAEAAEYSCIKKALALKFPEDIEAYINDKSGFVR
                     DLETKALKWFRANLQT"
     misc_feature    complement(155317..155808)
                     /locus_tag="DehaBAV1_0157"
                     /note="GrpB protein; Region: GrpB; pfam04229"
                     /db_xref="CDD:252465"
     gene            complement(155818..157125)
                     /locus_tag="DehaBAV1_0158"
                     /db_xref="GeneID:5131432"
     CDS             complement(155818..157125)
                     /locus_tag="DehaBAV1_0158"
                     /note="PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein; HI0933 family protein; FAD
                     dependent oxidoreductase; FAD-dependent pyridine
                     nucleotide-disulphide oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213627.1"
                     /db_xref="GI:147668809"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5131432"
                     /translation="MTVKEIVVIGAGAGGLVAAGRAAECGGKVILLEKSEQPGKKMLI
                     SGQGRCNISNSRDMAEFITAFGPNGRFLYSAFSRFFRQELVELLARYGVETKTERGGR
                     LFPDSDKAGDVVGALMKYASAATLIAGQKVSQILVNDGQVVGVKTEKETFRADAAVIA
                     TGGASYPGTGSSGDGFRMAEALGHTIVKLRPALVPLVVKEIALVQSMQGVALKNIRLT
                     SYRCEADKIPLDLILQDWGRGITGKKPPKAVIESRMGELMITHFGLGGPLTMLMGLPV
                     AEALEQGAVSVAIDLKPALSLDKLRLRLQRDFDTFGKRSFQNLLSELLPQKMIRPFVD
                     LTGIDPFKCGGQITASEREVILANLKCLRFNITSTLPLTSAVVTAGGVNLKEIDPRTM
                     ESKLIKGLYFCGEVMDIDADTGGYNLQAAFSSGYLAGESAAGA"
     misc_feature    complement(155824..157050)
                     /locus_tag="DehaBAV1_0158"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(155833..157050)
                     /locus_tag="DehaBAV1_0158"
                     /note="HI0933-like protein; Region: HI0933_like;
                     pfam03486"
                     /db_xref="CDD:251995"
     gene            157300..159741
                     /locus_tag="DehaBAV1_0159"
                     /db_xref="GeneID:5132037"
     CDS             157300..159741
                     /locus_tag="DehaBAV1_0159"
                     /EC_number="6.1.1.4"
                     /note="TIGRFAM: leucyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="YP_001213628.1"
                     /db_xref="GI:147668810"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="GeneID:5132037"
                     /translation="MAEKYNPQETEKKWQDKWAADRLYHASEDSPKPKWYSLTMFPYT
                     SGNLHIGHWYAEVPADCFARYKRLRGFNVMRPVGFDSFGLPAENAAIKHNIHPRIWTL
                     NNVENMRRQLKTIGAMFDWDREVITCLPEYYKWTQWFFLKLYEAGLAYRAKAPVNWCP
                     SCQAVLANEQVVDGTCWRCETPTTRRDLEQWFFRITNYADELKDHEGLDWPEKITAMQ
                     RNWVGKSYGAEVSFALDCPTAFEKEIKVFTTRPDTIYGVTFMVLAPEHPLVEKITTPE
                     NKAAVDAYIKKSRTCTEIERLSTEREKDGVFTGTYVTNRVNGQKVPVWIGDYVLQSYG
                     TGAVMGVPAHDERDFVFAQKYHLPVITVIAPSAYDGKPLEAAYINEGVMLNSGPFNGT
                     PNTEGKEKVCDYLAEHGWGKKTVNYKLRDWLISRQRYWGAPIPMVYCEKCGIVPVPEK
                     DLPVLLPEDVGFRSGGESPLKYNEGFVNTICPVCGGKAKRETDTMDTFMCSSWYFLRY
                     TSPGYDKGPFDPVKLKYWMPVDLYTGGAEHAVMHLFYSRFFTKALRDMGIIDFGEPFK
                     KLFNQGIIVSNHQKMSKSKGNVVTPDNLVAEVGTDAVRAYLMFVGPWDQGGEWNDSGL
                     SGMSRWLNRVWNLFTEEYTPQTASAEAERELKRTLHQTIKKITMDIERLRFNTVVAAL
                     MELSNSLAKLKETAAISAENWQNTLQTFALMLAPVAPHIAEELWANLGMKYSIHNQNW
                     PTWDEELAKDEVITLIIQVNGKLRERLEMPAGISEAEAKETALNSERVKPHLLGKTPV
                     TVIYVPGKLVNIVVK"
     misc_feature    157300..159738
                     /locus_tag="DehaBAV1_0159"
                     /note="leucyl-tRNA synthetase; Validated; Region: leuS;
                     PRK00390"
                     /db_xref="CDD:234743"
     misc_feature    157399..159156
                     /locus_tag="DehaBAV1_0159"
                     /note="catalytic core domain of leucyl-tRNA synthetases;
                     Region: LeuRS_core; cd00812"
                     /db_xref="CDD:173906"
     misc_feature    order(157420..157422,157426..157428,157444..157446,
                     157453..157455,157537..157539,157561..157563,
                     158902..158904,158908..158913,158923..158925,
                     159010..159012,159019..159021,159040..159042,
                     159046..159048)
                     /locus_tag="DehaBAV1_0159"
                     /note="active site"
                     /db_xref="CDD:173906"
     misc_feature    157444..157455
                     /locus_tag="DehaBAV1_0159"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    157954..158517
                     /locus_tag="DehaBAV1_0159"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:257918"
     misc_feature    159037..159051
                     /locus_tag="DehaBAV1_0159"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    159154..159486
                     /locus_tag="DehaBAV1_0159"
                     /note="Anticodon-binding domain of bacterial and
                     eukaryotic mitochondrial leucyl tRNA synthetases; Region:
                     Anticodon_Ia_Leu_BEm; cd07958"
                     /db_xref="CDD:153412"
     misc_feature    order(159163..159165,159172..159177,159184..159186,
                     159196..159198,159325..159327,159337..159339,
                     159346..159351,159358..159360,159367..159369,
                     159379..159381)
                     /locus_tag="DehaBAV1_0159"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153412"
     gene            159743..160546
                     /locus_tag="DehaBAV1_0160"
                     /db_xref="GeneID:5132291"
     CDS             159743..160546
                     /locus_tag="DehaBAV1_0160"
                     /EC_number="1.5.1.2"
                     /note="TIGRFAM: pyrroline-5-carboxylate reductase;
                     PFAM: NADP oxidoreductase, coenzyme F420-dependent;
                     6-phosphogluconate dehydrogenase, NAD-binding;
                     NAD-dependent glycerol-3-phosphate dehydrogenase domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="YP_001213629.1"
                     /db_xref="GI:147668811"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="GeneID:5132291"
                     /translation="MNIAFIGGGNMGEAILGALIQKNICPPQNITVSEIKAERRTYLE
                     TSYGIKTTASNPDAIKSAEVVLLAIKPQNLPELSAELKGKLADKQLVISIIAGATLSK
                     LSGGLAHKAVVRVMPNTPAMIGMGMSVWTALPSVSPAQKDQAKAILSAMGKEIYTGKE
                     TMLDAATAISGSGPAYFFLFMEGLEKAALEMGFTPEEASILVSQTAAGSAIYAGKSGF
                     ALTQLRKNVTSPGGTTAEAIKAFEEAGLEATIIKAAKAAFNRSVELGKG"
     misc_feature    159743..160540
                     /locus_tag="DehaBAV1_0160"
                     /note="pyrroline-5-carboxylate reductase; Reviewed;
                     Region: PRK11880"
                     /db_xref="CDD:237008"
     misc_feature    159746..160033
                     /locus_tag="DehaBAV1_0160"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; pfam03807"
                     /db_xref="CDD:252177"
     misc_feature    160217..160534
                     /locus_tag="DehaBAV1_0160"
                     /note="Pyrroline-5-carboxylate reductase dimerization;
                     Region: P5CR_dimer; pfam14748"
                     /db_xref="CDD:258885"
     gene            160640..161128
                     /locus_tag="DehaBAV1_0161"
                     /db_xref="GeneID:5132234"
     CDS             160640..161128
                     /locus_tag="DehaBAV1_0161"
                     /note="PFAM: Colicin V production protein"
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V production protein"
                     /protein_id="YP_001213630.1"
                     /db_xref="GI:147668812"
                     /db_xref="InterPro:IPR003825"
                     /db_xref="GeneID:5132234"
                     /translation="MNWLDIVLLISLGIQTVSGFFTGLIRNFLHLVGLIIGIILAGRF
                     YPTVAEWLSFISSPEWANIVAFLLILMTIWVATTLIAKLLDTMIKPTFLNWVNRLGGA
                     IFGLLVSGIFTAALLAIWVKFFDSGSVITDSAVAQILLDKFPLILSLLPDEFGVIQDF
                     FN"
     misc_feature    160649..161008
                     /locus_tag="DehaBAV1_0161"
                     /note="Colicin V production protein; Region: Colicin_V;
                     pfam02674"
                     /db_xref="CDD:251465"
     gene            complement(161239..161493)
                     /locus_tag="DehaBAV1_0162"
                     /db_xref="GeneID:5132397"
     CDS             complement(161239..161493)
                     /locus_tag="DehaBAV1_0162"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_001213631.1"
                     /db_xref="GI:147668813"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:5132397"
                     /translation="MSFKITDDCISCGACEPECPNKAISEGETIYIIDPEKCSECVGA
                     FDTPQCVEICPVDSCVKCCNESNDELLAKWQKQHPGESPK"
     misc_feature    complement(161323..161469)
                     /locus_tag="DehaBAV1_0162"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     gene            complement(161582..162061)
                     /gene="coaD"
                     /locus_tag="DehaBAV1_0163"
                     /db_xref="GeneID:5132277"
     CDS             complement(161582..162061)
                     /gene="coaD"
                     /locus_tag="DehaBAV1_0163"
                     /EC_number="2.7.7.3"
                     /note="Catalyzes the conversion of ATP and pantetheine
                     4'-phosphate to diphosphate and 3'-dephospho-coA"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="YP_001213632.1"
                     /db_xref="GI:147668814"
                     /db_xref="InterPro:IPR001980"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="GeneID:5132277"
                     /translation="MIAIYPGRFDPVTLGHLSVARRASGFCDRLIIAVFDNPAKPGLF
                     TAAERVDFIKQSIKDLPNVEVRSFSGLMVNFARKMGASLIIRGLRVGADFEREMEMYV
                     MNRRLDEGIELCCLFSEPQYQYLSASLIKEIVILGGDSSGLISEHVAVALKNKLASV"
     misc_feature    complement(161600..162058)
                     /gene="coaD"
                     /locus_tag="DehaBAV1_0163"
                     /note="Phosphopantetheine adenylyltransferase; Region:
                     PPAT; cd02163"
                     /db_xref="CDD:173914"
     misc_feature    complement(order(161687..161689,161696..161698,
                     161708..161710,161750..161752,161762..161764,
                     161771..161776,161795..161797,161801..161806,
                     161846..161854,161942..161944,161957..161959,
                     162005..162007,162014..162019,162035..162049))
                     /gene="coaD"
                     /locus_tag="DehaBAV1_0163"
                     /note="active site"
                     /db_xref="CDD:173914"
     misc_feature    complement(162014..162025)
                     /gene="coaD"
                     /locus_tag="DehaBAV1_0163"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:173914"
     gene            complement(162033..162611)
                     /locus_tag="DehaBAV1_0164"
                     /db_xref="GeneID:5132320"
     CDS             complement(162033..162611)
                     /locus_tag="DehaBAV1_0164"
                     /note="TIGRFAM: putative methyltransferase;
                     PFAM: conserved hypothetical protein 95"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="YP_001213633.1"
                     /db_xref="GI:147668815"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004398"
                     /db_xref="GeneID:5132320"
                     /translation="MRIIAGDAKGKNIIVPQRKATRPATELVRGAMMSMLEAVAEDWS
                     EVLDIYSGSGSLGLEALSRGAGHVDFVEHERCCCDIIKQNLETIGCASHAHVYCLDVP
                     KAMAFLKKQYDVILADPPYRNQQIGEVLEKLGNSGLIGENTVMAVTHSAHLTLAECYG
                     RLKMLKEHRHGDSLITIYRKDSSFDSHLPGPV"
     misc_feature    complement(162195..162476)
                     /locus_tag="DehaBAV1_0164"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(162258..162260,162309..162317,
                     162372..162377,162447..162467))
                     /locus_tag="DehaBAV1_0164"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            162990..165971
                     /locus_tag="DehaBAV1_0165"
                     /db_xref="GeneID:5131575"
     CDS             162990..165971
                     /locus_tag="DehaBAV1_0165"
                     /EC_number="1.2.1.2"
                     /note="TIGRFAM: formate dehydrogenase, alpha subunit;
                     PFAM: molybdopterin oxidoreductase; molydopterin
                     dinucleotide-binding region; molybdopterin oxidoreductase
                     Fe4S4 region"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase alpha subunit"
                     /protein_id="YP_001213634.1"
                     /db_xref="GI:147668816"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR006443"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="GeneID:5131575"
                     /translation="MRSQFSRRDFLKISGGTAGLFATAGLFRGPIKGVEPKMVDTRPR
                     WVKETTTICPFDASGCGFICYTDSAGNLTNMEGDPDNPVNRGSACSKGASLIQLHNNK
                     HRLEKVLYRAAGANDWEEKSWDWAFGEIAKKVKASRDSGFVAKNAAGKTVNRTEAIAS
                     LGGATLDNEECYLLSKMLRALGIVYLDSQARLSTASSLEALAASFGRNAMTNSWTDVS
                     NANVILDMGGNPAENYPACFSHLGEAMGKGAELISVDCRLTRTAAKAGTFVAARSGSE
                     IAFIGGLIKYVISDIEAHPANYNLTYITEYTTASMVVNSNFKGPADLDGMFVGYNTAS
                     HSYDQSNWNFTKASNGEPVIDKTLTNPNCVFQLLKKQYARYTPEMVSATCGCSQADFA
                     KVCASFAATGKADKAGAIVYAMSSTQHTSGAQTVRAYAVLQMLLANIGVSGGGLFALG
                     GESNVQGAADNGVSWNKLPGYLSAPNEDDTTFAAYASKAGDQSAASLLKAWYGSNASS
                     SNGFGFGFLPKTDNNTNYSYINAIKQMAAGKIKGAFAWGANPVVESAAAGQATQALAK
                     LDWLVVTDMFESETAAFWKKDGVTSQTEVFLLPTACSYEKEGSVTNADRWIQWRNKAV
                     SASGEAKSELEVISSLLSRLQTLYQGESGLNAEAITKLSWTYSTNPSAADVAKEMNGY
                     KISSLQQLESPEDLRADGTVACGNSLYIGSFTNAGNQMARREQTGAFHAGWAWSWPMN
                     TRIMNNRASVDLSGKPFNAAKPVISWNGISWTGDNVDGKNAPFNQSGGLPFKGTNGNT
                     AQLFAAMADGPMPEHYEPWESPVDNALSGTQNNPTAMVFEGDTQGSAGEYPVICTTIR
                     TVEHSLGGQLTRNMPFLVELAPAAYVEISEQLASEKGIKAGDIVKLTSARGSVSVAAA
                     VTKRLKPFSIGGKTVHQVAIPNHWGFMGIAQGDSANVLAPNTADSNSSTPEFKAFLVK
                     VEKAADGTVPTITGRYKVLED"
     misc_feature    162999..165914
                     /locus_tag="DehaBAV1_0165"
                     /note="formate dehydrogenase, alpha subunit,
                     proteobacterial-type; Region: formate-DH-alph; TIGR01553"
                     /db_xref="CDD:233466"
     misc_feature    163137..165494
                     /locus_tag="DehaBAV1_0165"
                     /note="Formate dehydrogenase N, alpha subunit
                     (Formate-Dh-Na) is a major component of nitrate
                     respiration in bacteria such as in the E. coli formate
                     dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that
                     is a complex of three different subunits and is the...;
                     Region: MopB_Formate-Dh-Na-like; cd02752"
                     /db_xref="CDD:239153"
     misc_feature    order(163146..163148,163152..163157,163167..163169,
                     163254..163256,163692..163697)
                     /locus_tag="DehaBAV1_0165"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239153"
     misc_feature    order(163260..163262,163554..163556,163566..163568,
                     163668..163670,163674..163676,163683..163688,
                     163752..163760,163809..163811,163815..163817,
                     164226..164234,164241..164246,164340..164345,
                     164628..164636,164646..164648,164706..164714,
                     164721..164723,164790..164792,164886..164888)
                     /locus_tag="DehaBAV1_0165"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239153"
     misc_feature    165528..165914
                     /locus_tag="DehaBAV1_0165"
                     /note="Formate dehydrogenase N, alpha subunit
                     (Formate-Dh-Na) is a major component of nitrate
                     respiration in bacteria such as in the E. coli formate
                     dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that
                     is a complex of three different subunits and is the...;
                     Region: MopB_CT_Formate-Dh-Na-like; cd02792"
                     /db_xref="CDD:239193"
     misc_feature    order(165549..165563,165567..165578,165795..165797,
                     165837..165839,165885..165890)
                     /locus_tag="DehaBAV1_0165"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239193"
     gene            166059..167270
                     /locus_tag="DehaBAV1_0166"
                     /db_xref="GeneID:5131481"
     CDS             166059..167270
                     /locus_tag="DehaBAV1_0166"
                     /note="PFAM: Polysulphide reductase, NrfD"
                     /codon_start=1
                     /transl_table=11
                     /product="polysulfide reductase NrfD"
                     /protein_id="YP_001213635.1"
                     /db_xref="GI:147668817"
                     /db_xref="InterPro:IPR005614"
                     /db_xref="GeneID:5131481"
                     /translation="MFSAIKGWVNKLEQTGNPNVPLFGKWGLLQIILGLGALTVAALK
                     LAYGLGPITNLSDNWPWGLWVAFDVGAYIASAAGGFTMAAIVYIFGYEKFRPLVRPAI
                     LIGALCYTIGAIGIMIDLARSIRIVHPIWMWNHESIMFEVGWCVMMYLTVLYLEFSNN
                     IFERIGWKKLGNLQHAFIIPLVIFGIMLSFLHQSSLGALFLINPAQQPLWHGPLMGHL
                     FLVSAMALGLSVLTYFSVILSRSWKMTLRMDILSKLGLIIAWIMLVYLAARGVDYAIT
                     GNLATGLNGDWYTVLWVAEVGIGMLLPMILLFIKKIRSSRSGLLWSTGLMIMGVVLNR
                     INTLVISQAPNREGSYFPHILEFVFTFGLIAGAMYVFRLCAKYLPLYTDHMKGLTPEQ
                     VKKAPAVIPAD"
     misc_feature    166140..167195
                     /locus_tag="DehaBAV1_0166"
                     /note="Polysulphide reductase [Energy production and
                     conversion]; Region: COG5557; cl17901"
                     /db_xref="CDD:248455"
     gene            167271..168119
                     /locus_tag="DehaBAV1_0167"
                     /db_xref="GeneID:5131537"
     CDS             167271..168119
                     /locus_tag="DehaBAV1_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213636.1"
                     /db_xref="GI:147668818"
                     /db_xref="GeneID:5131537"
                     /translation="MNTNRLERINSEIERYRAAQPELETILALYQKVFDIQESASSQE
                     EPAPLISDEDAIAKLAAGEYILKDIPFEPSAELFHQTGLKLGRAFTQTAGEKFPTPAL
                     LKLIESHPGGLSGFITAMLSDNLDYLAKFTQNTSFNPETLLFFVTNLVSPFLTAQAKY
                     YQPQVDLLGWDKNTCPFCGSSPRYSCLAKDNGARRLFCSLCHTQWNYRRIKCAYCSNA
                     NAEKLRHFYSAIFPYQRVDVCEKCKTYIKTTDERRLGRECLPEVEDAVSIHLDSIAQN
                     EGYQPG"
     misc_feature    167304..168116
                     /locus_tag="DehaBAV1_0167"
                     /note="Protein involved in formate dehydrogenase
                     formation; Region: FdhE; cl19312"
                     /db_xref="CDD:267665"
     gene            complement(168301..169266)
                     /locus_tag="DehaBAV1_0168"
                     /db_xref="GeneID:5131567"
     CDS             complement(168301..169266)
                     /locus_tag="DehaBAV1_0168"
                     /note="PFAM: Integral membrane protein TerC"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein TerC"
                     /protein_id="YP_001213637.1"
                     /db_xref="GI:147668819"
                     /db_xref="InterPro:IPR005496"
                     /db_xref="GeneID:5131567"
                     /translation="MSLTVLWVIFAVMVLCMMALDLGVFHRRAHEVKTKEALVWSGVW
                     IALALIFGGLVYSSLGSETGLNYLSGYIIELSLSVDNLFVFIMIFSYFCIKREYQHKV
                     LFWGILGAIIMRAVFIAAGITLIENLSWVLYIFGVFLIYTGIKMVKDQNKEIHPDKNP
                     LVNFVCRILPMTNKLHGDHFFIKENGRKLATPLILVLVSIEAMDLVFAVDSIPAVMAI
                     TLDPFIIFTSNIFAVMGLRAMYMALSGVIQKLHYLHYGLAAILAFLGIKMLISDFFHM
                     PVTASLGVVAVILAISIAASLLKPPKEIKPVEVPHPACPVDEGDK"
     misc_feature    complement(168361..169257)
                     /locus_tag="DehaBAV1_0168"
                     /note="integral membrane protein, TerC family; Region:
                     R_switched_Alx; TIGR03718"
                     /db_xref="CDD:234327"
     gene            complement(169433..171118)
                     /locus_tag="DehaBAV1_0169"
                     /db_xref="GeneID:5131494"
     CDS             complement(169433..171118)
                     /locus_tag="DehaBAV1_0169"
                     /note="PFAM: helicase domain protein; DEAD/DEAH box
                     helicase domain protein;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="YP_001213638.1"
                     /db_xref="GI:147668820"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5131494"
                     /translation="MSFESFNFDPAVMAGVRACGYKEPTPIQAQAIPPIMAGHDVIGL
                     AQTGTGKTAAYALPIIQKMLSTPRGRVRTLVIAPTRELACQISDSFRSLGQRARIREC
                     SIYGGVNMDQQIRRLRSGVDVVVACPGRLLDHIWRGTIDVCGVETLIIDEADRMFDMG
                     FQPDIQSILKCLVQPHQTLLFSATMPPEVRKLTLETQTNPVTVQVGTQSPVSSVSHSV
                     YPVKSHQKTPLLLEILKTVETKSVLIFARTKYGAENLADEISKAGFTTASLQGNLSQN
                     RRHAVMEGFRRGNFKILVATDIAARGLDIDHISHVINYDMPDSPEDYTHRIGRTGRFD
                     RTGQAFSLVTGRDGDMVRDIQRLLSSPIQRLRVDGFDYATTRNDGQNQSQRRDFAPRR
                     GYSHGGYNRPEMAVNETSQTDTPSEMPVSPARPFNPGFRPSRPANSAPRFHREGNFAP
                     RMQSHSSFEGTSAPAARPAARYNDRPAFRKENSFQTTEASRPSFRKETGFTPREHTQA
                     DFENSEQPSGRRPARFNGKASFADRPARSGNKVGKPPFFRRSKPAVSEKNETY"
     misc_feature    complement(169796..171118)
                     /locus_tag="DehaBAV1_0169"
                     /note="ATP-dependent RNA helicase RhlE; Provisional;
                     Region: PRK10590"
                     /db_xref="CDD:236722"
     misc_feature    complement(170510..171112)
                     /locus_tag="DehaBAV1_0169"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    complement(170963..170977)
                     /locus_tag="DehaBAV1_0169"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(170657..170668)
                     /locus_tag="DehaBAV1_0169"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(170567..170575)
                     /locus_tag="DehaBAV1_0169"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(170093..170455)
                     /locus_tag="DehaBAV1_0169"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(170225..170233,170306..170311,
                     170369..170380))
                     /locus_tag="DehaBAV1_0169"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(170123..170125,170132..170134,
                     170144..170146,170207..170209))
                     /locus_tag="DehaBAV1_0169"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            171591..172550
                     /locus_tag="DehaBAV1_0170"
                     /db_xref="GeneID:5131493"
     CDS             171591..172550
                     /locus_tag="DehaBAV1_0170"
                     /note="PFAM: Integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001213639.1"
                     /db_xref="GI:147668821"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:5131493"
                     /translation="MMKGILPIECKYCGSRHTRRYGHSRAQKQRWLCNDCCHTFVETS
                     AQPGMRTPPEQIGAAVSMFYEGLSLSAICRQMKQIHNISPSDGTVYGWITKYSKEAIA
                     RAKDIKPKVGDVWLCDETVLKIAGKNIWFYDIIDMKTRFLLASHLSDKRYLGDARTVL
                     HRAGIKAGKSPKVVITDSLNSYPQAIGDVFGADVRHIKYKGITKSPNNNILERFHGTL
                     KARTKVMRGLKSMETARLFTDGWLVFYNFMRPHESLDNQTPAHRAKVQLLNQTWHEVV
                     KTSEFKAEPVKWLEKPPSFLKQSIPSSVKRAIGLGNKLPRGLR"
     misc_feature    <171603..171926
                     /locus_tag="DehaBAV1_0170"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3677"
                     /db_xref="CDD:226202"
     misc_feature    171609..>171701
                     /locus_tag="DehaBAV1_0170"
                     /note="Cleavage inducing molecular chaperone; Region:
                     Jiv90; pfam14901"
                     /db_xref="CDD:259038"
     misc_feature    171915..172253
                     /locus_tag="DehaBAV1_0170"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    171924..172343
                     /locus_tag="DehaBAV1_0170"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     misc_feature    172203..172367
                     /locus_tag="DehaBAV1_0170"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            172547..172819
                     /locus_tag="DehaBAV1_0171"
                     /db_xref="GeneID:5131563"
     CDS             172547..172819
                     /locus_tag="DehaBAV1_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213640.1"
                     /db_xref="GI:147668822"
                     /db_xref="GeneID:5131563"
                     /translation="MIKITLKEYYFSVFSCEIGSFLAIKLFIDEDDLIPKIALIILAL
                     LSISAFVMLIRKGGINKRQYNHGERKETKYPEPDAINGKFRNNKEE"
     gene            complement(173038..173325)
                     /locus_tag="DehaBAV1_0172"
                     /db_xref="GeneID:5132322"
     CDS             complement(173038..173325)
                     /locus_tag="DehaBAV1_0172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213641.1"
                     /db_xref="GI:147668823"
                     /db_xref="GeneID:5132322"
                     /translation="MTGIVFLFGLLIGILGTWLWYTAKERSIKLAWVDYLLIAIFVLM
                     AGGGIWFVNTFTEESVASAARSSGLIFGLLALLVLGVTWQLIRRRNHKSGI"
     gene            complement(173374..174741)
                     /locus_tag="DehaBAV1_0173"
                     /db_xref="GeneID:5132211"
     CDS             complement(173374..174741)
                     /locus_tag="DehaBAV1_0173"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213642.1"
                     /db_xref="GI:147668824"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5132211"
                     /translation="MDEKINRRDFVKGAGLASAATVATLMATASTVSAEELVNPGGKA
                     MDEMGNASIKRDLPESFYKRIENKAGYIGTTRVVAPTQRLDAREHGFSQIVRRGSTGD
                     WSGEPGDWGPILLAAVQEKKKHAAEISPLEAADYTWSNAFQIAMDRWHITLEPGRYQQ
                     APIAATKVELSPEEMTARIKKICRWFGCEQVGICEVTEDMKPFFYSVGRTRGTYTTGH
                     ANYVDNGREIPWPYPYKYCIVMADKCDTDTLNALTGPLVEASAKIACSQSDFAPHYLE
                     SIIRSLGHDAKANIFSDTDIMDTPFAVKAGLGELGRSGLVISPWGAQMRIMEVFTNLP
                     LVPDKPIDFGLQEFCKVCKKCADNCPASAISMDDEPSEVDTVVKSIRWFQDGKKCLAQ
                     RLAYGCSKCQGVCPWSKPDTLIHEVGRMVGQNPAFAPFLVKLDDFFYNRYPEGHATGE
                     WAPWR"
     sig_peptide     complement(174637..174741)
                     /locus_tag="DehaBAV1_0173"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.961 at
                     residue 35"
     misc_feature    complement(<174622..174726)
                     /locus_tag="DehaBAV1_0173"
                     /note="formate dehydrogenase region TAT target; Region:
                     formate_TAT; TIGR02811"
                     /db_xref="CDD:234021"
     misc_feature    complement(173428..174231)
                     /locus_tag="DehaBAV1_0173"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(173737..>174231)
                     /locus_tag="DehaBAV1_0173"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(173518..173700)
                     /locus_tag="DehaBAV1_0173"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            174984..175583
                     /locus_tag="DehaBAV1_0174"
                     /db_xref="GeneID:5132308"
     CDS             174984..175583
                     /locus_tag="DehaBAV1_0174"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213643.1"
                     /db_xref="GI:147668825"
                     /db_xref="GeneID:5132308"
                     /translation="MVHQNLLSETSMITRTQSAELEKAISGILPSETAKLIDLVDQMF
                     DDYIRGAIHHNEIRRLIGIIQNKAGKAQTMPRSCAPIAIFNPISFIPPGITLLEAYLK
                     LNGFVPVVLGLDEQTIKKMAGQIHPTVVVSLTLFHHIDKLAKLKPCFEAAGLNVLAGG
                     VPFMYQNQNKDKLSFCSFPDSFKQIVCKLSEDLLNENRK"
     gene            175567..177360
                     /locus_tag="DehaBAV1_0175"
                     /db_xref="GeneID:5131079"
     CDS             175567..177360
                     /locus_tag="DehaBAV1_0175"
                     /note="PFAM: ATP-binding region, ATPase domain protein;
                     histidine kinase A domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001213644.1"
                     /db_xref="GI:147668826"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:5131079"
                     /translation="MKTENNKVGVVTCVSMSNFVKNWALHRNLDARIYPITNSCFYSV
                     KIEMLSYYIERAILENGYCILNYGMCNESITQLKNHYAGRLSVVELDNCYEAAIGTAI
                     YHERIEQGHIFRNPTTMSCWHNMPTLEVMQPVEAGIYPAPITFILENGEEEKAASYVN
                     NLKNTTILDYSVEILHPQPHFLEDKLDQAYAQIQLASDEEDETSHQLIFPFSFHNSDE
                     YLYILDKHDNVIFSPYVAPATPNQICEKLLQLILSRQPDRSFQVKGLDSLLKQRGLYL
                     DKCKRFANRSSLTTEYEIIQNGESTWIKEILWVSYDDNCSISNICGRMEDITKVKTSE
                     KSIAESYTKECLLRQALQDETKKRQAHLKALVHEIRTPLTPLLAASDALVNVSEKGTE
                     LYNLASSIREGAETLNSRIHDLIELERGKIGMLKLKMAGYSIEDIMEELQLRYMPIFL
                     KQHKSLVFCDETANSEIYCDKERLLQILTNLIDNALKYTKPEDSVSVATRLDNESLRF
                     TVSDSGAGVPACLIPDLFTEYGKLSGGHNLSGLGLGLPIAKLYVEAHGGNIIYSPREP
                     KGSEFSFTIPVKTVSRNERDNIRIANEYFNS"
     misc_feature    176632..176823
                     /locus_tag="DehaBAV1_0175"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(176647..176649,176659..176661,176671..176673,
                     176680..176682,176692..176694,176701..176703,
                     176752..176754,176764..176766,176773..176775,
                     176785..176787,176794..176796,176806..176808)
                     /locus_tag="DehaBAV1_0175"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    176665..176667
                     /locus_tag="DehaBAV1_0175"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    176986..177291
                     /locus_tag="DehaBAV1_0175"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(177004..177006,177016..177018,177025..177027,
                     177094..177096,177100..177102,177106..177108,
                     177112..177117,177190..177201,177247..177249,
                     177253..177255,177268..177273,177277..177279)
                     /locus_tag="DehaBAV1_0175"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    177016..177018
                     /locus_tag="DehaBAV1_0175"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(177106..177108,177112..177114,177190..177192,
                     177196..177198)
                     /locus_tag="DehaBAV1_0175"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            177341..178021
                     /locus_tag="DehaBAV1_0176"
                     /db_xref="GeneID:5132091"
     CDS             177341..178021
                     /locus_tag="DehaBAV1_0176"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001213645.1"
                     /db_xref="GI:147668827"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5132091"
                     /translation="MNILIVEDNDAAASTISSILKLSYHDAKITICRTGYEALESINS
                     DKADLVMLDLGLPDMNGLKVLDEIRPITGAPIIVVTACEEEENVLKALEQGADEYIIK
                     PFRHLEFLARVKKALSKNISPNTAIIKFGDLTIDCAKHELTFRNDRVLLTRVETMIMS
                     LLLQRGGQIVDYRDISDTLWGHAYPGSDESIRVYVSRLRIKMEKNLKTGGIIKNEAGI
                     GYRLSFAE"
     misc_feature    177341..178006
                     /locus_tag="DehaBAV1_0176"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    177350..177691
                     /locus_tag="DehaBAV1_0176"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(177359..177364,177497..177499,177521..177523,
                     177578..177580,177635..177637,177644..177649)
                     /locus_tag="DehaBAV1_0176"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    177497..177499
                     /locus_tag="DehaBAV1_0176"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(177506..177511,177515..177523)
                     /locus_tag="DehaBAV1_0176"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    177644..177652
                     /locus_tag="DehaBAV1_0176"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    177722..178006
                     /locus_tag="DehaBAV1_0176"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(177794..177796,177851..177856,177908..177910,
                     177917..177919,177941..177946,177980..177982,
                     177995..177997)
                     /locus_tag="DehaBAV1_0176"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(178952..179650)
                     /locus_tag="DehaBAV1_0177"
                     /db_xref="GeneID:5132076"
     CDS             complement(178952..179650)
                     /locus_tag="DehaBAV1_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213646.1"
                     /db_xref="GI:147668828"
                     /db_xref="GeneID:5132076"
                     /translation="MGAFSINGTSLVTSSTGTSLGSTKYYPYGLTRSGSIPTDEKFTG
                     QKLDDTGLYYYNARYYDPTIGRFISPDTLVQNIHNPQCLNRYSYVLNNPLKYIDPSGH
                     RMVIPGNPPQNGIPFPGPEDPGGSSGNGSSDDSDDSDSNSGSFFETDGDNTAPPRMNA
                     VDAIVGTTILAAGAMMAVTGAIVFLAVFIPGGALAAPEVGLGFWTIGGLLISEGVKRL
                     FHIEYFYIPGLIGP"
     misc_feature    complement(179345..179578)
                     /locus_tag="DehaBAV1_0177"
                     /note="RHS repeat-associated core domain; Region:
                     Rhs_assc_core; TIGR03696"
                     /db_xref="CDD:234316"
     misc_feature    complement(<179054..>179173)
                     /locus_tag="DehaBAV1_0177"
                     /note="FIG, FBPase/IMPase/glpX-like domain. A superfamily
                     of metal-dependent phosphatases with various substrates.
                     Fructose-1,6-bisphospatase (both the major and the
                     glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate
                     to fructose-6-phosphate in...; Region: FIG; cl00289"
                     /db_xref="CDD:260329"
     gene            complement(179904..181679)
                     /locus_tag="DehaBAV1_0178"
                     /db_xref="GeneID:5132075"
     CDS             complement(179904..181679)
                     /locus_tag="DehaBAV1_0178"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213647.1"
                     /db_xref="GI:147668829"
                     /db_xref="GeneID:5132075"
                     /translation="MNKILDALNKVLSQFDQETKTISERDVPKAIRSIGDSADPSDIP
                     MQFTAEAMAFDFCEDYHDQVTGWGTYYGPMMVFNNGDGTATEAPSITRITEEIISYWS
                     DRSKTAKHPILRTRYADLVWDFQKRITGQAPHYSMAQIVIDSTIEIAQRNCHSVKVDV
                     IKRLERALSIAIALNDDDRLQRVADATIAYEDAVTDDSKPGLWGFAWDMLFDNDKVKL
                     TADQRQKLIGDLEGHLQRASNTTDEGDIDPWLVEAAALRLAKYYRKTGRGEDTKRVII
                     AIGEAFGQASSKGSGLQASAWLQRVHSTFKEFGLTDEAEKVAIQLREVGEKAKSELKS
                     FSYTMEVPKEKLEQYIAALTEGELDVALKRITAHFIPKKSEVEKQLKELASKAPVAFL
                     IPHELQDDMGRPLAKVGSLEEDLLGHTVKQMSQNMGIESIFLRQALEALVKKYPAFEN
                     LCLDYLFRSPIFKDDRKPIIQQGLKEYIDGHHMEAVHLLIPQIENALRVLVETAGGSI
                     LKPARGGGFHLKVLDDLLREPIVTQVFGEDMVFYFCTLLVDQRGWNLRNCVCHGLCDA
                     SEFGPRMSDRIMHVLLCLALVRKKE"
     misc_feature    complement(179925..180215)
                     /locus_tag="DehaBAV1_0178"
                     /note="Domain of unknown function (DUF4209); Region:
                     DUF4209; pfam13910"
                     /db_xref="CDD:258176"
     gene            complement(181715..182533)
                     /locus_tag="DehaBAV1_0179"
                     /db_xref="GeneID:5132161"
     CDS             complement(181715..182533)
                     /locus_tag="DehaBAV1_0179"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213648.1"
                     /db_xref="GI:147668830"
                     /db_xref="GeneID:5132161"
                     /translation="MDWNFLTGLGTLILAIATILYVTQSRLQTQVLMKQVNLQIGQQI
                     PRLFIRQVTFEANSLKMEIQNAGSTPAYWVGLETRFFVIGQRLYSDQHSDNEINWGEA
                     VKLHEQGNTIYSKYFWTGPTKLRFENKEVDADTAVSFLSPQGVSVYFPPNSVVLTETR
                     PMFLVSWKGDQGLPASKGFEYNEFREFLLSNNIRAVAVVMSLMCKDAGETVHGQGYVA
                     SFVVRTDLDHSLVESSKNSHRFDFIPLSHEEQLSGNSWTRYDDYRNTFSNWHVF"
     gene            complement(182628..183593)
                     /locus_tag="DehaBAV1_0180"
                     /db_xref="GeneID:5132156"
     CDS             complement(182628..183593)
                     /locus_tag="DehaBAV1_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213649.1"
                     /db_xref="GI:147668831"
                     /db_xref="GeneID:5132156"
                     /translation="MTTSFKNVLILRTLISLCKNDRKLPHVFYDLGYTQIRIDKTIRL
                     PDNKTVEPDLIMSSRQQNHSIVWESKSGRNIENDQARKLAQVTENIFTEQLLFNLRTD
                     GSFVFDVAYACDDGQCQNIRIDLNRLSNGHSTVGEFPIVGFSQDRVIKHSGQFKHSTI
                     ESVFNAGISVDLNEIPVAYLPFDKDCSLSEIAPFVIRSLVSYVTSQEGNFSSEQIAKE
                     SYGSGWEYIASNRTKNELVHKVEEILVEGTRNELRGYLSKTGRGKTRSPKWRLSYANV
                     KGGAYPAGRLKKLQRRCKEFVNRLRIEESGVKQLRLPLFLEDEPI"
     gene            complement(183577..184734)
                     /locus_tag="DehaBAV1_0181"
                     /db_xref="GeneID:5132160"
     CDS             complement(183577..184734)
                     /locus_tag="DehaBAV1_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213650.1"
                     /db_xref="GI:147668832"
                     /db_xref="GeneID:5132160"
                     /translation="MIKAELRRTRLDMASYLQEKMRTGYERYLDEQKLEWEGGLLKTY
                     LVEADVITRPSDSHNQIFSFLQKQTAALNYTAEQLDEENFFALIARSRVSRQAKSDIF
                     YIDASDYRFWITYSIGHSSRTDRFIDKFVSHSPKLDNAWFPMQFLSKLADTKGIFTGL
                     GGRFNNSPFTKDEEEQLRISLKLWGNLAKDVFDAFQKSDMLKRAFSLSNVRLKRYLQN
                     TDESVTDDINYSGKITSMGQSFDSHLDLVNSIYREEYRNTLVGIIEKELAIGFDTDSS
                     GGFLKGEPIFVSFQKTIPNVEKFVKDLFSGTSPFRLWGLQEMVKKDFARIYAVDMHLG
                     RPLTFEVFPDTIRIFLHSGTCGNSIIRFFTLFQHHYDSSAELSGGKHDHLF"
     gene            complement(184727..187846)
                     /locus_tag="DehaBAV1_0182"
                     /db_xref="GeneID:5132068"
     CDS             complement(184727..187846)
                     /locus_tag="DehaBAV1_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213651.1"
                     /db_xref="GI:147668833"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="REBASE:DspBAVORF182P"
                     /db_xref="GeneID:5132068"
                     /translation="MNEERLSRLIEEFTSKNLNLFFRGKCENFAETPEDLRRYDDDRF
                     SDFQKLGEIRFDSDDKLVITSSLASGDLSERSGKKAQYEKAKKILKELAVYDAGFFIF
                     YDRSGSFRFSLVYAQFQGTKRSFSNFRRFTYFVSKDQTNKTFRIRVGGCTFSSLEAVM
                     DAFSVEKVNKEFYNHIARFFYRLTGYDRKREMTLPSVSDDDKETYQEFAVRLIGRAIF
                     CWFLKHKKSTNGVSLIPESMLSSESVKQNEQYYHSTLEKLFFEVLNTPLEQRHKNILP
                     DADKIPFLNGGLFEPHTNDFYSGKPLYNLVIPDQWFEEFFEILEQYNFTIDENSTVDA
                     DVSVDPEMLGRIFENLLAEVNPDTGETARKATGSYYTPRIIVDYMVDQSLKQYLLSKT
                     KIDEDRITALLSYEAPESALNEREKASIISALDEIKIIDPACGSGAFPMGILHKMILV
                     LQKADPDLKLWLKNHLGNIEPGIFKDRLIERIRNENWEYVRKLLIIQKSIYGVDIQTI
                     AVEISKLRFFLSLIVDEQIDDLKSNRGVEALPNLEFKFVAADSLIGLPPVMNRQVGLG
                     IVNEEVVRLKELRSKYLRSYGTEKKQIERDFLETRGKLIEQNINWGNKDALALQLVNW
                     NPFTNEASEWFDPDWMFGEDRFDIVIANPPWGVDLSKETKLLLKERIPEIDSSTPNSF
                     AYFVGMANRISKLNVAFILPDSILIKDYAKTRKLIAPKLLSLDWYQNTSVPENFRPFI
                     YVEHDVCVIIFNNENKEDIRCCKHEYDSQAKSVVHNEWAAQKSEMIFPEYDYVFNLML
                     EEKDRLIHEKLLKYKTIDSFAQCHEGIHTGNSRDILFVKGRKNGYCKPLFYGGRAGDF
                     IANYVSKTSGWYVDYREELIDKDRGYYASLRDENIFKYPKIYITRTGNPFKCFYDENT
                     YASNNFFSLQFKTKSENTKENLLVLLAIINSKLTQYFIRTFPAPRLGDTYIETKIIHL
                     LKVRAPNMSKELKDDFLPLIYQILAKRESNIEADISILETKINHMVYELYGLTPEEKA
                     VVEGRAQDD"
     misc_feature    complement(184931..185248)
                     /locus_tag="DehaBAV1_0182"
                     /note="TaqI-like C-terminal specificity domain; Region:
                     TaqI_C; pfam12950"
                     /db_xref="CDD:257424"
     gene            complement(187849..191217)
                     /locus_tag="DehaBAV1_0183"
                     /db_xref="GeneID:5132422"
     CDS             complement(187849..191217)
                     /locus_tag="DehaBAV1_0183"
                     /note="PFAM: helicase domain protein; type III restriction
                     enzyme, res subunit;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase domain-containing protein"
                     /protein_id="YP_001213652.1"
                     /db_xref="GI:147668834"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5132422"
                     /translation="MSTDTTFITNEGNKKLKDRIAELIAHSKELKFLVGFFYFSGIRE
                     LYTSLKNNPNIQLDVLVGLNVDKTVHGLTEYGDTTKGLTDKEKFEQFLGSISKSINSD
                     DFDNQVFYDQARFFLEAIKQDKLRIRKTYDPNHAKLYIFKLKDELATIKKAFFITGSS
                     NLTKAGLSHQNEFNVEISDYGAKEAEDYFDELWEEAVKVTEIASFKDRLINLLEKKTL
                     LTEVTPYEAFALVLKTYIELQEQKQIKQSLVDLLKKKGYRAYKYQTDAVAQAISILDQ
                     YKGVIVADVVGLGKSIIAGLIAKSLGKRGIILCPPGLIGDDNAASGWRKYREDFALHD
                     WEIRSSGLENLKKALDLVRSNPEYEVVIIDEVHRFRNQDTEAYEVLSNICRDKLVIML
                     TATPFNNTPADILSLLKLFIVPGKSNITLANDLTARFRSYTQTFRRLSNIRKNCNSPS
                     LPKRNQAIADYEVMFGANKIDLNNVRDRTRYLSKSIRNVISQVTIRRNRIDLRKDPEY
                     SKEIYELSDVQDPCEIFYELTPEQSEFYDRVLQDYFGERGQFTGAIYQPFLYETGQLE
                     PDEETLNQAENRESLIQRNLYDFMRRLLVKRFESSFGSFRQSIINFKSVTEKVQTFIE
                     NSNGKYILDRPLLEKIYEADIDEIEEELAGFEQRISEGTFPKTEKVYKVNDFISKDKF
                     NTDIQSDIDLFDQILDELDSLKLVNKDPKLKKLATEVKNILKKKDNPEEPERKIVIFT
                     EYIDTARYLEAYLEKEFPSCCITVKGDLNKTKSDEVLRNFDTTHKKPEDSYKILITTD
                     KMSEGFNLNRAGAVINYDIPWNPTRVIQRVGRINRISKRVFKNLYIYNFFPTLQGATY
                     VKSREIATEKMFLIHNTLGEDAKIFEPDEEPSASQLFKRIMENPDNMEEESFQTKIRQ
                     LYADIVVSSPEVIKRISELPPRIKVAKNFNENNLVLFIKKGLGLFTRGILSDDKKPQD
                     LVFENTLELIECKKEEKAIPFSDSFWDSYYNVKEFKETSGPPSSEISIEKKALNNVNT
                     LLQGKIPELESYLPFLRELREDILEYKTLSDYTLRRIANLNSLNKDNAKIQKTKDELE
                     KLQQELGADYLDKVKSKLGQLQTEVIIAIENVKE"
     misc_feature    complement(190630..191199)
                     /locus_tag="DehaBAV1_0183"
                     /note="N-terminal putative catalytic domain of
                     uncharacterized HKD family nucleases fused to putative
                     helicases from the Snf2-like family; Region:
                     PLDc_N_Snf2_like; cd09178"
                     /db_xref="CDD:197275"
     misc_feature    complement(190639..>190923)
                     /locus_tag="DehaBAV1_0183"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    complement(order(190687..190689,190693..190695,
                     190699..190713,190735..190737,190741..190743,
                     190747..190749,190804..190821))
                     /locus_tag="DehaBAV1_0183"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197275"
     misc_feature    complement(order(190702..190704,190735..190737,
                     190741..190743,190807..190809,190813..190815))
                     /locus_tag="DehaBAV1_0183"
                     /note="putative active site [active]"
                     /db_xref="CDD:197275"
     misc_feature    complement(190813..190815)
                     /locus_tag="DehaBAV1_0183"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197275"
     misc_feature    complement(189979..190467)
                     /locus_tag="DehaBAV1_0183"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    complement(190030..190386)
                     /locus_tag="DehaBAV1_0183"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(190345..190359)
                     /locus_tag="DehaBAV1_0183"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(190117..190128)
                     /locus_tag="DehaBAV1_0183"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(188707..189123)
                     /locus_tag="DehaBAV1_0183"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(188821..188829,188920..188925,
                     188986..188997))
                     /locus_tag="DehaBAV1_0183"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(188719..188721,188728..188730,
                     188740..188742,188803..188805))
                     /locus_tag="DehaBAV1_0183"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(191300..191470)
                     /locus_tag="DehaBAV1_0184"
                     /pseudo
                     /db_xref="GeneID:5132140"
     gene            complement(191603..192088)
                     /locus_tag="DehaBAV1_0185"
                     /db_xref="GeneID:5132314"
     CDS             complement(191603..192088)
                     /locus_tag="DehaBAV1_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213653.1"
                     /db_xref="GI:147668835"
                     /db_xref="GeneID:5132314"
                     /translation="MSKNINTMIDDLVGTLTDPIIVYPGGWGDSLPEWLKNAITLERL
                     TENMKGSKGEQPSGTDAEACAYLNTASLTMPMDSDWSQIYLYVAGKTYTRWRKGEMPK
                     DIRVDSLNNQQMADLNRLKEWLYCRRTTAKQELERAERRQQKEEEVAKRESEQPALFE
                     F"
     misc_feature    complement(<191618..191749)
                     /locus_tag="DehaBAV1_0185"
                     /note="Chain length determinant protein; Region: Wzz;
                     cl19730"
                     /db_xref="CDD:268083"
     gene            complement(192130..192447)
                     /locus_tag="DehaBAV1_0186"
                     /db_xref="GeneID:5132105"
     CDS             complement(192130..192447)
                     /locus_tag="DehaBAV1_0186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213654.1"
                     /db_xref="GI:147668836"
                     /db_xref="GeneID:5132105"
                     /translation="MNSLFVINAAFNTGQIVATRGVFDLACENPEFAQFIQKSLNRHV
                     KGDWGDVDDEDKQTNDQALKQGTRLLSAYNDERFPKNGVATIWIITEADRSATTILFP
                     DEY"
     gene            complement(192501..192983)
                     /locus_tag="DehaBAV1_0187"
                     /db_xref="GeneID:5132213"
     CDS             complement(192501..192983)
                     /locus_tag="DehaBAV1_0187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213655.1"
                     /db_xref="GI:147668837"
                     /db_xref="GeneID:5132213"
                     /translation="MATGQMDLFDGVKLAEPEPTTTVRLGRKAAQIPLRKKRREAIKR
                     LMEILEELEGKDIYIGSYDAGGRHFWLDNLKLPRLQMEWHPMRLKSDQTYIPSVIVLW
                     GSKSAAVRIFTDYLVAVREQEYQGYWHYLLDFRNGFWQSPIDNFRSHYSCLHITRFKD
                     "
     gene            complement(193972..195231)
                     /locus_tag="DehaBAV1_0188"
                     /db_xref="GeneID:5132387"
     CDS             complement(193972..195231)
                     /locus_tag="DehaBAV1_0188"
                     /note="PFAM: DNA polymerase III, beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III beta subunit family protein"
                     /protein_id="YP_001213656.1"
                     /db_xref="GI:147668838"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:5132387"
                     /translation="MNIEGKRSGEGFCAHKTILVNALSRALAERVVLMDFTIGRKGFL
                     TYIKSLGGSNVVKVVPSSNGDASGLRVADKRLKVVCGANTSYLDDMAWVGEKTPLTLC
                     DVRVSPSNAVKPNLGALELSEALSRVVPFTAKEDNRPVLQSVLFKVADGKLTMVSADG
                     YRLAMVKLDFDGDEGQVLINRDELRGVISALRRAYRVRVGFEKSGESLDGMSLVLDTE
                     LIRYKWRGADGNFPEYEKLIPANFNTFVSFDTNEAIRAVSSLKVLSDSKAYPIDLTIG
                     NGKLTMSSPDDKGMAEIPADTQGDGKIRLDGSYLADALRACGGMVELKLVDSKSPMLF
                     TSPDYELVVMPMFAGESQTPKGEAQTAEPVEVETEPAEDTEPTEPEAEMVSEAEKANA
                     VAEAEAITKAEKPKRKRSKAKEPVAVA"
     misc_feature    complement(194194..>194874)
                     /locus_tag="DehaBAV1_0188"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    complement(order(194194..194202,194314..194316,
                     194743..194754,194758..194760))
                     /locus_tag="DehaBAV1_0188"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    complement(order(194194..194202,194305..194307,
                     194416..194418,194521..194523,194749..194754,
                     194758..194760))
                     /locus_tag="DehaBAV1_0188"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            complement(195367..195978)
                     /locus_tag="DehaBAV1_0189"
                     /db_xref="GeneID:5132215"
     CDS             complement(195367..195978)
                     /locus_tag="DehaBAV1_0189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213657.1"
                     /db_xref="GI:147668839"
                     /db_xref="GeneID:5132215"
                     /translation="MVTLCCPQDDNPLSYDRLNGEWAQWFRTAQRFEHKVPAQDRGDI
                     RHSIILELALTRARNGNKSFSEAMMCRIASCVVALYWRKQYKLTNGLDCGSCSQKQRA
                     KCKAGYLYGECPKAIKIEYLSKPITDGDGNVTEFGNTIADDKAIDVGAWIDARTFLLS
                     FPNRLVEIAYKRLEGTPLDKKDQKYLERFRRHEQIRLLQYVAN"
     gene            196354..197508
                     /locus_tag="DehaBAV1_0190"
                     /db_xref="GeneID:5132221"
     CDS             196354..197508
                     /locus_tag="DehaBAV1_0190"
                     /note="PFAM: filamentation induced by cAMP protein Fic"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentation induced by cAMP protein fic"
                     /protein_id="YP_001213658.1"
                     /db_xref="GI:147668840"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="GeneID:5132221"
                     /translation="MDTALFKNSPSGKLVRAAGGYWAFVPNSLPSTIEWDTALVSQVS
                     RADLAVGTLSGLGETLPNPHLLIYPFIRREAVLSSRIEGTQSSLSDLLLFEATQIEKQ
                     RDVREVQNYVRAMEYGLKRLNELPLSLRFIRELHGILMEGVRGEHATRGEFRQSQNWI
                     GSAGATLNEATFVPPPVPEMLECLNQLEKFLHADTELPPIVQAAMVHYQFETVHPFLD
                     GNGRIGRLLVTLLLCQKNVLAKPLLYLSAFFEQHRQEYYELLLKVSQRGAWREWIEFF
                     LKAVTEQADDAVSRSRRLLDLLHQYSQMAREKRLSPTAGQLVELIFMKPVLNAKTAQE
                     FLKVSYPSAQYALSSLEEAGILTEITGRKRDKAYSAKDVLKALDGETTRE"
     misc_feature    196423..197463
                     /locus_tag="DehaBAV1_0190"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    196468..196716
                     /locus_tag="DehaBAV1_0190"
                     /note="Fic/DOC family N-terminal; Region: Fic_N;
                     pfam13784"
                     /db_xref="CDD:258068"
     misc_feature    196729..197049
                     /locus_tag="DehaBAV1_0190"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     misc_feature    197296..197457
                     /locus_tag="DehaBAV1_0190"
                     /note="HTH DNA binding domain; Region: HTH_13; pfam11972"
                     /db_xref="CDD:152407"
     gene            197565..199514
                     /locus_tag="DehaBAV1_0191"
                     /db_xref="GeneID:5131738"
     CDS             197565..199514
                     /locus_tag="DehaBAV1_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213659.1"
                     /db_xref="GI:147668841"
                     /db_xref="GeneID:5131738"
                     /translation="MSKKQNKGKENKHILEDMGNSMSVESLFSTYVLLDTFLSSGLMS
                     KAKSFDTKMKGRHAREAFRQGYKLLLIASLDNYIDEIIRSPELIGIDPDLDYRDYWAF
                     TKGRGREITRAVARPGHHISKFVGRASSYIDEILTLDTWEGIEAFGERTKSFRDCLRL
                     ISEKAYVVSRGGRKVDVRNAILEASSTILWSNSGNPLPIAHMYTDYFIGRKNDEVGIH
                     DLDEIVRECESSPGMTRLDFSRVDPTFFPRPLPAQWALGYAFILHESLKMLTPDNKHV
                     ASLKSLDEFVLNTKNWDDIEKYDKKLETVYGLPKIFRGYGYAMHHIITDDDRQALIAD
                     VEGPSSPERLLSIFGNRARIVERGSPGAFGSFECLLDGALKRSARTKEKAKVAIIVHK
                     NYREQEDYSTAIFMPAYGGGWISTNASMWWVFYLIGNNHSGGASYRWKLVFNKIKRNR
                     RAIDLTVIYAGEEEFYKYCEDPGYLRLNNAVVLTNRVANDVRGAFPELLLANMLTNMG
                     CRIVRIGFEPKLLKPLKGELDVLGVKYANDSPQRILLFESKGQATVDDELQKEINRFS
                     KNVETVKENLESFCSELELPHSDGVEIEATFVSMDTLEYVTNIEVPSNVKLWNFNDLV
                     SSLKRNKIPPKYLELLKMNRVAVSM"
     gene            199571..201061
                     /locus_tag="DehaBAV1_0192"
                     /db_xref="GeneID:5132242"
     CDS             199571..201061
                     /locus_tag="DehaBAV1_0192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213660.1"
                     /db_xref="GI:147668842"
                     /db_xref="GeneID:5132242"
                     /translation="MEHFVIVPYLKTSETVTIRGIQFRSSLDLTSVPVSAQQHLTTLF
                     PMFFLKDDLHIKQMSYAYLKVDNEKDLERLKKRLSEVHHLLAFLYSSPHPTLLDPFLK
                     EEHATLYTFIPEPVSQFLIYPEDRNLECVSPEYPYPKPDDRHEMSGYTGTLNSESIIW
                     VTRGSRIYPPSGRFWLNLSQDLYADLLRGSSSSHGSGAWSLLKASEPKFGPIEDRIFT
                     ALNWYNRSNSICSSDEAALLHLAIAFESLLSLEQAPQITQRFKDSVRLLVGPVPKLEN
                     WADQFYNARSRIVHKGCGADLAFYALGTGSKVSAQYRSLISLGRSIFRICLNAAVAGA
                     DMACKTGLASLLITNQERFENICKTLSSVKPGASDALISLNKEITDIDEYKFVPEDNL
                     RIDTIIAANRLAAQYFIGKNPNVSQELITLFSDLANAASSADHFLELQAVSKIADYIG
                     AYNAPQYTSPVNDTDLIFSLTRSVHHYAFMHYYSLKEQREKNQNAK"
     gene            complement(201126..201662)
                     /locus_tag="DehaBAV1_0193"
                     /db_xref="GeneID:5132208"
     CDS             complement(201126..201662)
                     /locus_tag="DehaBAV1_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213661.1"
                     /db_xref="GI:147668843"
                     /db_xref="GeneID:5132208"
                     /translation="MVIRLAPTRGGFLRPFGCGWFIREYLLGNGPEGSRKVDPRRGAP
                     QADINFEYKEALARATARERAERIISNMVVKHADVTEAEAEKIYQRELKRVSRKFTHM
                     RYHSFLMYFGVLKRLGWVEVTNRTEASTIQDNYPSAPERTYYRLTKKGIDAGEDLWSN
                     PLFTLYPEIGSSHMKKVE"
     gene            complement(201666..203210)
                     /locus_tag="DehaBAV1_0194"
                     /db_xref="GeneID:5132235"
     CDS             complement(201666..203210)
                     /locus_tag="DehaBAV1_0194"
                     /note="PFAM: protein of unknown function DUF192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213662.1"
                     /db_xref="GI:147668844"
                     /db_xref="InterPro:IPR003795"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:5132235"
                     /translation="MAGQVKITIEDKEWLASLSSTYWELVQGLGDIPGMDAGTGMLFD
                     LSYTQYITVTTEPMLFPLDIAFLSEDLVITEIYHNVEPGYLVHATMPSRYFIEVNAGE
                     MEGIEIGEQVSIELLALQDIPTEPDWVSAMISFTGFTLMGFLIVGMVKDMVRKMSDES
                     TKTLPARSYATTPVYNRVSKSVSSGECAFCANSGHQCNVCEKISPRDYHLLSWVGAPV
                     PDYSFTVEPETKERKIDDVLKRLKEGVDGIQQSENFRTFLLTMSKFHEYSIGNLILIM
                     LQKPDATRVAGYSTWKDLYRWVKKGEKGIAILAPCMPPKKKELEPSESVNAPDAKEKQ
                     EEETEIRPIYFKVVYVFDVSQTEGKPLPEFEVPPLTGDANEDLFERVMHLAELQGLDV
                     SFEPKPDQDPDIKGFYTGKTIWVRPEESRAQQLKTLLHEVAHYYSEGVFRIPRSDAET
                     IAESVAFTIGAHYGFDTGARSFPYVAIWSKDKKVLEANLAAIRKVSEKIFDGLEQTTK
                     KPVGVA"
     misc_feature    complement(202866..203150)
                     /locus_tag="DehaBAV1_0194"
                     /note="Uncharacterized ACR, COG1430; Region: DUF192;
                     pfam02643"
                     /db_xref="CDD:251443"
     misc_feature    complement(<201903..202058)
                     /locus_tag="DehaBAV1_0194"
                     /note="Domain of unknown function (DUF955); Region:
                     DUF955; cl01076"
                     /db_xref="CDD:260778"
     gene            complement(203508..204203)
                     /locus_tag="DehaBAV1_0195"
                     /db_xref="GeneID:5132241"
     CDS             complement(203508..204203)
                     /locus_tag="DehaBAV1_0195"
                     /note="PFAM: phage integrase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="YP_001213663.1"
                     /db_xref="GI:147668845"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="GeneID:5132241"
                     /translation="MKAYLEPEEVERLEQSAEYMRDRLLIRLLFHLGCRVSEALGIKV
                     SDIDFKQGLVTIQHLKQRIKLSCPKCSARLGKGHKFCPVCGQKVEKVVAEEKEHRKFR
                     NLPLDTVTLGMLKEYIKRGGASSKKGNQQLFNLTRHRAWQIVKECAEKAALPDLINPE
                     SGKVHNVSPHKLRDAFAVHAVKLDDSGDGLRLLQEHLGHQSITTTMKYRKVSGEEQKE
                     WYEKLWQGGKQDG"
     misc_feature    complement(203544..>204194)
                     /locus_tag="DehaBAV1_0195"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(203580..203582,203694..203702,
                     203976..203978,204096..204101))
                     /locus_tag="DehaBAV1_0195"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(203580..203582,203607..203609,
                     203685..203687,203694..203696,203976..203978,
                     204099..204101))
                     /locus_tag="DehaBAV1_0195"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(203580..203582,203607..203609,
                     203685..203687,203694..203696,204099..204101))
                     /locus_tag="DehaBAV1_0195"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(204203..204676)
                     /locus_tag="DehaBAV1_0196"
                     /db_xref="GeneID:5132205"
     CDS             complement(204203..204676)
                     /locus_tag="DehaBAV1_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213664.1"
                     /db_xref="GI:147668846"
                     /db_xref="GeneID:5132205"
                     /translation="MVLDIVLKPMALSPQTFTVGDKVRVTVSFKYVIGVTATVKLFAG
                     PYYTNIFGKHMVNACVGQADLSLAATSTPTAGTATIDFLLIPKDQGGIEDGTYGLRVW
                     IEDTKAMAEQDNVIIVTGNPSSGDMFSSIMPMLMMLMMMGMIMPMTQQMGEGVEG"
     gene            complement(205657..205983)
                     /locus_tag="DehaBAV1_0197"
                     /db_xref="GeneID:5132132"
     CDS             complement(205657..205983)
                     /locus_tag="DehaBAV1_0197"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213665.1"
                     /db_xref="GI:147668847"
                     /db_xref="GeneID:5132132"
                     /translation="MERLFIALVALVGGLVSALIGWLDSGEHFDPRKFGGSAVRSLIA
                     GVVFAVGYHLSGAVSILDLFYAFLGGAGIDVLGNRISSKLGNGSFPLPGSSSLGDSTI
                     SEKKDE"
     sig_peptide     complement(205927..205983)
                     /locus_tag="DehaBAV1_0197"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.856) with cleavage site probability 0.677 at
                     residue 19"
     gene            complement(206168..207424)
                     /locus_tag="DehaBAV1_0198"
                     /db_xref="GeneID:5132244"
     CDS             complement(206168..207424)
                     /locus_tag="DehaBAV1_0198"
                     /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
                     sedolisin"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8/S53 subtilisin kexin sedolisin"
                     /protein_id="YP_001213666.1"
                     /db_xref="GI:147668848"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="GeneID:5132244"
                     /translation="MRYTVIAKGKPLSQVEVEVKKAGATNIRVAKLLGQIFCELDENQ
                     AKAIAQISGLSLKPIKEYKTDQVVAEMPPVESLADVFYMLRAYFNPPLTSTGLTVAVL
                     DSGIRKSHEALQNKVVYEANLTDSPSATDIFGHGTQVAFIIAGGFHAIGSKAGVSPGA
                     ALMNIKVISDEGIGNDEDIVLGIDRVCELAEEAREKGLWPTDDLYPNVINLSLGAEDD
                     GDPDNPVRSACRKASTEYGLDVIAAAGNSGPKMTTVMLPACDPEVIAVGAVETTGDLV
                     IWEKSSRGPTMQGETKPDFVIWGTNLEMASHKADDEYLTKSGTSFAAPMISGLTGLLW
                     ESGRRAYGESWQFRWTDARQYAPYFSTKPSDAPLNKDNAYGYGLPAMGTMLGEVSQVG
                     ASSQGGMEMLPMVMMMAMMSALTGGS"
     misc_feature    complement(206375..207142)
                     /locus_tag="DehaBAV1_0198"
                     /note="Peptidase S8 family domain, uncharacterized
                     subfamily 1; Region: Peptidases_S8_1; cd07487"
                     /db_xref="CDD:173812"
     misc_feature    complement(206288..207133)
                     /locus_tag="DehaBAV1_0198"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    complement(order(206465..206467,206687..206689,
                     206786..206788,206888..206890,207020..207022,
                     207116..207118))
                     /locus_tag="DehaBAV1_0198"
                     /note="active site"
                     /db_xref="CDD:173812"
     misc_feature    complement(order(206465..206467,207020..207022,
                     207116..207118))
                     /locus_tag="DehaBAV1_0198"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:173812"
     gene            complement(207438..208577)
                     /locus_tag="DehaBAV1_0199"
                     /db_xref="GeneID:5132202"
     CDS             complement(207438..208577)
                     /locus_tag="DehaBAV1_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213667.1"
                     /db_xref="GI:147668849"
                     /db_xref="GeneID:5132202"
                     /translation="MLRGTIDISKFGKNGKENYSQLCRSFNRNFISLLYSGFAQVNYG
                     LTDIDGIYRTCEIDRDRPLLGVTQPALHLPFASQDMLGVQVGSSDAVAGPLDFDLGNR
                     VIHADASPETANVVMEGVRYTGSTSTRNIYAANWVIQTFHVPWAVNAYAIRLYCYRAG
                     DLSARTLTVSIRKTDGAWNPTGGELAVGTATGVELQGITTDANGQWFEVAMTSPCVLR
                     PYTRYCIIVRIDGGDYSNSLRWQYGGSGSSSGYRLYRGGADCSGSSSNSGGSWSLSDN
                     YHQSNYFLVMGRHSVGLCHYPTIVRTISFPTPPPDMQFTIERFFHNFSGSAITLRETG
                     LYASAPTSASYENFVYLIARDILTAPIIVNNDELLKVSYAVQISV"
     gene            complement(208587..209246)
                     /locus_tag="DehaBAV1_0200"
                     /db_xref="GeneID:5132217"
     CDS             complement(208587..209246)
                     /locus_tag="DehaBAV1_0200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213668.1"
                     /db_xref="GI:147668850"
                     /db_xref="GeneID:5132217"
                     /translation="MTDIEIKTQPNLKVIKEEIPHLLAEGEIGAILELTVSDKNGNIT
                     QKRVMKSESFVRQFLELLWVNFQNLDYRSGRYCADVYGGVACVRADRRLWTAGGAIGE
                     THRGILVGTGTNVPTINDYTIQTLISHGTGAGQLQYSAVTFGAPSSDATTSQFTVTRN
                     FANGSGAQVTVHELTLVVQSYADSNIQYSHMVIRDMIPGGIAVPNGQTLTVNYRIQVT
                     T"
     gene            complement(209261..210178)
                     /locus_tag="DehaBAV1_0201"
                     /db_xref="GeneID:5132218"
     CDS             complement(209261..210178)
                     /locus_tag="DehaBAV1_0201"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213669.1"
                     /db_xref="GI:147668851"
                     /db_xref="GeneID:5132218"
                     /translation="MSLLIKIKGITRLSELEIDADKDWQTKGITNLKQVAAMMSKGDI
                     AVRDTSILVRLPPGPEDYCLTSAGSGKLPSWQPKGGMLKFYYPVYIASNHTESKPSVA
                     QSLNKPIIPDLDKRYAYSDSPSDNLRMFSPFVTLAKNSAIATVNQSHSKNAPIGRDIS
                     ILVDGAVSETSIGVQTDETAAARDSNGNDMNLCPMTPAVDDKYYFGFDRLFPRVWLNI
                     GMSGAGNWANVLEYWNGSTWVQASDEEDHTSDFTKSGINRINWTIPGDWARNTILGMN
                     LYWLRCRTITFVNQTVKPLGTQVWACLSA"
     gene            complement(210179..210436)
                     /locus_tag="DehaBAV1_0202"
                     /db_xref="GeneID:5132138"
     CDS             complement(210179..210436)
                     /locus_tag="DehaBAV1_0202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213670.1"
                     /db_xref="GI:147668852"
                     /db_xref="GeneID:5132138"
                     /translation="MGIFWGTSGCLLVRPKTMHKLSELVIDTDKLWGEKGILNVKEIA
                     EGMTKGDMVFSDGVKLVKITPGSIGTMLTAHDLGNDLTWSY"
     gene            complement(210436..210903)
                     /locus_tag="DehaBAV1_0203"
                     /db_xref="GeneID:5132437"
     CDS             complement(210436..210903)
                     /locus_tag="DehaBAV1_0203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213671.1"
                     /db_xref="GI:147668853"
                     /db_xref="GeneID:5132437"
                     /translation="MPGEFYVETKGGKVNLVPIETSLTDLQAKVDAIKAQADKLAGEI
                     PGQGSTTADWQLSEADVVSIGTAGVRYKLHDLTVSIHNLTGTQIRVRFYKKVNDIERK
                     VYDQLFDASLDPPGLPVINGSWAIHGVLRVTLESNDAADNSKAVDYDFMLEAM"
     gene            complement(210903..211568)
                     /locus_tag="DehaBAV1_0204"
                     /db_xref="GeneID:5132107"
     CDS             complement(210903..211568)
                     /locus_tag="DehaBAV1_0204"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213672.1"
                     /db_xref="GI:147668854"
                     /db_xref="GeneID:5132107"
                     /translation="MARCPGDTHGCGHTGGNGCLGFFTGEESHQRRGGEVPAMTTSLS
                     IMSGELGDIFWDLPPAVSYIAGLDLGCSIYVANPTEIEREYALIARLYKGETLISEEA
                     LPVFGYTWFKVEPGDFIKLNGALRFSESDASLMVLLVEKDTEEVTDSVSTHLVQVSSS
                     VLPPWPGSTATTTDWSSMLGFMLPFLMLGIMAVTLKPQSEKKESISQTKEERKLLPAG
                     RQG"
     gene            complement(211621..212151)
                     /locus_tag="DehaBAV1_0205"
                     /db_xref="GeneID:5132123"
     CDS             complement(211621..212151)
                     /locus_tag="DehaBAV1_0205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213673.1"
                     /db_xref="GI:147668855"
                     /db_xref="GeneID:5132123"
                     /translation="MPYTMVPEGYRALLIGSATSIGDLGTFAPLEESADEGAFFLMRL
                     DLVDLPSAESLGQLEQGLIDAGVEIWPGYDHYVYAVQNEPVVYIVWQKGLAWIPIIVG
                     ILVTTVLPPLLMAGIWLILPAEVKSLITGFINLGMMALVMFIMMQVMKPLTASNKEKP
                     KKIEQPKQPKPEEVAA"
     gene            complement(212169..212756)
                     /locus_tag="DehaBAV1_0206"
                     /db_xref="GeneID:5132182"
     CDS             complement(212169..212756)
                     /locus_tag="DehaBAV1_0206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213674.1"
                     /db_xref="GI:147668856"
                     /db_xref="GeneID:5132182"
                     /translation="MTEKIVTQQYPGYPGTRPPKGWVPPLGQSLTLLGVYDNESGYWM
                     GLPLQVLREALLNAEALHTEDRIDERDKIEVTVPNVSAQDVVKTTEFEVPAGEVWFLN
                     RLNLITEAEVSGNIRISKFPKVSDIDKKYLGTDQAAGTDTDYDLATPGQLGADLRLVG
                     GEKITVVATVMAVGGTTADRKVTLNPYGRKAKRLV"
     gene            complement(213369..213581)
                     /locus_tag="DehaBAV1_0207"
                     /db_xref="GeneID:5132187"
     CDS             complement(213369..213581)
                     /locus_tag="DehaBAV1_0207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213675.1"
                     /db_xref="GI:147668857"
                     /db_xref="GeneID:5132187"
                     /translation="MGKYASWNEFEKNVPITYKEKATPEAFRTGMNGIAPSGLKVKEG
                     RVNHYRDGVDGKGEVMVSGYKRAMFE"
     gene            complement(213999..214247)
                     /locus_tag="DehaBAV1_0208"
                     /db_xref="GeneID:5132351"
     CDS             complement(213999..214247)
                     /locus_tag="DehaBAV1_0208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213676.1"
                     /db_xref="GI:147668858"
                     /db_xref="GeneID:5132351"
                     /translation="MNSWFAPLQWLVFLALWRMSYETANINKLANSEKSFLIEKTPPQ
                     ETGNPREKEWTEKAVKKYADAQAKKWQHWNEAMFERSD"
     gene            complement(214511..215332)
                     /locus_tag="DehaBAV1_0209"
                     /db_xref="GeneID:5132185"
     CDS             complement(214511..215332)
                     /locus_tag="DehaBAV1_0209"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213677.1"
                     /db_xref="GI:147668859"
                     /db_xref="GeneID:5132185"
                     /translation="MDDQFLEEIKKRKEQGQSERQMATELGVSRSKVHNVLQDLKLTE
                     TGASLVPEDKLRVIIREELERVRNGEEEEAKTSSEFPIIRKMGGGMEMIAPEAVLKHY
                     MGGTPEGEVELRAIMKFRAAMLMVMDLVNIQKGSAEADARRMEPILRLMKETREEQDA
                     AAARAKASSEEIAERTAQATAGQLFGAISQSNTQVNSTLAQIKQMVGGQSNDPFSQVV
                     SMLQSMQQMSQMFGMPLPGMMPGAPQGGGPPGGQPPSDPPPIEKHTAKEWEERNV"
     misc_feature    complement(215222..215332)
                     /locus_tag="DehaBAV1_0209"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    complement(order(215225..215233,215237..215242))
                     /locus_tag="DehaBAV1_0209"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            complement(215506..216429)
                     /locus_tag="DehaBAV1_0210"
                     /db_xref="GeneID:5132152"
     CDS             complement(215506..216429)
                     /locus_tag="DehaBAV1_0210"
                     /note="PFAM: AAA ATPase, central domain protein; ATPase
                     associated with various cellular activities, AAA_5"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_001213678.1"
                     /db_xref="GI:147668860"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:5132152"
                     /translation="MKEGDMELITEIARFEASVDMEKEYRIGWSWRHVRVWPATLSRL
                     FKDGYLDNVFRSNSFTGYKLTEKAKAILLANQQEATTESQLESLVNPDDDLFTDIIGH
                     EDVKALLKAILLSEKPVHVMLTGPPALAKTLFLWDIEQTFGEQAIWLVGSATSKAGLW
                     DLVAEREPKILLIDEMDKMNAVDMAALLTMMEGGRLVRVKRGRELDINNPLKVIAASN
                     RLEKLSPELRSRFAIRKLNPYSRSEFLTVVKGVLVRKEGLPNDLAEEIARKLDGQSQD
                     VRDAIRIARLAPQVGVDKAISLLLGGEPCTS"
     misc_feature    complement(215728..216132)
                     /locus_tag="DehaBAV1_0210"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(215905..215922)
                     /locus_tag="DehaBAV1_0210"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(215740..215742)
                     /locus_tag="DehaBAV1_0210"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(216459..216614)
                     /locus_tag="DehaBAV1_0211"
                     /pseudo
                     /db_xref="GeneID:5132146"
     gene            complement(217143..219338)
                     /locus_tag="DehaBAV1_0212"
                     /db_xref="GeneID:5132388"
     CDS             complement(217143..219338)
                     /locus_tag="DehaBAV1_0212"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213679.1"
                     /db_xref="GI:147668861"
                     /db_xref="GeneID:5132388"
                     /translation="MPELVFSEAVPQLLAEHLTHLSEGSGISLDVIKERGYRSILGKD
                     ELAKAGFTSSQQRTTGILIPLWGVDGGQVGYQYRPDNPRLDSRQRPVKYESPVGSSNH
                     LDCPPRCKQILGDPKTPLWITEGSKKADALATHGACVISLTGVWGFKGKNEFGAITLL
                     SDWDRIAIKDRLVYLAFDSDIVSKEMVRKALEHLGEHLSRKGATILVVYLPQEGNQKV
                     GIDDYLLNHTLEEARKLATDFKIDDTANRERFVPGFVLHDGTVGEMVVSKEDERAFII
                     VINGSVRKVFRYETPKAIYLPTDDPLVTEVVHFATTATPYDSQARLFEEIRSFVHKYL
                     ELSADFEEISSLYVLLTWVYEFAPSIPYLRVIGDWGTGKTRFLQVVGSVCFRPTFASG
                     ATTPAPIFRILEQFRGTLVLDEADFKDSSSWVEMVKLLNNGYRPGMPVLRADKENGKW
                     FPRSYQVFGPKLIATRFPFKDEALESRCLTSEMMSLTRDDIPRVLPPTFDKEIDDLRA
                     KLLTFRLANLIKLKGKTFGNDLLEPNLQPRLQEILIPLKAMLNGDRSMVEAITSFVHR
                     LQDSLFIRRRESAPGRVLAALMELHEEGKELTSENVAKKANETDDEVEQLSAEKVGRM
                     TKRLGFAKERTGKSRQRLICWDESRVTKLIGSYGLQMALPLSQEKPSEPSLLSALATK
                     QADSNKGGSVYCPPYCPPKTEADSSVGADSRTERTVTDDELTKEASAGE"
     misc_feature    complement(218739..218984)
                     /locus_tag="DehaBAV1_0212"
                     /note="TOPRIM_primases: The topoisomerase-primase (TORPIM)
                     nucleotidyl transferase/hydrolase domain found in the
                     active site regions of bacterial DnaG-type primases and
                     their homologs. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_primases; cd01029"
                     /db_xref="CDD:173779"
     misc_feature    complement(order(218793..218795,218799..218801,
                     218805..218807,218955..218957,218964..218969))
                     /locus_tag="DehaBAV1_0212"
                     /note="active site"
                     /db_xref="CDD:173779"
     misc_feature    complement(order(218805..218807,218967..218969))
                     /locus_tag="DehaBAV1_0212"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173779"
     misc_feature    complement(order(218877..218879,218937..218942,
                     218958..218963))
                     /locus_tag="DehaBAV1_0212"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173779"
     gene            complement(219388..220368)
                     /locus_tag="DehaBAV1_0213"
                     /db_xref="GeneID:5132178"
     CDS             complement(219388..220368)
                     /locus_tag="DehaBAV1_0213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213680.1"
                     /db_xref="GI:147668862"
                     /db_xref="GeneID:5132178"
                     /translation="MPIKGVTGVVRLPRLGKVRLGVKKENASGISYPCPTDHFVCPEE
                     VKKVFGEKPKELRIMFPTDDQTQWASQYLRCYSASRGLVCRGDGETAVAKIDTRTGEI
                     ANRESVETEMKEVTCNPAKCTYYQLARCRRVMNLQFLLPDCPGFGVYQLDTSSFYSIV
                     NVNSSLELIRGTCGRLSMIPLSLKLVEQEVQPEGKKKTVRVLSMTAPFSLVEIQRYAQ
                     IPPGQVLLLPPPDNEAPDDLFPDEILSKEEPAKTILGSDKDLMLLWDRVKSKVWQMDM
                     QDYQVSHWFQKNCNLDFHLTDLDPLTPPTRIKTEHLENFLKTLERYTDRS"
     gene            220889..221284
                     /locus_tag="DehaBAV1_0214"
                     /db_xref="GeneID:5132162"
     CDS             220889..221284
                     /locus_tag="DehaBAV1_0214"
                     /note="PFAM: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001213681.1"
                     /db_xref="GI:147668863"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:5132162"
                     /translation="MMENFGEYLRTLRVEKRLSLREVEQQSGVSNSYLGLIERGQRPI
                     PGADILKKLAPVYDVPVRDLLKAAGYLKDEDISISENDEIEMAFNYVMNDPRYKSGTR
                     IKGGLTTDVKRFIVEMYEKATGKKLLPGG"
     misc_feature    220901..>221143
                     /locus_tag="DehaBAV1_0214"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    220904..221080
                     /locus_tag="DehaBAV1_0214"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(220916..220918,220928..220930,221003..221005)
                     /locus_tag="DehaBAV1_0214"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(220925..220927,221000..221002)
                     /locus_tag="DehaBAV1_0214"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(220946..220951,220982..220984,220991..220993,
                     221003..221008)
                     /locus_tag="DehaBAV1_0214"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            221289..222218
                     /locus_tag="DehaBAV1_0215"
                     /db_xref="GeneID:5132143"
     CDS             221289..222218
                     /locus_tag="DehaBAV1_0215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213682.1"
                     /db_xref="GI:147668864"
                     /db_xref="GeneID:5132143"
                     /translation="MKSFSDLRYFCEYIVNKYGSPSNASEDDKAQEFRKIYLRDLPLD
                     IRTLRAIASACGIYVNGVDSKNLPQNIRGYHDVFDDKRNIYYKKGDTKSGIENTVLHE
                     FREMIEPVFAELYTDYSPLRTNAVHLAANKFATAVLLPKEEFRDKVYELGFDVIALSK
                     FYSKSCSQVLLRMGEVLQGSVFLYSALYEQGPEIDNWILNYWTGSANNDDPEANIYGA
                     DGLFPRKGRAVVPGSLVEMVIKAKKPQLVRRITILDSQEDDGLVAIANPLVITGSLVK
                     VALVVVLSHSIGLLQPQIERLNPVEVEGFHKHL"
     misc_feature    221442..221804
                     /locus_tag="DehaBAV1_0215"
                     /note="Domain of unknown function (DUF955); Region:
                     DUF955; cl01076"
                     /db_xref="CDD:260778"
     gene            222243..223796
                     /locus_tag="DehaBAV1_0216"
                     /db_xref="GeneID:5132174"
     CDS             222243..223796
                     /locus_tag="DehaBAV1_0216"
                     /note="PFAM: Resolvase, N-terminal domain; Recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="YP_001213683.1"
                     /db_xref="GI:147668865"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="InterPro:IPR011109"
                     /db_xref="GeneID:5132174"
                     /translation="MENRAKKVAIYARVSSDKQDVDLSISAQLKAIREYAKNNGYEVV
                     REFVDEAETGRTTARPAFREMISLARHPQKPFDVILVWKYSRFARSREDSIVYKAMLR
                     KSEVHVISINEPFDDTPTGRLLEAIIESLDEFYSDNLGEEVTRGMRESAARGFYLSSK
                     PPYGYRKVRFKDGEKEHTKLEIEPNQAGIVSSMFTDALKGKGLTEIAKELNHKGIASP
                     RGKGWGKTAVRTIMSNEAYAGSFVWGRNSKRGLAPIRVENACPAIISRQVFDNAQKLI
                     RERAPKLTHPKRTCSRFLLSGFTFCSHCGKAMIGQDAKSGKYSYYVCGTLNKKGAGSC
                     PSHYFNSRSFEETVVKVIRENILTEEHLKRLIEMVNQEMDVNSRGYQEELDAVLEEMN
                     ETNRRLERLYDAVETGKIPLADLAPRIHDLKLRIEKLQERKIQITNNMSDRKVELASP
                     EIVKSYVKDMRQVLQESELTGKRAFLKGFIKKIEVKDRQGIIHYLLPINGVLEERIGV
                     LPIVQYGGQ"
     misc_feature    222258..222923
                     /locus_tag="DehaBAV1_0216"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    222270..222680
                     /locus_tag="DehaBAV1_0216"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    order(222279..222281,222285..222287,222495..222500,
                     222507..222509)
                     /locus_tag="DehaBAV1_0216"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    222285..222287
                     /locus_tag="DehaBAV1_0216"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     misc_feature    222792..223079
                     /locus_tag="DehaBAV1_0216"
                     /note="Recombinase; Region: Recombinase; pfam07508"
                     /db_xref="CDD:254248"
     misc_feature    223122..223301
                     /locus_tag="DehaBAV1_0216"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     gene            complement(223784..223859)
                     /locus_tag="DehaBAV1_R0004"
                     /note="tRNA-Val3"
                     /db_xref="GeneID:5132120"
     tRNA            complement(223784..223859)
                     /locus_tag="DehaBAV1_R0004"
                     /product="tRNA-Val"
                     /db_xref="GeneID:5132120"
     gene            complement(223909..224403)
                     /locus_tag="DehaBAV1_0217"
                     /db_xref="GeneID:5132421"
     CDS             complement(223909..224403)
                     /locus_tag="DehaBAV1_0217"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213684.1"
                     /db_xref="GI:147668866"
                     /db_xref="GeneID:5132421"
                     /translation="MKKFPKRTYSNPIQFFSDIGFILRNRRKLKESRLSGFPGPAFRE
                     RLMLAVTGVNECRFCTYAHTKMALESGISQSEVKALLDGDFGNCPPDELGAVLFAQHW
                     ADTAAKPSAKMQGKFEADYGAEKSGFINLYLRMIRIGNLSGNTADKLLYYISFGKMGL
                     DRQL"
     misc_feature    complement(<224161..224319)
                     /locus_tag="DehaBAV1_0217"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; pfam02627"
                     /db_xref="CDD:251430"
     gene            complement(224517..225551)
                     /locus_tag="DehaBAV1_0218"
                     /db_xref="GeneID:5132167"
     CDS             complement(224517..225551)
                     /locus_tag="DehaBAV1_0218"
                     /EC_number="4.1.2.5"
                     /note="PFAM: aromatic amino acid beta-eliminating
                     lyase/threonine aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine aldolase"
                     /protein_id="YP_001213685.1"
                     /db_xref="GI:147668867"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="GeneID:5132167"
                     /translation="MKIIDLRSDTVTRPTPEMKKTMCDAPLGDDVFGEDPTVNRLEKM
                     AAGKTGKEAALFTPSGTMSNLLSVLSQTRPGDEIILGSEAHILWYEVGGASAVGGVVM
                     RAVPNQPDGTIYLADIKDAIRGSNLHFPPTRLICLENTHNRCGGAVLSPSYTAGVANL
                     ARMRGIKVHLDGARLFNACVALGVSAKELCQGMDTVSFCLSKGLSAPAGSLLCSDQET
                     INRARKFRKMLGGGMRQTGVLAACGIVALETMIERLALDHAMAKTLAEGLFDIDNHTL
                     DKQIVQTNIVIFNPPFGLGADEFLEQAKQAGLLFTMGSHGRVRAVCHHDLSEADIQTA
                     LRRIAAMKKA"
     misc_feature    complement(224532..225539)
                     /locus_tag="DehaBAV1_0218"
                     /note="Low-specificity threonine aldolase (TA). This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I).  TA
                     catalyzes the conversion of L-threonine or
                     L-allo-threonine to glycine and acetaldehyde in a...;
                     Region: TA_like; cd06502"
                     /db_xref="CDD:99748"
     misc_feature    complement(224688..225539)
                     /locus_tag="DehaBAV1_0218"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(224619..224621,224835..224840,
                     224868..224873,224880..224885,224928..224930,
                     224946..224951,225243..225251,225270..225293,
                     225345..225347,225366..225371,225378..225380,
                     225480..225488,225495..225497,225513..225524,
                     225531..225533))
                     /locus_tag="DehaBAV1_0218"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99748"
     misc_feature    complement(order(224946..224948,224955..224957,
                     225030..225032,225039..225041,225138..225140,
                     225360..225362,225369..225374))
                     /locus_tag="DehaBAV1_0218"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99748"
     misc_feature    complement(224946..224948)
                     /locus_tag="DehaBAV1_0218"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99748"
     gene            225636..226538
                     /locus_tag="DehaBAV1_0219"
                     /db_xref="GeneID:5132124"
     CDS             225636..226538
                     /locus_tag="DehaBAV1_0219"
                     /note="PFAM: protein of unknown function DUF6,
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213686.1"
                     /db_xref="GI:147668868"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:5132124"
                     /translation="MLHMKAKTYLLLLLGVFGIAAASVFTRLADAPPVIIASLRMLAA
                     TLLLLPFAARPVYLAIKRLSRRNLLLIILAGFLVGMDQFFWVSSLEYTSIASSVILVT
                     SHPVLVAIMSYIMWREQLNPKAIFGVLAAFGGMVLINLATTQVGEQAFLGNMLAMAAT
                     IPTTGYLIIGRQMRNSIDFLPYITLLYGSAAFFLLAGAFISGDSFGGYPGTTYLMIFL
                     LAVVSQLVGHSSLNMALRLVPALVVSVAILGEPVGAIILGYLFLGEGLTFNEFLGGML
                     VLAGILIVMLNQPRTKKMEAEIPR"
     misc_feature    225636..226505
                     /locus_tag="DehaBAV1_0219"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     sig_peptide     225636..225725
                     /locus_tag="DehaBAV1_0219"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.891 at
                     residue 30"
     misc_feature    225717..226055
                     /locus_tag="DehaBAV1_0219"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    226128..226493
                     /locus_tag="DehaBAV1_0219"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            226535..227257
                     /locus_tag="DehaBAV1_0220"
                     /db_xref="GeneID:5132134"
     CDS             226535..227257
                     /locus_tag="DehaBAV1_0220"
                     /note="PFAM: protein of unknown function DUF45"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213687.1"
                     /db_xref="GI:147668869"
                     /db_xref="InterPro:IPR002725"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:5132134"
                     /translation="MSPRNVYSRPEVIGKKSIVLEGKEIHYTLRKSRFSDLIRLAIRS
                     ATGLVVTVPHQYNMNGLDDILLQRSAWILKHQNKMNANRFVLEDGLHDGQQVPYLGKL
                     YTLRIKEGGERGHVSLAENTIHLLTGGKTPVEVMEKWYRHRAAGIVKTCLEKNASKMG
                     LSFGRLCIRAQKTRWGSCTSRGDLNFNWKLATIPPEVMDYVVIHELSHRVEMNHTDRF
                     WVIVEKYCPNWKALRKQLKTYE"
     misc_feature    226646..227251
                     /locus_tag="DehaBAV1_0220"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     pfam01863"
                     /db_xref="CDD:145171"
     gene            227481..227741
                     /locus_tag="DehaBAV1_0221"
                     /db_xref="GeneID:5132104"
     CDS             227481..227741
                     /locus_tag="DehaBAV1_0221"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213688.1"
                     /db_xref="GI:147668870"
                     /db_xref="GeneID:5132104"
                     /translation="MSKKSFSTKEALAVAKTLGITFKNYDIEQFRMGMDVELEHGTRD
                     PHTNVTSDDPVMTGKIALAHLNEIEDYYTRLAKMEAEAGVED"
     gene            227748..228581
                     /locus_tag="DehaBAV1_0222"
                     /db_xref="GeneID:5132149"
     CDS             227748..228581
                     /locus_tag="DehaBAV1_0222"
                     /EC_number="3.1.1.23"
                     /note="PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="acylglycerol lipase"
                     /protein_id="YP_001213689.1"
                     /db_xref="GI:147668871"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="GeneID:5132149"
                     /translation="MRFTEGHFKGCQEYNCYYQALLPNGSPKAIVLVVHGLGEHSGRY
                     SELAHYLADRSYAVYAYDHFGHGKTDGKAGYVSSYDVYIYDLISAFSMVQAKHPTSKI
                     FIFGHSMGGLITAAYASKNQYDAAGLIFSSIALKPNTGMPGVINQLIKPLSKIAPMLG
                     VRKINASTISHNKDVVKAYNEDPLVLHHRMSAQMAAEFLRICQDLPDFLKNISLPSLI
                     IHGEEDHLVNIKGSRELVQRIRSKDKTLITYPGMYHEVLNEPDCPQVWNDLFFWLENH
                     I"
     misc_feature    227748..228578
                     /locus_tag="DehaBAV1_0222"
                     /note="Lysophospholipase [Lipid metabolism]; Region: PldB;
                     COG2267"
                     /db_xref="CDD:225176"
     misc_feature    227796..228020
                     /locus_tag="DehaBAV1_0222"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     pfam12146"
                     /db_xref="CDD:256874"
     misc_feature    227814..228578
                     /locus_tag="DehaBAV1_0222"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(228810..229313)
                     /locus_tag="DehaBAV1_0223"
                     /db_xref="GeneID:5132144"
     CDS             complement(228810..229313)
                     /locus_tag="DehaBAV1_0223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213690.1"
                     /db_xref="GI:147668872"
                     /db_xref="GeneID:5132144"
                     /translation="MFNVQSISLRKELVIAFLVMLGLATAAPLLGNQYLTGSLVNAVL
                     FISAVTLGWKNAVAIGLISSTIALATGLLPIVMAPMVPFIMAANALLVTSFSALRGKS
                     FWLGAGVGAVLKFAFLWATSSLILNLFIEQNVADKIAGMMGLTQLFTALMGAVIAYGA
                     LRLGKKI"
     sig_peptide     complement(229218..229313)
                     /locus_tag="DehaBAV1_0223"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.992) with cleavage site probability 0.704 at
                     residue 32"
     gene            complement(229353..231074)
                     /locus_tag="DehaBAV1_0224"
                     /db_xref="GeneID:5132131"
     CDS             complement(229353..231074)
                     /locus_tag="DehaBAV1_0224"
                     /note="TIGRFAM: hydrogenase, Fe-only;
                     PFAM: ferredoxin; 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein; iron hydrogenase, small subunit;
                     hydrogenase large subunit domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase, Fe-only"
                     /protein_id="YP_001213691.1"
                     /db_xref="GI:147668873"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003149"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR013352"
                     /db_xref="GeneID:5132131"
                     /translation="MVTLNIDNKQVTVPEGTTILQAAKEANINIPHLCYFEGLKSYSG
                     CRVCVVEIEGEPRLATSCSRKVAEGMKVNTHSARVRRARRTILEILLANHPQDCFNCE
                     RNQNCDLLRLAFECGVKKLRFEESEKRVLPIDNTSPSIIRDPNKCIACGRCVRVCHDI
                     QTVNAIGFINKGPDTMVATSMDRGMGNVACANCGQCILVCPVGAIKERSAVDAVWAAI
                     ADPAKHVVVQEAPSIRVSLGEELGLPAGTLVAKKMYAALRRLGFDAVFDTNFTADLTI
                     LEEGSELVERVKEGGVLPQLTSCCPGWVKFMEHYYPELAPNVSSAKSPQQMFGAVCKT
                     YYAEKAGIDPKTIVNVSVMPCTAKKFECQRPEMNDSGFKDVDYVLTTRELARMIKEAG
                     LDFVSLDEEPAEDLLGLYTGAATIFGATGGVMEAAIRSAYMLITGRELENLDIEPVRG
                     LEGVKTATLNVDGLELKVAVAHGLGNARALLEEIKEGTSPYHFIEIMACPGGCVGGGG
                     QPIRFDSSLKKKRGEALYEEDRNMPKRCSHHNPSIAKIYADYLEKPLGKRSHKLLHTE
                     YTSRPVV"
     misc_feature    complement(230859..231071)
                     /locus_tag="DehaBAV1_0224"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(230889..230894,230931..230942,
                     230961..230963,230973..230975,230982..230987))
                     /locus_tag="DehaBAV1_0224"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(230889..230891,230931..230933,
                     230940..230942,230973..230975))
                     /locus_tag="DehaBAV1_0224"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    complement(230706..230828)
                     /locus_tag="DehaBAV1_0224"
                     /note="NADH-ubiquinone oxidoreductase-G iron-sulfur
                     binding region; Region: NADH-G_4Fe-4S_3; pfam10588"
                     /db_xref="CDD:256073"
     misc_feature    complement(229575..230660)
                     /locus_tag="DehaBAV1_0224"
                     /note="[FeFe] hydrogenase, group A; Region: FeFe_hydrog_A;
                     TIGR02512"
                     /db_xref="CDD:233903"
     misc_feature    complement(230466..230642)
                     /locus_tag="DehaBAV1_0224"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    complement(229575..230408)
                     /locus_tag="DehaBAV1_0224"
                     /note="Iron only hydrogenase large subunit, C-terminal
                     domain; Region: Fe_hyd_lg_C; pfam02906"
                     /db_xref="CDD:251611"
     misc_feature    complement(229362..229517)
                     /locus_tag="DehaBAV1_0224"
                     /note="Iron hydrogenase small subunit; Region: Fe_hyd_SSU;
                     smart00902"
                     /db_xref="CDD:214899"
     gene            complement(231062..232315)
                     /locus_tag="DehaBAV1_0225"
                     /db_xref="GeneID:5132092"
     CDS             complement(231062..232315)
                     /locus_tag="DehaBAV1_0225"
                     /EC_number="1.6.99.5"
                     /note="PFAM: Respiratory-chain NADH dehydrogenase domain,
                     51 kDa subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (quinone)"
                     /protein_id="YP_001213692.1"
                     /db_xref="GI:147668874"
                     /db_xref="InterPro:IPR011538"
                     /db_xref="GeneID:5132092"
                     /translation="MKDLKIITRHLNTANSADIDVYLADGGYQALKKALSMTPEEVIA
                     EVKRSKLVGRGGAAFPTGLKWELTRKEKANPKYIVCNASEGEPGTFKDRLILKNDPHM
                     VLEGFIIAAYAVGTSQGFIHAREVYTQEIELFQKAIDQATERGFLGQNIMGSNFSLDI
                     QFYKSAGAYICGEETALFESLEGHRGIPATRPPYPVQVGLMDKPTTVNNVETLCNIPA
                     IINNGADWFASIGHPDYPGTKLFCLSGNVKKPGVFELPLGTNLKDLLEAGGGVDGKFK
                     AVLPGGISSSLLTETDISLDFKTLAKAGTMLGSGAVIVINSDTSMVNVASNVAHFFDE
                     EGCGKCSICREGTRRAAEILSRFSRGQGNRNELEWLLELHEVMKDTASCGLGQVALNV
                     AASAIRNFKGEFLAQVRKEEGVWLR"
     misc_feature    complement(231083..232303)
                     /locus_tag="DehaBAV1_0225"
                     /note="NADH:ubiquinone oxidoreductase, NADH-binding (51
                     kD) subunit [Energy production and conversion]; Region:
                     NuoF; COG1894"
                     /db_xref="CDD:224806"
     misc_feature    complement(231665..232180)
                     /locus_tag="DehaBAV1_0225"
                     /note="Respiratory-chain NADH dehydrogenase 51 Kd subunit;
                     Region: Complex1_51K; pfam01512"
                     /db_xref="CDD:250674"
     misc_feature    complement(231470..231598)
                     /locus_tag="DehaBAV1_0225"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     misc_feature    complement(231224..231352)
                     /locus_tag="DehaBAV1_0225"
                     /note="NADH-ubiquinone oxidoreductase-F iron-sulfur
                     binding region; Region: NADH_4Fe-4S; pfam10589"
                     /db_xref="CDD:256074"
     gene            complement(232317..232784)
                     /locus_tag="DehaBAV1_0226"
                     /db_xref="GeneID:5132048"
     CDS             complement(232317..232784)
                     /locus_tag="DehaBAV1_0226"
                     /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
                     /protein_id="YP_001213693.1"
                     /db_xref="GI:147668875"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="GeneID:5132048"
                     /translation="MESIWKEKVDGVITQSGSSRLSLLPCLEAVQEECGYIPHEAVNY
                     LRECLSIPSIDIYGMITFYSLLSTNQKGKYVIRLCNSLPCYLNGTENILDTLVDNLGI
                     EPGQTTLDRRFTLELVPCLGLCDQSPAMVINGVVYGKLTAQLVTEVLDELRTY"
     misc_feature    complement(232326..232760)
                     /locus_tag="DehaBAV1_0226"
                     /note="Thioredoxin-like [2Fe-2S] ferredoxin; Region:
                     2Fe-2S_thioredx; pfam01257"
                     /db_xref="CDD:250481"
     misc_feature    complement(232329..232568)
                     /locus_tag="DehaBAV1_0226"
                     /note="TRX-like [2Fe-2S] Ferredoxin (Fd) family,
                     NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily;
                     Nuo, also called respiratory chain Complex 1, is the entry
                     point for electrons into the respiratory chains of
                     bacteria and the mitochondria of eukaryotes; Region:
                     TRX_Fd_NuoE; cd03064"
                     /db_xref="CDD:239362"
     misc_feature    complement(order(232428..232436,232554..232556,
                     232560..232562))
                     /locus_tag="DehaBAV1_0226"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239362"
     misc_feature    complement(order(232413..232415,232425..232427,
                     232533..232535,232548..232550))
                     /locus_tag="DehaBAV1_0226"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239362"
     gene            complement(233230..233643)
                     /locus_tag="DehaBAV1_0227"
                     /db_xref="GeneID:5131994"
     CDS             complement(233230..233643)
                     /locus_tag="DehaBAV1_0227"
                     /note="PFAM: low molecular weight phosphotyrosine protein
                     phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein tyrosine phosphatase"
                     /protein_id="YP_001213694.1"
                     /db_xref="GI:147668876"
                     /db_xref="InterPro:IPR000106"
                     /db_xref="GeneID:5131994"
                     /translation="MENRLQVLFVCLHNAGRSQAAEAIFNNLSGGRVVAISAGTEPSS
                     ALNPEVVAVLKEDGINTDGLKPKLLSQDMLDKASRIISMGCDVTLSCPGHLYGQEDWG
                     ITDPRGKNLAEVRLIVGGIRQKVENLLAELEKSEG"
     misc_feature    complement(233254..233625)
                     /locus_tag="DehaBAV1_0227"
                     /note="Low molecular weight phosphatase family; Region:
                     LMWPc; cd00115"
                     /db_xref="CDD:238063"
     misc_feature    complement(order(233590..233598,233602..233607,
                     233611..233613))
                     /locus_tag="DehaBAV1_0227"
                     /note="active site"
                     /db_xref="CDD:238063"
     gene            complement(233645..234310)
                     /locus_tag="DehaBAV1_0228"
                     /db_xref="GeneID:5131998"
     CDS             complement(233645..234310)
                     /locus_tag="DehaBAV1_0228"
                     /note="TIGRFAM: phosphate transport system regulatory
                     protein PhoU;
                     PFAM: PhoU family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate uptake regulator PhoU"
                     /protein_id="YP_001213695.1"
                     /db_xref="GI:147668877"
                     /db_xref="InterPro:IPR008170"
                     /db_xref="GeneID:5131998"
                     /translation="MPRMGFDRHLKELENDLLLLGSMVGKAIDRSTQAMKERDIALAK
                     QVIEEDKLINCKRFEIEEKSIELMATQQPMARDLRIIVAVLNMIVDLERIGDHAAGNA
                     KIVLMLGEEPPLKPLVDIPRMAVKTQEMLNRALGAFINRDSAEAINVINDDDEVDNLY
                     DQVFRELLVFMAEDPHTISRATRLIWAAHNLERSADRVTNICERVLFVITGKSEELGS
                     SNY"
     misc_feature    complement(233675..234295)
                     /locus_tag="DehaBAV1_0228"
                     /note="phosphate transport system regulatory protein PhoU;
                     Region: phoU_full; TIGR02135"
                     /db_xref="CDD:233742"
     misc_feature    complement(233996..234262)
                     /locus_tag="DehaBAV1_0228"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    complement(233696..233953)
                     /locus_tag="DehaBAV1_0228"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            complement(234323..235078)
                     /locus_tag="DehaBAV1_0229"
                     /db_xref="GeneID:5132098"
     CDS             complement(234323..235078)
                     /locus_tag="DehaBAV1_0229"
                     /note="ATP-binding protein; PstABCS is an ATP dependent
                     phosphate uptake system which is responsible for inorganic
                     phosphate uptake during phosphate starvation"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="YP_001213696.1"
                     /db_xref="GI:147668878"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005670"
                     /db_xref="GeneID:5132098"
                     /translation="MDPKIKIRGVNFFYHKHQVLKNINMDFPERQITAIIGPSGCGKS
                     TLLRVLNRMNDIVSGARLEGAVLLDNENIYSPNLDVVNLRKRVGMVFQQPNPFPKSIF
                     DNVAFGPRMLGTTAQSRLDEVVEKSLRQAALWDEVKDNLHKSGLALSGGQQQRLCIAR
                     VLAIEPEVILMDEPCSALDPVSTMRIEELMQELKQNYTIAIVTHNMQQAARASDWTGF
                     LLTGDLVEYGRTGEIFSRPRDKRTEDYITGRFG"
     misc_feature    complement(234326..235078)
                     /locus_tag="DehaBAV1_0229"
                     /note="phosphate ABC transporter ATP-binding protein;
                     Provisional; Region: PRK14249"
                     /db_xref="CDD:184590"
     misc_feature    complement(234380..235066)
                     /locus_tag="DehaBAV1_0229"
                     /note="ATP-binding cassette domain of the phosphate
                     transport system; Region: ABC_PstB_phosphate_transporter;
                     cd03260"
                     /db_xref="CDD:213227"
     misc_feature    complement(234947..234970)
                     /locus_tag="DehaBAV1_0229"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(order(234467..234469,234560..234565,
                     234803..234805,234944..234952,234956..234961))
                     /locus_tag="DehaBAV1_0229"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(234803..234814)
                     /locus_tag="DehaBAV1_0229"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(234608..234637)
                     /locus_tag="DehaBAV1_0229"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(234560..234577)
                     /locus_tag="DehaBAV1_0229"
                     /note="Walker B; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(234542..234553)
                     /locus_tag="DehaBAV1_0229"
                     /note="D-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(234461..234481)
                     /locus_tag="DehaBAV1_0229"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213227"
     gene            complement(235079..235930)
                     /locus_tag="DehaBAV1_0230"
                     /db_xref="GeneID:5132000"
     CDS             complement(235079..235930)
                     /locus_tag="DehaBAV1_0230"
                     /note="TIGRFAM: phosphate ABC transporter, inner membrane
                     subunit PstA;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="YP_001213697.1"
                     /db_xref="GI:147668879"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR005672"
                     /db_xref="GeneID:5132000"
                     /translation="MLKFTSRSTQKVAFSLLWTAGIITLLILLLIIGYIIIRGLPGFS
                     WDFLFTPPAGGLAGDGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRLTR
                     FIRYGVQTLAGVPSILFGLFGFALFVTVLHFRFSILSGALTLACLLLPVLITATEEAL
                     KTVPRSYRAGAMALGATKWQSITHVILPAALPGIATGVILCAGRALGETACLYVTMGG
                     SAAMPDSLLSGGRSLALHVFYLATETNAIDKAMATAAVLIVIIVGLNALTNFISRRFQ
                     KRMSGGV"
     misc_feature    complement(235094..235804)
                     /locus_tag="DehaBAV1_0230"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstA; COG0581"
                     /db_xref="CDD:223654"
     misc_feature    complement(235139..235735)
                     /locus_tag="DehaBAV1_0230"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235139..235144,235151..235156,
                     235163..235168,235172..235177,235184..235189,
                     235217..235219,235250..235252,235289..235294,
                     235301..235312,235331..235333,235340..235345,
                     235385..235387,235436..235438,235445..235450,
                     235460..235462,235466..235471,235478..235480,
                     235484..235486,235490..235495,235559..235561,
                     235565..235570,235577..235606,235610..235621,
                     235655..235657,235670..235675,235682..235687))
                     /locus_tag="DehaBAV1_0230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235295..235312,235559..235603))
                     /locus_tag="DehaBAV1_0230"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235187..235189,235217..235219,
                     235256..235258,235292..235294,235508..235510,
                     235559..235561))
                     /locus_tag="DehaBAV1_0230"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235364..235366,235376..235381,
                     235397..235435))
                     /locus_tag="DehaBAV1_0230"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(235923..236783)
                     /locus_tag="DehaBAV1_0231"
                     /db_xref="GeneID:5132429"
     CDS             complement(235923..236783)
                     /locus_tag="DehaBAV1_0231"
                     /note="TIGRFAM: phosphate ABC transporter, inner membrane
                     subunit PstA; phosphate ABC transporter, inner membrane
                     subunit PstC;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="YP_001213698.1"
                     /db_xref="GI:147668880"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR005672"
                     /db_xref="InterPro:IPR011864"
                     /db_xref="GeneID:5132429"
                     /translation="MLPRYFTDKLAKYGVFITALVSILVLLAIAIFIIKGGLPLFGEV
                     NPLDFLFGQSWSPTYGEYGILSMIVGSLLVTLGAMVIAVPLGIACAILLAEVAPRRVR
                     DLLRPAVELLVGIPSVVYGLVGIMVIVPAVRNLGGTGYSILAAVLVLSIMVLPTIISI
                     SEDSLRAVPRTYREGSLALGASHWQTIWHVLLPAARSGVGASIVLGMGRAIGETMAMI
                     MVIGNAVIIPSSPLDPARTLTGNIAVEINYAAGLHENALFATGLVLLILILILNSLAT
                     LVLKRGEQHA"
     misc_feature    complement(235935..236762)
                     /locus_tag="DehaBAV1_0231"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstC; COG0573"
                     /db_xref="CDD:223646"
     misc_feature    complement(236097..236582)
                     /locus_tag="DehaBAV1_0231"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(236127..236132,236139..236150,
                     236169..236171,236178..236183,236223..236225,
                     236274..236276,236283..236288,236298..236300,
                     236304..236309,236316..236318,236322..236324,
                     236328..236333,236406..236408,236415..236420,
                     236427..236456,236460..236471,236502..236504,
                     236517..236522,236529..236534))
                     /locus_tag="DehaBAV1_0231"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(236133..236150,236406..236411,
                     236415..236453))
                     /locus_tag="DehaBAV1_0231"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(236130..236132,236346..236348,
                     236406..236408))
                     /locus_tag="DehaBAV1_0231"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(236202..236204,236214..236219,
                     236235..236273))
                     /locus_tag="DehaBAV1_0231"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(236858..237712)
                     /locus_tag="DehaBAV1_0232"
                     /db_xref="GeneID:5131569"
     CDS             complement(236858..237712)
                     /locus_tag="DehaBAV1_0232"
                     /note="TIGRFAM: phosphate binding protein;
                     PFAM: extracellular solute-binding protein, family 1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate binding protein"
                     /protein_id="YP_001213699.1"
                     /db_xref="GI:147668881"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="InterPro:IPR011862"
                     /db_xref="GeneID:5131569"
                     /translation="MNKIASNKKIMLPVTAIMLLALGVAGCGNDTDDNNDDNTTALSG
                     TINEAGSTTVQPLAEKLAAAFTALNPNVKVVIGGGGSSVGVKSVTEGTVDIGAASRDL
                     KDTETGLTKHLLAKDGIAIVVHPDNTAVNNLTIDQVRDIFSGVITNWSQVGGPDKAIH
                     VMAREEGSGTRTAFEELVMGADVRIVTNAVLQNSNGALKTALSGDKDAIGFISFGYID
                     SAVKALSINGIAATSENGKNGTYPIIRPLYFLTKGTTSELVQAFIDYCLSDAVQQIIT
                     EEGYLSVN"
     sig_peptide     complement(237632..237712)
                     /locus_tag="DehaBAV1_0232"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.995) with cleavage site probability 0.498 at
                     residue 27"
     misc_feature    complement(236873..237694)
                     /locus_tag="DehaBAV1_0232"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(237752..238186)
                     /gene="mgsA"
                     /locus_tag="DehaBAV1_0233"
                     /db_xref="GeneID:5131461"
     CDS             complement(237752..238186)
                     /gene="mgsA"
                     /locus_tag="DehaBAV1_0233"
                     /EC_number="4.2.3.3"
                     /note="catalyzes the formation of methylglyoxal from
                     glycerone phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="methylglyoxal synthase"
                     /protein_id="YP_001213700.1"
                     /db_xref="GI:147668882"
                     /db_xref="InterPro:IPR004363"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="GeneID:5131461"
                     /translation="MERITLALVAHDNKKQEMVELVKKHETDLASLNLVATRTTGKLI
                     QASTSLNVTLLQSGPLGGDQQIGAMVASGVVTAIIFLRDPLTAQPHEPDISALMRVCD
                     VHNVPLATNVSTAEAVLHLIFEHPEELKEHRLKSQLLNSLNS"
     misc_feature    complement(237830..238174)
                     /gene="mgsA"
                     /locus_tag="DehaBAV1_0233"
                     /note="Methylglyoxal synthase catalyzes the enolization of
                     dihydroxyacetone phosphate (DHAP) to produce
                     methylglyoxal. The first part of the catalytic mechanism
                     is believed to be similar to TIM (triosephosphate
                     isomerase) in that both enzymes utilize DHAP to...;
                     Region: MGS; cd01422"
                     /db_xref="CDD:238710"
     misc_feature    complement(order(237917..237919,237998..238000,
                     238013..238018,238067..238072,238076..238078,
                     238142..238144,238160..238162))
                     /gene="mgsA"
                     /locus_tag="DehaBAV1_0233"
                     /note="active site"
                     /db_xref="CDD:238710"
     misc_feature    complement(order(237836..237838,237845..237856,
                     237863..237880,237884..237892,237899..237901,
                     237908..237910,237935..237937,237974..237976,
                     237992..237997,238007..238012,238016..238021,
                     238070..238072,238151..238153))
                     /gene="mgsA"
                     /locus_tag="DehaBAV1_0233"
                     /note="dimer interfaces [polypeptide binding]; other site"
                     /db_xref="CDD:238710"
     misc_feature    complement(order(237917..237919,237998..238000))
                     /gene="mgsA"
                     /locus_tag="DehaBAV1_0233"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238710"
     gene            complement(238395..240140)
                     /locus_tag="DehaBAV1_0234"
                     /db_xref="GeneID:5132250"
     CDS             complement(238395..240140)
                     /locus_tag="DehaBAV1_0234"
                     /EC_number="2.7.13.3"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region, ATPase domain protein; histidine
                     kinase, HAMP region domain protein; histidine kinase A
                     domain protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_001213701.1"
                     /db_xref="GI:147668883"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5132250"
                     /translation="MTRSLKWRLITLFCLLIAGCVGILSIFLSNHLENSYMDNLQSRL
                     IQEVTLFSRVVPEYITESPDSFDAGVKKLGASLDIRLTVIALDGQVLADSLQLPSEME
                     NHSTRIEFIDALASGIGISIHPSASLGYEMLYVATLVKSGQDVLAVARVALPVEEVYA
                     AVREVDRTILLGAVISILAAGLLAVWVAASVTRPVKELTAISRRIAQGQMDTIQIDVS
                     GKGEMEELAKAFRLMTERLRDSIKAVSSERDHLSAVLERMGDGIFLLDREGSINLLNH
                     ASERIFKLEAGGVIGHSFVEAIRDHEINAVFERAKSSGKQEMGFVELTAGKRFLGIIA
                     TPLVSQSGYLVLVQDLSELRRLEKVRRDFVANISHELRTPITSLKLLTETLQEGAASD
                     PDVAAGFIDKIHLEVDKLAQLVTELSDLSAIESGQAVLNLQPGDIRTAIKLAAERLSP
                     QAERAGIILGVELPETLPQVRLDENRVEQVLVNLVHNAIKFTPKGGKIKIGVRTQSQT
                     LVVYVTDSGIGIPEDDLTRVFERFYKVDKSRSGGGTGLGLAISKHIVQAHGGSIWAES
                     VYGKGATFSFSLPLA"
     sig_peptide     complement(240042..240140)
                     /locus_tag="DehaBAV1_0234"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.936) with cleavage site probability 0.494 at
                     residue 33"
     misc_feature    complement(238404..239726)
                     /locus_tag="DehaBAV1_0234"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: VicK; COG5002"
                     /db_xref="CDD:227335"
     misc_feature    complement(239424..239570)
                     /locus_tag="DehaBAV1_0234"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(239430..239435,239442..239447,
                     239451..239456,239463..239468,239472..239477,
                     239526..239528,239532..239537,239544..239549,
                     239553..239558,239565..239570))
                     /locus_tag="DehaBAV1_0234"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(<239214..239369)
                     /locus_tag="DehaBAV1_0234"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(239241..239252,239289..239291,
                     239307..239309,239319..239321))
                     /locus_tag="DehaBAV1_0234"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(239214..239216,239223..239225,
                     239247..239249,239259..239261))
                     /locus_tag="DehaBAV1_0234"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(238878..239072)
                     /locus_tag="DehaBAV1_0234"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(238890..238892,238902..238904,
                     238911..238913,238923..238925,238932..238934,
                     238944..238946,238998..239000,239007..239009,
                     239019..239021,239028..239030,239040..239042,
                     239052..239054))
                     /locus_tag="DehaBAV1_0234"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(239034..239036)
                     /locus_tag="DehaBAV1_0234"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(238407..238709)
                     /locus_tag="DehaBAV1_0234"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(238419..238421,238425..238430,
                     238443..238445,238449..238451,238497..238508,
                     238581..238586,238590..238592,238596..238598,
                     238602..238604,238671..238673,238680..238682,
                     238692..238694))
                     /locus_tag="DehaBAV1_0234"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(238680..238682)
                     /locus_tag="DehaBAV1_0234"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(238500..238502,238506..238508,
                     238584..238586,238590..238592))
                     /locus_tag="DehaBAV1_0234"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(240143..240835)
                     /locus_tag="DehaBAV1_0235"
                     /db_xref="GeneID:5132406"
     CDS             complement(240143..240835)
                     /locus_tag="DehaBAV1_0235"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001213702.1"
                     /db_xref="GI:147668884"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5132406"
                     /translation="MPEHKILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALSVYR
                     LFKPALVILDVMIPGIDGFELCRLIRAESSVPILMLTARSSEADKVNGLEAGADDYLS
                     KPFGMKELLARMRALLRRSQMLNSQADIAGGLKIGDLEIFIERHLVIRNGVALDFSPK
                     EFDLFSFLVQNRYRVFSREQLLEKVWGYDYPGGTRTVDVHISWLRQKIEVDPSKPRHL
                     ITVRGTGYKFEE"
     misc_feature    complement(240146..240826)
                     /locus_tag="DehaBAV1_0235"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(240482..240817)
                     /locus_tag="DehaBAV1_0235"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(240524..240529,240536..240538,
                     240593..240595,240650..240652,240674..240676,
                     240803..240808))
                     /locus_tag="DehaBAV1_0235"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(240674..240676)
                     /locus_tag="DehaBAV1_0235"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(240650..240658,240662..240667))
                     /locus_tag="DehaBAV1_0235"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(240521..240529)
                     /locus_tag="DehaBAV1_0235"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(240152..240436)
                     /locus_tag="DehaBAV1_0235"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(240161..240163,240176..240178,
                     240212..240217,240239..240241,240248..240250,
                     240302..240307,240362..240364))
                     /locus_tag="DehaBAV1_0235"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            240968..241387
                     /locus_tag="DehaBAV1_0236"
                     /db_xref="GeneID:5132389"
     CDS             240968..241387
                     /locus_tag="DehaBAV1_0236"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213703.1"
                     /db_xref="GI:147668885"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:5132389"
                     /translation="MKMPLNIFKRESGFTLIEILVVVAILGALAGVVIPNVIKFMHEG
                     KVESANTELANVRLAVLSAMVDVKTNTLNDGGTVGPGHTSSVTYGSPSVSLPVHNFIM
                     GAVIGIYTLDEKGLIASAEMPEDSDWAGLTFVNGAWQ"
     misc_feature    240992..>241162
                     /locus_tag="DehaBAV1_0236"
                     /note="Type II secretory pathway, pseudopilin PulG [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PulG; COG2165"
                     /db_xref="CDD:225076"
     misc_feature    <240992..241054
                     /locus_tag="DehaBAV1_0236"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; pfam13544"
                     /db_xref="CDD:257863"
     gene            241477..241689
                     /locus_tag="DehaBAV1_0237"
                     /db_xref="GeneID:5132432"
     CDS             241477..241689
                     /locus_tag="DehaBAV1_0237"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213704.1"
                     /db_xref="GI:147668886"
                     /db_xref="GeneID:5132432"
                     /translation="MQIPEAVCTKCGGHYHGWALLNARHQSCAQCGGKLVITTEDEII
                     QGYSPFSAEEVNLKAPKQTPSKKTQS"
     misc_feature    <241498..241647
                     /locus_tag="DehaBAV1_0237"
                     /note="DNA polymerase, archaeal type II, large subunit;
                     Region: polC; TIGR00354"
                     /db_xref="CDD:232935"
     gene            complement(241693..242652)
                     /locus_tag="DehaBAV1_0238"
                     /db_xref="GeneID:5132445"
     CDS             complement(241693..242652)
                     /locus_tag="DehaBAV1_0238"
                     /EC_number="1.4.1.1"
                     /note="PFAM: ornithine cyclodeaminase/mu-crystallin"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine dehydrogenase"
                     /protein_id="YP_001213705.1"
                     /db_xref="GI:147668887"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="GeneID:5132445"
                     /translation="MPTLILSRKDISGLISMPVVIQAVEQAFKDWAVGLADMPSKVYL
                     TLPGGDFRAMPASLPGAAGIKWVNVHPGNRALHMPTVMGLIIYSDPDTGYPLAIMDGT
                     DITAYRTGAAAAIASRYLARQDATTLGIIGAGRQAITQIMAHKVLFELREIRVYDISP
                     DAGLRLIEYFPDLNIRQTSLEETAASDIICTLTTSTKPVLFLKHLKPGCHINAVGADA
                     PGKQELDPLILKQAVVVVDDMDQAIHAGELNVPVKAGAFNKEMVKANLGQILMGGKSG
                     RSSVRDITVFDSTGVAIEDIAVAKWLYQRASNLGTFLSLPLVE"
     misc_feature    complement(241708..242652)
                     /locus_tag="DehaBAV1_0238"
                     /note="Predicted ornithine cyclodeaminase, mu-crystallin
                     homolog [Amino acid transport and metabolism]; Region:
                     COG2423"
                     /db_xref="CDD:225280"
     misc_feature    complement(241723..242652)
                     /locus_tag="DehaBAV1_0238"
                     /note="Shikimate / quinate 5-dehydrogenase; Region:
                     Shikimate_DH; cl19124"
                     /db_xref="CDD:267477"
     gene            242759..243331
                     /locus_tag="DehaBAV1_0239"
                     /db_xref="GeneID:5131999"
     CDS             242759..243331
                     /locus_tag="DehaBAV1_0239"
                     /note="PFAM: Rhomboid family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="YP_001213706.1"
                     /db_xref="GI:147668888"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="GeneID:5131999"
                     /translation="MKFSNYRNQPDVILLIIITCVVVFFGVNFVPQLGPYLALQPATA
                     ISHPWTIVTSLFVHADLWHLFANMLTLYFFGNALLQMISQRSWLIIFFGGGLAGSLLF
                     ILLNAGSYGYVIGASGAVFALGGALAVLRPNSKVMVFPLPIPIPLWIAVIGSFIILSF
                     LPSVAWQGHLGGLLVGLACGYLIQQGKFKF"
     misc_feature    <242900..243259
                     /locus_tag="DehaBAV1_0239"
                     /note="Membrane associated serine protease [Amino acid
                     transport and metabolism]; Region: COG0705"
                     /db_xref="CDD:223777"
     gene            243476..243868
                     /locus_tag="DehaBAV1_0240"
                     /db_xref="GeneID:5132007"
     CDS             243476..243868
                     /locus_tag="DehaBAV1_0240"
                     /note="PFAM: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_001213707.1"
                     /db_xref="GI:147668889"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:5132007"
                     /translation="MTDKKYRVLVVEDEPSICQVCLRTLEGMGLDVTIAINGQIGQSL
                     IQRDTFDLCLVDIRTPVMNGKNLYAYVLNHYPNIAKRIIFTTGDLLDETTRGFLDATG
                     QPFLPKPFTPNDLKTIITETFQKLGEQN"
     misc_feature    243500..243832
                     /locus_tag="DehaBAV1_0240"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(243509..243514,243641..243643,243665..243667,
                     243731..243733,243788..243790,243797..243802)
                     /locus_tag="DehaBAV1_0240"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    243641..243643
                     /locus_tag="DehaBAV1_0240"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(243650..243655,243659..243667)
                     /locus_tag="DehaBAV1_0240"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    243797..243805
                     /locus_tag="DehaBAV1_0240"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            243949..244320
                     /locus_tag="DehaBAV1_0241"
                     /db_xref="GeneID:5131965"
     CDS             243949..244320
                     /locus_tag="DehaBAV1_0241"
                     /note="PFAM: response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_001213708.1"
                     /db_xref="GI:147668890"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:5131965"
                     /translation="MSKIKILIADDEEHIRQLVCSILDKGYQIVQARNGEEAVKESRE
                     QNFDLILMDIMMPKLDGLAACCMLKGDKQTSSTPIIMLTGVGYELNKKLSQQLGADGY
                     ITKPFNPQELRNKVSEFIKHD"
     misc_feature    243961..>244296
                     /locus_tag="DehaBAV1_0241"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    243967..244308
                     /locus_tag="DehaBAV1_0241"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(243976..243981,244105..244107,244129..244131,
                     244195..244197,244252..244254,244261..244266)
                     /locus_tag="DehaBAV1_0241"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    244105..244107
                     /locus_tag="DehaBAV1_0241"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(244114..244119,244123..244131)
                     /locus_tag="DehaBAV1_0241"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    244261..244269
                     /locus_tag="DehaBAV1_0241"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            244313..244729
                     /locus_tag="DehaBAV1_0242"
                     /db_xref="GeneID:5131972"
     CDS             244313..244729
                     /locus_tag="DehaBAV1_0242"
                     /note="PFAM: protein of unknown function UPF0047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213709.1"
                     /db_xref="GI:147668891"
                     /db_xref="InterPro:IPR001602"
                     /db_xref="GeneID:5131972"
                     /translation="MTDALPLYRLEIPSHSQTEFIDITPQIRSVIHQSGITSGLCLIF
                     VPHTTAGLTINENADPDVITDIKAQLEQIVPSVTPFLHAEGNSAAHVKTSLMGNSLNL
                     IIEEGMILLGTWQGIYLAEFDGPRKRTVNIKILKEK"
     misc_feature    244373..244717
                     /locus_tag="DehaBAV1_0242"
                     /note="Uncharacterized protein family UPF0047; Region:
                     UPF0047; pfam01894"
                     /db_xref="CDD:250947"
     gene            244769..246160
                     /locus_tag="DehaBAV1_0243"
                     /db_xref="GeneID:5132002"
     CDS             244769..246160
                     /locus_tag="DehaBAV1_0243"
                     /EC_number="6.3.5.-"
                     /EC_number="6.3.5.9"
                     /note="responsible for the amidation of carboxylic groups
                     at position A and C of cobyrinic acid or hydrogenobrynic
                     acid"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_001213710.1"
                     /db_xref="GI:147668892"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR004484"
                     /db_xref="InterPro:IPR011698"
                     /db_xref="GeneID:5132002"
                     /translation="MNFPRIVIAGVSSSSGKTTISSGLTAALAQRGHKVAAYKCGPDY
                     IDPGYLTLASNNPCHNLDSWMLSKDAMTEVFFHGLKNRDIALVEGVMGLYDGYSGERP
                     GGSTAEIARLLSAPVILLVNISHMAESAAAIVLGYKNLDPRINIAGVILNQAGSTRHY
                     EICRKAIEKYASTPVIGYLLRNKDLVIPERHLGLKTTSEGGELETFIQNLATRIESTI
                     DIDRILEIARNAPPLPEKPLPCLFPETPACPVTRIAVAKDEAFSFYYQANLDMLSDWG
                     AELCYFSPVHDTCLPPDIGGIYIGGGFPEIMAAELSANQPMKDTLTKAAADGMPIYAE
                     CGGLMYLSEAIEDFDSTKYLMLGLLPGISVMQKKLHRLGYTRAAVQNDNILSAKGTEL
                     RGHIFHWSKLPSPQTKPAYTLLEPAEFIGQNEGFIVGGSTNVLASYLHLHFGTNPDLA
                     KNFIRISKDFCTI"
     misc_feature    244769..246148
                     /locus_tag="DehaBAV1_0243"
                     /note="cobyrinic acid a,c-diamide synthase; Validated;
                     Region: PRK01077"
                     /db_xref="CDD:234896"
     misc_feature    244784..>244903
                     /locus_tag="DehaBAV1_0243"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cd01983"
                     /db_xref="CDD:238941"
     misc_feature    245525..246130
                     /locus_tag="DehaBAV1_0243"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyrinic Acid a,c-Diamide Synthase; Region:
                     GATase1_CobB; cd03130"
                     /db_xref="CDD:153224"
     misc_feature    order(245771..245773,246092..246094,246098..246100)
                     /locus_tag="DehaBAV1_0243"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153224"
     gene            246239..249426
                     /locus_tag="DehaBAV1_0244"
                     /pseudo
                     /db_xref="GeneID:5132268"
     gene            complement(249514..250638)
                     /locus_tag="DehaBAV1_0245"
                     /db_xref="GeneID:5132110"
     CDS             complement(249514..250638)
                     /locus_tag="DehaBAV1_0245"
                     /EC_number="2.4.2.18"
                     /note="TIGRFAM: anthranilate phosphoribosyltransferase;
                     PFAM: glycosyl transferase, family 3"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="YP_001213711.1"
                     /db_xref="GI:147668893"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /db_xref="GeneID:5132110"
                     /translation="MDENRVKNFGAVISRLISKENLSREEVKDCFSQIMRNEQPDLQQ
                     GAFMAALTAKGETASEIAGVWEAIYEQDTVRVKLQVNKPVVDNCGTGMDSLKTFNIST
                     AASIVAAAGGVVLAKHGARALSGSCGTIDMLESLGVDVETDVETVKRSIETVGIGIFN
                     GMSAKVHPQALFRILSQIRFGTTLNIAGSLANPALPHYAVRGVYSSELLQPVAEVMRE
                     IGYKKALVIFGSAPGGRGMDELSNLGESRIAELGEDGQITEYSLSPADFGLKVRQAED
                     ILTSGDKQGETLRLLRILSGNENGAAFEVVCLNTAPVFYVAGAVSSLREGYAKAAEII
                     RSGVAIAKLRQWIQAQNANPEAGIARLESLLGELDGAKIS"
     misc_feature    complement(250429..250617)
                     /locus_tag="DehaBAV1_0245"
                     /note="Glycosyl transferase family, helical bundle domain;
                     Region: Glycos_trans_3N; pfam02885"
                     /db_xref="CDD:251593"
     misc_feature    complement(249583..250602)
                     /locus_tag="DehaBAV1_0245"
                     /note="anthranilate phosphoribosyltransferase;
                     Provisional; Region: trpD; PRK00188"
                     /db_xref="CDD:234682"
     misc_feature    complement(249622..250398)
                     /locus_tag="DehaBAV1_0245"
                     /note="Glycosyl transferase family, a/b domain; Region:
                     Glycos_transf_3; pfam00591"
                     /db_xref="CDD:249986"
     gene            complement(250653..251684)
                     /locus_tag="DehaBAV1_0246"
                     /db_xref="GeneID:5131993"
     CDS             complement(250653..251684)
                     /locus_tag="DehaBAV1_0246"
                     /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_001213712.1"
                     /db_xref="GI:147668894"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:5131993"
                     /translation="MKAVLLEKPGELRLAEVVTPYCPKGGVLLKVLCCAICGTDVKMF
                     RRGHRDLEYPRILGHEIAAEVVCSGHPDFEVGCRVQVYPGIACGVCPLCLQGRENLCR
                     KVKIIGFNYDGGLAEYMALPPESLPVGLNIIPEHVSDEEASLAEPLASCIHAQSVCRV
                     GDGDRVLVLGAGPLGLLQAMLARHNGAEQVLVAEVLPERVNGAELASPDGIIDLGKTS
                     LKQGVFDQTGRAGVDVILIASSGVEVGELPFILSPGGRINFFSGLPKDRSELIIDANA
                     VHYQELVINGSYGSTAADNAEALRLIGKGIIPVKRLLSRITGISDIEAAFLGVERLDG
                     LKTVIKFHK"
     misc_feature    complement(250662..251684)
                     /locus_tag="DehaBAV1_0246"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    complement(250665..251684)
                     /locus_tag="DehaBAV1_0246"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     misc_feature    complement(order(250818..250826,250902..250907,
                     250968..250973,251043..251045,251088..251090,
                     251100..251105,251160..251177,251235..251237,
                     251247..251249,251559..251561,251568..251576))
                     /locus_tag="DehaBAV1_0246"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176178"
     misc_binding    complement(251798..251990)
                     /note="Cobalamin riboswitch as predicted by Rfam
                     (RF00174), score 106.60"
                     /bound_moiety="adenosylcobalamin"
     gene            252226..254028
                     /locus_tag="DehaBAV1_0247"
                     /db_xref="GeneID:5132012"
     CDS             252226..254028
                     /locus_tag="DehaBAV1_0247"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_001213713.1"
                     /db_xref="GI:147668895"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5132012"
                     /translation="MAKTKKPVEKLEPAEETKKDGKVVSTKRTKGSEFFWTQSRCTGC
                     NRCASVCPVDAIKLERDKMPTKRVGTSPCTRACPAGLDIPRYVRFVADGNAPAATAVM
                     REKIPFPSVCGYVCFHPCELECQRQKFDEPIAIRALKRYAAENDDGSWKNNLKIAPPT
                     GKKVAIIGSGPTGLTSAYFLTLLGHEATIFESMEYAGGKMFYSIPEHQLPKEILNKEI
                     KTITDLGVTIHTSCQVQSVQTLFKQGYDSVLLSTGVLGVDEGLLLPCDETAKSDLIKG
                     SDFLKGIKSTTKETLGDKVIVIGGGSEAYNSAFAAKNLGVSEVNLVCSRHTGSKEASP
                     EEVDRAIDAGVTVQPSLDFVKLVKLNDKIEGVELFRIRSYGYDKENKLHYEIINDTRR
                     LISADTIITTVAQNDKPGSDYLSVVQPGVFAAGDGISGARSVIEAMAAGRSVAGLIDK
                     YLGGEGNLDETLAPPEKTIKPLGEPKSQNRSQVELNLVKQAGGDKVEIEKTLSPNAAK
                     KEAQRCLRCDIVHQVHDYSLDTSSCTYCGRCVDACYWDAITNGYGYEAAAKKRKAEAA
                     ALEEKNSVYNYAIRILPIAIGLMILAAAIAKLST"
     misc_feature    <252340..252489
                     /locus_tag="DehaBAV1_0247"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     misc_feature    252343..252465
                     /locus_tag="DehaBAV1_0247"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     misc_feature    <252430..252663
                     /locus_tag="DehaBAV1_0247"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     misc_feature    252439..253581
                     /locus_tag="DehaBAV1_0247"
                     /note="NADPH-dependent glutamate synthase beta chain and
                     related oxidoreductases [Amino acid transport and
                     metabolism / General function prediction only]; Region:
                     GltD; COG0493"
                     /db_xref="CDD:223567"
     misc_feature    252721..252954
                     /locus_tag="DehaBAV1_0247"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    253801..253872
                     /locus_tag="DehaBAV1_0247"
                     /note="4Fe-4S binding domain; Region: Fer4; pfam00037"
                     /db_xref="CDD:249530"
     gene            254159..254446
                     /locus_tag="DehaBAV1_0248"
                     /db_xref="GeneID:5132015"
     CDS             254159..254446
                     /locus_tag="DehaBAV1_0248"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213714.1"
                     /db_xref="GI:147668896"
                     /db_xref="GeneID:5132015"
                     /translation="MKQLNDDEIYRIAQKRVKEKKDFYNHLSVYVVINAMIIGIWAFT
                     GSSYPWFIFPLGGWGIGLIFHFLSVFGFMRDESDWESKEIQKEIGRLKKNL"
     misc_feature    254186..254428
                     /locus_tag="DehaBAV1_0248"
                     /note="2TM domain; Region: 2TM; pfam13239"
                     /db_xref="CDD:257596"
     gene            complement(254443..255939)
                     /locus_tag="DehaBAV1_0249"
                     /db_xref="GeneID:5132029"
     CDS             complement(254443..255939)
                     /locus_tag="DehaBAV1_0249"
                     /EC_number="6.4.1.1"
                     /note="catalyzes the ATP-dependent carboxylation of a
                     covalently attached biotin and the transfer of the
                     carboxyl group to pyruvate forming oxaloacetate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase subunit A"
                     /protein_id="YP_001213715.1"
                     /db_xref="GI:147668897"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR003806"
                     /db_xref="InterPro:IPR004549"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="GeneID:5132029"
                     /translation="MLNKILVANRGEIAIRVMRACRELGIKTVAVYSDADKGALFVKY
                     ADEAYHIGPSQLSESYLNIKKIVAVAKKSGVDGVHPGYGFLSENPGFALALEKAGIKF
                     VGPSSRVIELMGNKIAARREMKKAGVPVLPGTEGCVSGIEQATEAAAAIGYPVIIKPS
                     GGGGGIGMRVANGPDELKDAIESSQKVAGNTFGLAEVYIEKYISNPRHIEIQIMGDSQ
                     GNIVYLGERECSIQRRYQKLIEESPSPVITPELRKKMGEVAVKAGKWVNYEGAGTIEF
                     IFSNGQFYFLEANTRVQVEHPVTEMVTGIDIVKEQIMVASGSELSFKQEEVEMRGWAI
                     ECRINAEDPLNEFAPSAAKLKGYRSPGGIGVRVDSGVHTRYNIPYLYDPMISKLIVWG
                     RTREEAIARMRRALYEYIIVGVKTNIPFHKAVMVNPNFVAGNLHTHFIEKETTLLDEM
                     KRIMSEEQPLEEKLSEIFDDTRRIAAIAAVTALTQLPAEIDEDEITGV"
     misc_feature    complement(254446..255939)
                     /locus_tag="DehaBAV1_0249"
                     /note="pyruvate carboxylase subunit A; Validated; Region:
                     PRK08654"
                     /db_xref="CDD:236325"
     misc_feature    complement(255613..255936)
                     /locus_tag="DehaBAV1_0249"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(254971..255594)
                     /locus_tag="DehaBAV1_0249"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(254617..254937)
                     /locus_tag="DehaBAV1_0249"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            complement(255932..257680)
                     /locus_tag="DehaBAV1_0250"
                     /db_xref="GeneID:5131990"
     CDS             complement(255932..257680)
                     /locus_tag="DehaBAV1_0250"
                     /EC_number="6.4.1.1"
                     /note="catalyzes the formation of oxaloacetate from
                     pyruvate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase subunit B"
                     /protein_id="YP_001213716.1"
                     /db_xref="GI:147668898"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005776"
                     /db_xref="GeneID:5131990"
                     /translation="MGIKITDTTLRDAHQSLIATRMRTRDMIDIAARLDKAGFHSLEV
                     WGGATFDSCIRFLNEDPWERLRLIRQKAPNTPLQMLLRGQNLVGYRHYADDVVREFVR
                     LSVKNGIDIFRVFDALNDIRNMEVSIQTAKELKAHVQGTICYTTSPIHTVEKLAEMAV
                     ELEKMGCDSICIKDMAGLITPTAAAQLVKSIKSKVKLPVDLHSHCTSGMAPLAYYAAA
                     EAGVDIIDTAFSAFAWGTSQPTTESFVAAFKGTKLDTGLDLELMSEIGEEFNKISASY
                     RCLYTCEATQPSISVLLHQIPGGMISNLVSQLRQQNAFDKLSEVLAEVPRVRADLGHP
                     PLVTPSSQIVGTQAILNVLSGERYKQVTKETKNYLMGYYGKIPGKVNEDIRKAIIGDE
                     KPISVRPGALLEPELPKMKAEGEKLGILKTEEDLLTYAMYPEVAAKFLKGECKEECLL
                     PSTPEAAKPVKTEAKPVPAFSGSAEYSVEVDGEVFTVKVSAKAGVAGEAPKALKPTAS
                     HPGAIVSPMQGMLLSLKVKEGDKVTEGEVVATIEAMKMENDVCATVNGVVVGIYAYEG
                     EVVGSKDVIMVIEPDA"
     misc_feature    complement(255941..257680)
                     /locus_tag="DehaBAV1_0250"
                     /note="pyruvate carboxylase subunit B; Validated; Region:
                     PRK09282"
                     /db_xref="CDD:236449"
     misc_feature    complement(256847..257668)
                     /locus_tag="DehaBAV1_0250"
                     /note="Pyruvate carboxylase and Transcarboxylase 5S,
                     carboxyltransferase domain; Region: DRE_TIM_PC_TC_5S;
                     cd07937"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(256967..256969,257069..257071,
                     257075..257077,257162..257164,257252..257254,
                     257435..257437,257441..257443,257540..257542,
                     257552..257554,257636..257638,257645..257650))
                     /locus_tag="DehaBAV1_0250"
                     /note="active site"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(257552..257554,257645..257650))
                     /locus_tag="DehaBAV1_0250"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(257069..257071,257075..257077,
                     257162..257164,257645..257647))
                     /locus_tag="DehaBAV1_0250"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(256892..256894,256934..256936,
                     256952..256954,256982..256984,256988..256993,
                     257033..257038,257048..257050,257054..257056,
                     257060..257062,257135..257137,257141..257143))
                     /locus_tag="DehaBAV1_0250"
                     /note="homodimer binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163675"
     misc_feature    complement(256217..256810)
                     /locus_tag="DehaBAV1_0250"
                     /note="Conserved carboxylase domain; Region: PYC_OADA;
                     pfam02436"
                     /db_xref="CDD:251291"
     misc_feature    complement(255947..256147)
                     /locus_tag="DehaBAV1_0250"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(256022..256024,256043..256051,
                     256076..256078))
                     /locus_tag="DehaBAV1_0250"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(256046..256048)
                     /locus_tag="DehaBAV1_0250"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            257974..258516
                     /locus_tag="DehaBAV1_0251"
                     /db_xref="GeneID:5132030"
     CDS             257974..258516
                     /locus_tag="DehaBAV1_0251"
                     /note="TIGRFAM: DJ-1 family protein;
                     PFAM: ThiJ/PfpI domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DJ-1 family protein"
                     /protein_id="YP_001213717.1"
                     /db_xref="GI:147668899"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR006287"
                     /db_xref="GeneID:5132030"
                     /translation="MSRFAVLLAEGFEEIEFCTITDILRRADLEVKIVGLKNDLTGGS
                     RGIRIMPDIHIDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHAENKYLAAIC
                     AGPAVLSRAGVIDGKEVAIYPGVKHLLKNCTACDLRVKVEGRLITGRSPQAAMDFALT
                     LMDMFAKPQSAKVVRDEMLV"
     misc_feature    257980..258501
                     /locus_tag="DehaBAV1_0251"
                     /note="DJ-1 family protein; Region: not_thiJ; TIGR01383"
                     /db_xref="CDD:213612"
     misc_feature    257986..258468
                     /locus_tag="DehaBAV1_0251"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in Human DJ-1; Region: GATase1_DJ-1; cd03135"
                     /db_xref="CDD:153229"
     misc_feature    258277..258279
                     /locus_tag="DehaBAV1_0251"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153229"
     gene            258696..259334
                     /locus_tag="DehaBAV1_0252"
                     /db_xref="GeneID:5132041"
     CDS             258696..259334
                     /locus_tag="DehaBAV1_0252"
                     /note="PFAM: regulatory protein, TetR"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001213718.1"
                     /db_xref="GI:147668900"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:5132041"
                     /translation="MAKAKQNNISRDKILSAATHLFLNSHDAGKVSIEDIAVKANVSP
                     TTIYNNFGGRKALVLGVVEKIIDNSLIQSKDIMARPLPFPAKIQLILSNKNDMAGKMP
                     EEILKKLVNMDDDVTALIQEIYQQEIQPMWQKLIADGKAEGYVDPSLSEEAVFIYLKV
                     VRDGFNANAALFEPAKEKINLMMELSRIMMYGFFKKDACLIPDIKSGHAKTG"
     misc_feature    258696..259250
                     /locus_tag="DehaBAV1_0252"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    258735..258878
                     /locus_tag="DehaBAV1_0252"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            259346..260212
                     /locus_tag="DehaBAV1_0253"
                     /db_xref="GeneID:5131977"
     CDS             259346..260212
                     /locus_tag="DehaBAV1_0253"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_001213719.1"
                     /db_xref="GI:147668901"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5131977"
                     /translation="MSQISISVEKLSYWYGDLKAVNQISFEVAQGEILGFLGPNGAGK
                     TTTQKMLTGQLRPKDGRATLLGFDVAKDTEEIHRRIGICFEQTNLYEQMNALENLQLF
                     ADLFGVNNFNGYALLKRVGLAGREKDKVAGYSKGMKQRLMVARSLVNTPSILFMDEPT
                     SGLDPVSSESIRDIILEERKRGATIFLTTHDMWEADKLCDRVAFINEGSIAALDAPVN
                     LKQQYGKRSLIAKVKSANGQLENREIALDTGKTAEEVSKLLSSERVLTLHSEEATLED
                     IFIKITGRRLTE"
     misc_feature    259361..260197
                     /locus_tag="DehaBAV1_0253"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    259361..260005
                     /locus_tag="DehaBAV1_0253"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    259457..259480
                     /locus_tag="DehaBAV1_0253"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(259466..259471,259475..259483,259598..259600,
                     259814..259819,259913..259915)
                     /locus_tag="DehaBAV1_0253"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    259589..259600
                     /locus_tag="DehaBAV1_0253"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    259742..259771
                     /locus_tag="DehaBAV1_0253"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    259802..259819
                     /locus_tag="DehaBAV1_0253"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    259826..259837
                     /locus_tag="DehaBAV1_0253"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    259901..259921
                     /locus_tag="DehaBAV1_0253"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            260209..261267
                     /locus_tag="DehaBAV1_0254"
                     /db_xref="GeneID:5132016"
     CDS             260209..261267
                     /locus_tag="DehaBAV1_0254"
                     /note="PFAM: ABC-2 type transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_001213720.1"
                     /db_xref="GI:147668902"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="GeneID:5132016"
                     /translation="MNFSVIKALLKKDFSLFLQNRFYMLMTIVGLVFYIIIFFIMPNK
                     VDEQLKAGIYAPVMPPAFSILVADPASSLTSYASLEEAKAAVENGDSQVAIVLPADIM
                     QTWASGGKPEVEIYYASSAPLELRDAVISLVKELSYIQTGQSLTFDTNEQVMGQDMLG
                     EQIPMRNRMVPLLAIFILMMEILSLASLIAEENEQGTARALLVTPMTVPELFAAKGII
                     GVGMALGQVVLFMLLVGGFNSQPLITLGVLLLGSLMVTGLGFLLASLTKSLMSVTTWG
                     MLLFIILAIPGMGIMFPGLISNWAKVIPSYYLTDTVNRVVNYGADLSVVGGNLLILVG
                     FTAVIVTAGIVVLRRRYQ"
     misc_feature    <260713..261243
                     /locus_tag="DehaBAV1_0254"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_3; pfam12698"
                     /db_xref="CDD:257232"
     misc_feature    <260719..261258
                     /locus_tag="DehaBAV1_0254"
                     /note="Acyltransferase family; Region: Acyl_transf_3;
                     cl19154"
                     /db_xref="CDD:267507"
     gene            261264..262337
                     /locus_tag="DehaBAV1_0255"
                     /db_xref="GeneID:5132418"
     CDS             261264..262337
                     /locus_tag="DehaBAV1_0255"
                     /note="PFAM: ABC-2 type transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_001213721.1"
                     /db_xref="GI:147668903"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="GeneID:5132418"
                     /translation="MSIKHIITLFNREVIHGPKDVTFIMVVVTPILISLFISLAFGNI
                     FSEKPKLGLTDLGNSQIVNLLKENNTLLIKEYPDEAALKEAATSGAVDMGLVLPADFD
                     TSLIQTNTLKANAYVWGESLAKSRMIIPAVLADTARQITGANVPVEINSISLGDEMNV
                     PWADRLFPFVVLMAMFFSGLMLPASSLIDEKQKRTLEAVNITPATLGEIFTAKGAIGT
                     LLGVVMGLIILALNSAFGNSPLPLILMLGLGSLMASLLGLLAGAFIKDMNTLFAVWKF
                     GGLLLFGPAFIYLFPQIPQWIGYFFPTYYILKPVVDLSVYDAGWTDIALNAGISVILV
                     VILLVAVSKVVSRMSNSALRLYT"
     misc_feature    261324..262286
                     /locus_tag="DehaBAV1_0255"
                     /note="ABC-type Na+ efflux pump, permease component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatB; COG1668"
                     /db_xref="CDD:224582"
     misc_feature    <261768..262184
                     /locus_tag="DehaBAV1_0255"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     cl17235"
                     /db_xref="CDD:266576"
     gene            263015..263818
                     /locus_tag="DehaBAV1_0256"
                     /db_xref="GeneID:5132340"
     CDS             263015..263818
                     /locus_tag="DehaBAV1_0256"
                     /EC_number="1.2.1.2"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit beta"
                     /protein_id="YP_001213722.1"
                     /db_xref="GI:147668904"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:5132340"
                     /translation="MPNGMLIDTTRCTGCRGCQVACKQWNENPAVKTTFSPEVTNPLE
                     QNAFNYNLLECREIEEDGKLQWIFAHKRCLHCYEPACVSVCPVGALHKRPNGAVVWDQ
                     DKCFGCRYCQNACPFEIPKFEWDDNWAKITKCTMCWNRVDEGMEPACAATCPTGAIKF
                     GERADLLAEAYERLSNNPDKYYPYVYGEKEAGGTHVLYLSSVHPEKLGFDMHEHEFFP
                     SFTREFLGNIPLEISIVASLMVGVWYFRGRRIQAQAHDAEHAENKAGKH"
     misc_feature    263024..263518
                     /locus_tag="DehaBAV1_0256"
                     /note="DMSO reductase, iron-sulfur subunit; Region:
                     DMSO_dmsB; TIGR02951"
                     /db_xref="CDD:131996"
     misc_feature    263210..263503
                     /locus_tag="DehaBAV1_0256"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            263871..264935
                     /locus_tag="DehaBAV1_0257"
                     /db_xref="GeneID:5132013"
     CDS             263871..264935
                     /locus_tag="DehaBAV1_0257"
                     /EC_number="1.12.99.6"
                     /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
                     PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit;
                     Nickel-iron dehydrogenase small subunit, N-terminal domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase (NiFe) small subunit HydA"
                     /protein_id="YP_001213723.1"
                     /db_xref="GI:147668905"
                     /db_xref="InterPro:IPR001821"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR013634"
                     /db_xref="GeneID:5132013"
                     /translation="MFNTKLTRRDFVQLAAGSTAALSLGALKLPEFEKMFAEALKEIP
                     VIWLQGAGCNGCTISTLNVVSPTIQDLLLTSVVPGTHVSMQFHPTIMAAQGDLAMNTI
                     TDTAAKGPFVLVIEGSVPLKDGGIYAEVGEKDGEGITLLEHVLNLAPKALAVVAAGTC
                     SAFGGITAAAPNPTGAKAVSEILKDHNITTPVVNLPGCPPHPDWVVGTLATVLMSGLD
                     ALDLDDMGRPKAYYGKLLHDQCPRRGHYEKGLFATKLSEPYCLFLVGCKGPVTYADCS
                     DRLWNNKTRWCVEADSPCIGCAHPGFPDAVSPMFEAPPVINSTDKLAIGIAGTAVVLT
                     AGVAAVELAKKAKRNAAKKG"
     misc_feature    263871..264890
                     /locus_tag="DehaBAV1_0257"
                     /note="Ni,Fe-hydrogenase I small subunit [Energy
                     production and conversion]; Region: HyaA; COG1740"
                     /db_xref="CDD:224654"
     sig_peptide     263871..263957
                     /locus_tag="DehaBAV1_0257"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.865) with cleavage site probability 0.580 at
                     residue 29"
     misc_feature    264027..264506
                     /locus_tag="DehaBAV1_0257"
                     /note="NADH ubiquinone oxidoreductase, 20 Kd subunit;
                     Region: Oxidored_q6; pfam01058"
                     /db_xref="CDD:250330"
     misc_feature    264564..264800
                     /locus_tag="DehaBAV1_0257"
                     /note="NiFe/NiFeSe hydrogenase small subunit C-terminal;
                     Region: NiFe_hyd_SSU_C; pfam14720"
                     /db_xref="CDD:258857"
     gene            264966..266546
                     /locus_tag="DehaBAV1_0258"
                     /db_xref="GeneID:5131996"
     CDS             264966..266546
                     /locus_tag="DehaBAV1_0258"
                     /note="PFAM: nickel-dependent hydrogenase, large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-dependent hydrogenase, large subunit"
                     /protein_id="YP_001213724.1"
                     /db_xref="GI:147668906"
                     /db_xref="InterPro:IPR001501"
                     /db_xref="GeneID:5131996"
                     /translation="MQKIVIDPITRIEGHLKIEATVDGGEVKDAKCVGTLFRGFEIFM
                     KDRDPRDAVHITQRICGVCPTSHGTTAALNLDAAFGVADKIPNNGRILRNLIQGANYI
                     ASHIVHFYHLAALDYVDVTEVADYDGTDPELLKVKDFIARALAAGDMSMLAPFYPRYE
                     GDYRLPKKVAQAAVAHYVEALNMRRLAHELSAIYSGRMPHSVAVVAGGVTSHPSIDSI
                     SSFMSKLNTLRHFIDNVYLPDVIAVAETYPDYFGIGVGCGNLLSYGVFDLEANGTNLA
                     TRQRLFTQGTVSASDLTLHTFDPNKITEDIKYGWFKGETNEYPLNEVTEPDHTKAEGY
                     SWLKAPRYENTPYEVGPLARMVVNYVAGDPVVQKMVNDTLAHFGAGPAALFSTLGRHA
                     ARALECKIVADEMVKWVMELKIGEPVCADYEIPESAEGMGLWEAPRGALGHWIKIENH
                     KISNYQCVVPSTWNCSPKDGQGVNGPVEQALIGTKVRDNDNPFELVRIVRSFDPCLAC
                     AVHLVSPTGNEISRFRVY"
     misc_feature    264966..266540
                     /locus_tag="DehaBAV1_0258"
                     /note="Ni,Fe-hydrogenase I large subunit [Energy
                     production and conversion]; Region: HyaB; COG0374"
                     /db_xref="CDD:223451"
     gene            266549..267031
                     /locus_tag="DehaBAV1_0259"
                     /db_xref="GeneID:5131995"
     CDS             266549..267031
                     /locus_tag="DehaBAV1_0259"
                     /note="TIGRFAM: hydrogenase maturation protease;
                     PFAM: peptidase M52, hydrogen uptake protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase maturation protease"
                     /protein_id="YP_001213725.1"
                     /db_xref="GI:147668907"
                     /db_xref="InterPro:IPR000671"
                     /db_xref="GeneID:5131995"
                     /translation="MFFNPGDESPKPILVLGTGNILLSDEGAGVRCVERLSRFPVPED
                     VELYDGGTAAMDLLDVISGREKMFILDAVHGGDEPGMIYRFRPEDIKTQPKIDISFHQ
                     MGLMEILNLAKYHDAIPKDIIIYGIQPGSMAPGFELTPAVDKAVNRVVEMMKEELGIK
                     "
     misc_feature    266579..267022
                     /locus_tag="DehaBAV1_0259"
                     /note="coenzyme F420-reducing hydrogenase delta subunit
                     (putative coenzyme F420 hydrogenase processing subunit);
                     Region: frhD; TIGR00130"
                     /db_xref="CDD:161726"
     misc_feature    266585..267019
                     /locus_tag="DehaBAV1_0259"
                     /note="Endopeptidases belonging to membrane-bound
                     hydrogenases group. These hydrogenases transfer electrons
                     from H2 to a cytochrome that is bound to a
                     membrane-located complex coupling electron transfer to
                     transmembrane proton translocation. Endopeptidase HybD...;
                     Region: H2MP_MemB-H2up; cd06062"
                     /db_xref="CDD:99873"
     misc_feature    order(266606..266608,266648..266650,266693..266701)
                     /locus_tag="DehaBAV1_0259"
                     /note="putative substrate-binding site; other site"
                     /db_xref="CDD:99873"
     misc_feature    order(266624..266626,266759..266761,266849..266851)
                     /locus_tag="DehaBAV1_0259"
                     /note="nickel binding site [ion binding]; other site"
                     /db_xref="CDD:99873"
     gene            complement(267098..269017)
                     /locus_tag="DehaBAV1_0260"
                     /db_xref="GeneID:5131515"
     CDS             complement(267098..269017)
                     /locus_tag="DehaBAV1_0260"
                     /note="PFAM: Endonuclease/exonuclease/phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase"
                     /protein_id="YP_001213726.1"
                     /db_xref="GI:147668908"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="GeneID:5131515"
                     /translation="MKKFFQEKPGAVEFLLPALVFTLAISLFPLFGSGMTWILGDRFG
                     QGAGVLGLIALTVFSLSFLAKPLRRFLCSYKAIIFSAGGVGILSLLAQIGFSEPLLNF
                     VCSALGLSLFGIFLCVYLDSARVRGPSAVGHFGAGAVFGLLLNAALSAGFGTYDLLNQ
                     PSFFPLLVSAVMVGFLLFLLTVHMPLAEGPAASNDGLGWLAIGPFLFLELVVFGNIAR
                     LSALSGFSSPVASMFVLGALSLGLVGILWVLSLSERHIRLLTLISSLCLILSLTGISD
                     GVAFVSLIQQVLGQLAVVLLFGVILRYIGGRKADGHSESLNLPSGLGMLVFVILLLGY
                     YAVYQVAVPYDNTVLELVAGLIVVGLALYSGRESLPLLDFKSDRFILPAMSVLLLTLP
                     LLGLLTYKTPPSPPQFEGSLRIMTYNLHNGFNTQGKLDMEALARVIEDSGADVVALQE
                     ISRGWVISGRVDMLEWLSQRLNMYSAFGATAGEYWGNAILSKYPILDTHNISLESEGL
                     PIKRGYLNAVLDLGGRYLYLAATHLHHVPEEGDVRLIQAGELADFWDNAPATIILGDF
                     NAEPDSEEIGLLRQAGLSDSLEGQTSVLTYHSADLYQRIDYIWASPEIEYIDSYTIVS
                     LASDHLAIIADIRLS"
     misc_feature    complement(267101..267790)
                     /locus_tag="DehaBAV1_0260"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:260458"
     misc_feature    complement(order(267131..267136,267200..267202,
                     267317..267319,267323..267325,267422..267424,
                     267668..267670,267764..267766))
                     /locus_tag="DehaBAV1_0260"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    complement(order(267134..267136,267668..267670))
                     /locus_tag="DehaBAV1_0260"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    complement(order(267131..267133,267317..267319,
                     267422..267424))
                     /locus_tag="DehaBAV1_0260"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            complement(269080..270384)
                     /locus_tag="DehaBAV1_0261"
                     /db_xref="GeneID:5132021"
     CDS             complement(269080..270384)
                     /locus_tag="DehaBAV1_0261"
                     /note="PFAM: LemA family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LemA family protein"
                     /protein_id="YP_001213727.1"
                     /db_xref="GI:147668909"
                     /db_xref="InterPro:IPR007156"
                     /db_xref="GeneID:5132021"
                     /translation="MEFQIWGYLVFVLGLAALALAFRAMRRKRLVDDIPTSRTHGVFI
                     GLVELKGTAESEKPFTGFLSAEQCVYYYYKVEERWSRMVTESFTDAKGHVQFRTRQES
                     GWTQVASGKEMQPFYLKDETGIILIQPEGADIQPKNLFNRTCGQNDPLYYAKGPQASI
                     PNSDHQRRFTEEAIPLHAGLYIMGQSRERQDIVAPEIAKDKSAPLYVISTRTEKQISR
                     TYSGWFWFWVGLGLLLASGSGLLLSQEGTSGFNPDFGVAVLWLGLYLICWLFGWLWAG
                     YNSLVGLRNRVCQGYAQVDIQLKRRFDLIPNLAKSVEGFGKHERELQEMLAEVRTISK
                     VNGQDPKDIQGASAILVFNMERYPELKADTLFLKIQEELAATESWIALARDYYNSIAT
                     FYNTRREVFPDRLLAGIFGFKERVLINASALERAVVKVKLAE"
     misc_feature    complement(269701..270108)
                     /locus_tag="DehaBAV1_0261"
                     /note="E3 Ubiquitin ligase; Region: GIDE; pfam12483"
                     /db_xref="CDD:257080"
     misc_feature    complement(269095..269613)
                     /locus_tag="DehaBAV1_0261"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: LemA; COG1704"
                     /db_xref="CDD:224618"
     gene            270583..271422
                     /locus_tag="DehaBAV1_0262"
                     /db_xref="GeneID:5132271"
     CDS             270583..271422
                     /locus_tag="DehaBAV1_0262"
                     /note="TIGRFAM: degV family protein;
                     PFAM: DegV family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="degV family protein"
                     /protein_id="YP_001213728.1"
                     /db_xref="GI:147668910"
                     /db_xref="InterPro:IPR003797"
                     /db_xref="GeneID:5132271"
                     /translation="MTIKIVTDSTADLPADIVKNLGITVVPLYVHFGNEVFRDGVDIN
                     KETFFDRLAHGGIHPKTSQPSPEDFANVYRELAKDNATGIVSIHISSKFSGTYQSAME
                     GAKISGVSCPIEVIDSRLLSMGMGLVIKAAAIASRSGKKLGEVVEDCKNNIPKIKLMG
                     FFDTLRYVQVGGRLGKAKILMGSLLGVKPVLTVADGEYQPCGRVRNTGKGLERLVEFA
                     KTGKNIVDMSVIHSTTPETAHKLAEMLSDIFPKDQTIIAQLGAVLGTHGGPGTLWVAY
                     KEA"
     misc_feature    270589..271410
                     /locus_tag="DehaBAV1_0262"
                     /note="EDD domain protein, DegV family; Region: DegV;
                     TIGR00762"
                     /db_xref="CDD:213558"
     gene            271569..271934
                     /locus_tag="DehaBAV1_0263"
                     /db_xref="GeneID:5131622"
     CDS             271569..271934
                     /locus_tag="DehaBAV1_0263"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213729.1"
                     /db_xref="GI:147668911"
                     /db_xref="GeneID:5131622"
                     /translation="MSFAAIFSIIAGVLVIFQWRENLNRRAIQDPNKGYKVRWGTYEL
                     ILRSAAEFATALMLILAGTGLLSEQSWGESIYLLATGMFIYSAVNSPGYFVQQKNWAV
                     VAVYAIALELAILGVILFL"
     gene            complement(272052..273038)
                     /locus_tag="DehaBAV1_0264"
                     /db_xref="GeneID:5132191"
     CDS             complement(272052..273038)
                     /locus_tag="DehaBAV1_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning ATPase"
                     /protein_id="YP_001213730.1"
                     /db_xref="GI:147668912"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="GeneID:5132191"
                     /translation="MSIEPEIRETLGKINVAASGRTLANLNLLRDIEIQPDKIKISVA
                     SAGLSASSQQILRQDISLCLKPLLNKQTLEIEYISVPLNELNHVKKVVAVMSGKGGVG
                     KSLITGLCAVALNRQGYRVGILDADITGSSIPKMFGANQHLAGNEEAILPAQSRAGIS
                     LVSTNLLLTNQDDAVIWRGPLISKMINQFWDDVLWGELDYMVVDLPPGTSDASLTVLQ
                     SLPISGILVVFTPQGLVEMVARKAVSMAEKMGKPIIGLVENMAYLKVPELDKKIEVFG
                     TGHGEELAKSIGVPFIGQMPLDPALAALCDSGDIEKYQHPLLDELEGAISRS"
     misc_feature    complement(<272910..273023)
                     /locus_tag="DehaBAV1_0264"
                     /note="Domain of unknown function DUF59; Region: DUF59;
                     cl00941"
                     /db_xref="CDD:260711"
     misc_feature    complement(272124..272894)
                     /locus_tag="DehaBAV1_0264"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Mrp;
                     COG0489"
                     /db_xref="CDD:223563"
     misc_feature    complement(272142..272768)
                     /locus_tag="DehaBAV1_0264"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     misc_feature    complement(272727..272750)
                     /locus_tag="DehaBAV1_0264"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238994"
     gene            273519..274457
                     /locus_tag="DehaBAV1_0265"
                     /db_xref="GeneID:5132272"
     CDS             273519..274457
                     /locus_tag="DehaBAV1_0265"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_001213731.1"
                     /db_xref="GI:147668913"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:5132272"
                     /translation="MTDKGKEGTTRSTHPPTRRDFIKSSGGVLGLAAITKLDERTQNF
                     SAAVAPPSTVSFPAEETAFIPNSTKEDPLIRMQAELRRAMQKPAAERHWAMVINLRKC
                     VGCHACTEACVSENKLPPGVIYRFVMDEEIGQYPNVSRRFTPRPCMHCDNPPCTQVCP
                     VGATFKQADGIVVIDYQRCIGCRFCIVACPYTARTMDYGDNYLEDEPEDSGLVLGYEQ
                     GGVWQSASNFEYGNEHSRTPKRDSPIGNARKCHFCLHRLEKGMLPACVTTCIGRVNYF
                     GDSNDPDSLVSELIANPGIIQLKSELGTDPSVYYLF"
     misc_feature    273765..274454
                     /locus_tag="DehaBAV1_0265"
                     /note="Fe-S-cluster-containing hydrogenase components 1
                     [Energy production and conversion]; Region: HybA; COG0437"
                     /db_xref="CDD:223514"
     misc_feature    273810..274004
                     /locus_tag="DehaBAV1_0265"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    273942..274352
                     /locus_tag="DehaBAV1_0265"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            274478..275659
                     /locus_tag="DehaBAV1_0266"
                     /db_xref="GeneID:5131942"
     CDS             274478..275659
                     /locus_tag="DehaBAV1_0266"
                     /note="PFAM: Polysulphide reductase, NrfD"
                     /codon_start=1
                     /transl_table=11
                     /product="polysulphide reductase, NrfD"
                     /protein_id="YP_001213732.1"
                     /db_xref="GI:147668914"
                     /db_xref="InterPro:IPR005614"
                     /db_xref="GeneID:5131942"
                     /translation="MNWKRIALGILILSLAAGVWGFLMLLNNGQQMLGLGSFVVWGLW
                     MALYVFFASTAAGMFFIASLDLLFKVKTFAGTGKIFMLASLASLGAGLIHILINEGRP
                     ERVMNVFLHPNFDSVLAWSVWIYTLIALATAAILLVLFIPQKRLPFRKEPVIKWLMIL
                     GFPVAVIASGAVGFTLSTQSSHSFWSVGLFPVLFPIFGMSAGFALSRIIVALYGDKTS
                     PGYPRLAKTMAISTIALLLSITYIIGSVLFVGIYDATPPTIEAANYIMFGQYWYGFWI
                     VQIGLGIVVALGALIKVLSKPGLSKKPAWGLTIGVLVLLGAAVARLNFIIPAQIVAGA
                     DFLSSPIIDSRYIDSYIPTLPEWALSAGITAAVILAFYIIAKMMKLIPVRIGNEETGD
                     E"
     sig_peptide     274478..274543
                     /locus_tag="DehaBAV1_0266"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.993) with cleavage site probability 0.690 at
                     residue 22"
     misc_feature    274490..275656
                     /locus_tag="DehaBAV1_0266"
                     /note="Polysulphide reductase [Energy production and
                     conversion]; Region: COG5557; cl17901"
                     /db_xref="CDD:248455"
     gene            275652..278864
                     /locus_tag="DehaBAV1_0267"
                     /db_xref="GeneID:5131095"
     CDS             275652..278864
                     /locus_tag="DehaBAV1_0267"
                     /note="PFAM: molydopterin dinucleotide-binding region;
                     molybdopterin oxidoreductase Fe4S4 region"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase Fe4S4 region"
                     /protein_id="YP_001213733.1"
                     /db_xref="GI:147668915"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="GeneID:5131095"
                     /translation="MNKEKPEKNPSGGITRANFIKVSALLGGTALLSGCDLGTKPRRI
                     LGSSDYPLSKAEDIIYSTCQQCATQCSIKVKLIDGVIAKIDGNPFSPWNMMPHLDYKT
                     PVTTSAFTDASICPKGHSGAQTSYDPFRLVKVIKRDGPRGSNKWISIPFAQAIDEIAN
                     GGKLFSNVPGEENRTVEGLKDIWALRSPEITKAIKNDITAIWAEKDATKKSALVAVFK
                     EKHKDYLDKFIDPNHPDLGTKNNGFCFMFGRTQGGRVDFIKRFTNDAMGSVNAHGHTA
                     VCQGSLFQSAKALSAQFDSGTGSFSEGEKFYWMADIGKSEFVIFTGASPFEASFGPTS
                     RSMRISEGLDTGRMKYAVVDPRFSKAASKAWKWLPAKPGTEGALALALIRWIFDNSRY
                     DARYLANANKAAADADGEPTWSGSSWLVKIDAAGRAARLLRASDIGLEQGNFSFDTPL
                     VMKQGQFTRFDPNDKVNAVEGELLVDTTVNGLRVKSSLQILRDEASSHTIEEWAEICG
                     VKADDLAEIASEFTSHGKKAAADIHRGVSQHTNGFYNSLAWWNLNMLIGNYDWQGGML
                     KGSAYDIKGGKADGPFNLGQMRPGALTPSGVNIVRHGNIYEDTTLYQSTGYPAKRNWY
                     PLSEDIYQEVIPSAGDAYPYPIKALFLHMGSPVYVVPAGHTALEFLTDPEKLPLLVVT
                     DIVVSETSMYADYIFPDLTNMERWEFAGSQNTIPFKSQPVRQPAIAPLVETVKVFGQD
                     MPLSMETMLLGLAEEMGLPGFGPDGLGQGIPLSHFDDLYLRMAANLAFGEKADGSDAV
                     PDADEEEIRIFTQARRHMPDSIYNLERWSSLAGENWPKVVYMLNRGGRFQDYEGGYPA
                     NQQLGNKYGRLFNVFLEKTTEVKNSQTGESIPGHACYITAGRDCYGQELNDEKNGYDL
                     SLITYREIARTPTTASNYYLNPLLPENTILINQQDADRLGLTETDIVRVVSESNPKGV
                     WNLRNGQEWPMNAKLSIMQGIRPGVIAFSLGYGHFAYGGLDITIDGQLIPGEAKRTKG
                     VNANAAMRVDPHLKNTCLVDTVGGSAVFYDTKVRLEKVNT"
     misc_feature    275694..278855
                     /locus_tag="DehaBAV1_0267"
                     /note="tetrathionate reductase subunit A; Provisional;
                     Region: PRK14991"
                     /db_xref="CDD:237883"
     misc_feature    275829..278357
                     /locus_tag="DehaBAV1_0267"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:263922"
     misc_feature    order(276000..276002,276474..276476,276480..276488,
                     276612..276617,276621..276623,276630..276635,
                     276708..276716,276774..276776,277248..277250,
                     277608..277616,277695..277703,277710..277712,
                     277746..277751,277764..277766)
                     /locus_tag="DehaBAV1_0267"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238218"
     misc_feature    278385..278852
                     /locus_tag="DehaBAV1_0267"
                     /note="This CD contains the molybdopterin_binding
                     C-terminal (MopB_CT) region of tetrathionate reductase,
                     subunit A, (TtrA); respiratory arsenate As(V) reductase,
                     catalytic subunit (ArrA); and other related proteins;
                     Region: MopB_CT_Tetrathionate_Arsenate-R; cd02780"
                     /db_xref="CDD:239181"
     misc_feature    order(278388..278414,278655..278657,278742..278744,
                     278832..278837)
                     /locus_tag="DehaBAV1_0267"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239181"
     gene            278887..279576
                     /locus_tag="DehaBAV1_0268"
                     /db_xref="GeneID:5131094"
     CDS             278887..279576
                     /locus_tag="DehaBAV1_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213734.1"
                     /db_xref="GI:147668916"
                     /db_xref="GeneID:5131094"
                     /translation="MNTYLNPEKNRIPTGLTLAVIGSVWGLLEMALGGFLHTIHFANQ
                     GAVMGGLAISLMAIFLSITKKPALIPLLGIIAASFKPFSAFIFGEPVFSAYVINPAIA
                     IIMEAIAFGAIAFIFKKAMEKHLFAQITTGFLAGALGIVLYAVIASVFGLGKWPMLDM
                     AGKLDTIVSTGLPVALAGTITLAAGYYLGKFGMPKLANFKTNYPRLYYVTSAAAVVSC
                     WVIPAVFHLGG"
     gene            279577..280722
                     /locus_tag="DehaBAV1_0269"
                     /db_xref="GeneID:5131092"
     CDS             279577..280722
                     /locus_tag="DehaBAV1_0269"
                     /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor guanylyltransferase"
                     /protein_id="YP_001213735.1"
                     /db_xref="GI:147668917"
                     /db_xref="InterPro:IPR001228"
                     /db_xref="GeneID:5131092"
                     /translation="MNLIITGEVGSGKSSHCQRYAKHLQECGFKTGGVICRPVFQETT
                     KTGYKVTDIRTSAETIFSLTHPPSEFTGEKVGKYSICQSGLSFAGKAIQEAIQTGCTV
                     IFLDEIGHLEIAGKGLAEHAHLAYQKAPHTISVVRKSLLSKFLAAFAPDKSNNIFVIQ
                     DTQTDTDIHTHYFENRADTVDISCIILAGGKSTRLGSNKVTATLNSQTLLERAIANLA
                     GYGDEILVVTAYSKTDDKTRQLAGIKIIQDILPDKGPLAGIYSGLMASNSPLNLVIAC
                     DMPFINQPLLEYMRAQAEGYEAVVPRLAQRPEPLHAIYSKSAGEKALGLINEGKFAVS
                     DLLACLKTRYIEEAEINRFDPEHRSFFNINRPEDLEKARNIAETESI"
     misc_feature    279580..280053
                     /locus_tag="DehaBAV1_0269"
                     /note="NTPase; Region: NTPase_1; cl17478"
                     /db_xref="CDD:266716"
     misc_feature    279580..>279909
                     /locus_tag="DehaBAV1_0269"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    280120..280683
                     /locus_tag="DehaBAV1_0269"
                     /note="MobA catalyzes the formation of molybdopterin
                     guanine dinucleotide; Region: MobA; cd02503"
                     /db_xref="CDD:133000"
     misc_feature    order(280135..280143,280147..280149,280171..280173,
                     280255..280257,280318..280320,280336..280341,
                     280348..280350,280399..280401,280405..280407)
                     /locus_tag="DehaBAV1_0269"
                     /note="GTP binding site; other site"
                     /db_xref="CDD:133000"
     gene            280911..281219
                     /locus_tag="DehaBAV1_0270"
                     /db_xref="GeneID:5131950"
     CDS             280911..281219
                     /locus_tag="DehaBAV1_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213736.1"
                     /db_xref="GI:147668918"
                     /db_xref="GeneID:5131950"
                     /translation="MPEFGSPFSGMAKGQPLSNEELIRAIRFMVAAEYEAIQLYMQLA
                     ESTTNRLAIEVLRDIANEEKVHAGEFLRLLKELAPDEENFYADGAKEVEEEIEKRKNK
                     "
     misc_feature    <280914..281132
                     /locus_tag="DehaBAV1_0270"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cd00657"
                     /db_xref="CDD:153097"
     misc_feature    order(281007..281009,281097..281099,281106..281108)
                     /locus_tag="DehaBAV1_0270"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153097"
     gene            complement(282146..282451)
                     /locus_tag="DehaBAV1_0271"
                     /pseudo
                     /db_xref="GeneID:5131090"
     gene            282499..282777
                     /locus_tag="DehaBAV1_0272"
                     /db_xref="GeneID:5132296"
     CDS             282499..282777
                     /locus_tag="DehaBAV1_0272"
                     /note="PFAM: transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001213737.1"
                     /db_xref="GI:147668919"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:5132296"
                     /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYR
                     WRQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
     misc_feature    282505..282726
                     /locus_tag="DehaBAV1_0272"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            282918..283613
                     /locus_tag="DehaBAV1_0273"
                     /db_xref="GeneID:5131093"
     CDS             282918..283613
                     /locus_tag="DehaBAV1_0273"
                     /note="PFAM: Integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001213738.1"
                     /db_xref="GI:147668920"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:5131093"
                     /translation="MADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEGL
                     RVPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTRE
                     CLAITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTLF
                     IEPGSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGYR
                     PPAPEAIMAVVTT"
     misc_feature    282927..283073
                     /locus_tag="DehaBAV1_0273"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    283116..283466
                     /locus_tag="DehaBAV1_0273"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    283377..283577
                     /locus_tag="DehaBAV1_0273"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(284016..284702)
                     /locus_tag="DehaBAV1_0274"
                     /db_xref="GeneID:5131012"
     CDS             complement(284016..284702)
                     /locus_tag="DehaBAV1_0274"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001213739.1"
                     /db_xref="GI:147668921"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5131012"
                     /translation="MNVVIIEDDDVIIESLTLLFRMRWPEAKLVSSNLGDKGLELIVD
                     WNPNLVILDLGLPDLDGLEVLKRIRLFSNVPVIILTVRGDEAEIVKGLEYGADDYITK
                     PFKQLEFLARVKALTRRQEVPAIATCYQKGPFQLVSATHKLYLKDKEITLTNTEYLIF
                     YKLLENANMVISHSTLSKMLWGEDYPDSIDAIRVYISRIRQKIHDDSSEPSIILTKPG
                     LGYMLSTSKA"
     misc_feature    complement(284028..284702)
                     /locus_tag="DehaBAV1_0274"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(284355..284690)
                     /locus_tag="DehaBAV1_0274"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(284394..284399,284406..284408,
                     284463..284465,284520..284522,284544..284546,
                     284679..284684))
                     /locus_tag="DehaBAV1_0274"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(284544..284546)
                     /locus_tag="DehaBAV1_0274"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(284520..284528,284532..284537))
                     /locus_tag="DehaBAV1_0274"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(284391..284399)
                     /locus_tag="DehaBAV1_0274"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(284034..284309)
                     /locus_tag="DehaBAV1_0274"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(284043..284045,284058..284060,
                     284094..284099,284121..284123,284130..284132,
                     284184..284189,284244..284246))
                     /locus_tag="DehaBAV1_0274"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(284702..287914)
                     /locus_tag="DehaBAV1_0275"
                     /db_xref="GeneID:5132260"
     CDS             complement(284702..287914)
                     /locus_tag="DehaBAV1_0275"
                     /note="PFAM: ATP-binding region, ATPase domain protein;
                     histidine kinase A domain protein; Two component regulator
                     propeller; Two component regulator three Y domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001213740.1"
                     /db_xref="GI:147668922"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011110"
                     /db_xref="InterPro:IPR011123"
                     /db_xref="GeneID:5132260"
                     /translation="MKHILLFIAVICLIILPVYSNPVQAQEFTRFEHISIDDGLSQSS
                     VTAIIQDREGFIWFGTRDGLNRFDGSTMHTFSNNPENPGSLSDSYINCLFEDSRGIIW
                     IGTLSGGLNKFDKMTETFSTFRHSEGNSETLASDNVRMMREDLAGFLWLATPNGLDRF
                     NPHSNSFEHFSLHNGLSNNSVWSILITKEGTVWVGTEDGIDQFQSENGIYKHSNRLTS
                     DLSGNTIRYLFEDKTGNIWISTYNGVDCLNPLSGIIAHFENIPGNPSSLGNNRIRTIC
                     QDTAGSLWFGTTDGLDKLEQGTNEFIHFKNDSGNPDSISNNIIWSLMVDRSGVLWIGT
                     LNGGVNRLSLTKQVFICYRNNPGNANSLSNNIVKSIYQDQNGIIWIGTLGGLNKFDPL
                     ANTFYLFNHDGSNPQSIAGDTIKTITGDTNGNLWVGTTSGLDKYSEQLNQFTHFTHNQ
                     SDTKSISDDVIWSLFFDSQGQFWVATNRGLDKFNPDSSEFIHFGAVYGLPETTIYTIF
                     EYEPGVLLLGTDYGLYRFDTISETSVPFRFDANNPTTINNNAVRCIYQATNGTILIGT
                     HTGLNKFNITEGTFERYTQINGVTYGILEDNFGYVWISGNNGLIRLFLANETIKTFNK
                     TDGLQSDEFSEGAYFKGSSGLLYFGGINGLNVFDPSKLQTETAKPNIIITSLDLIGGN
                     ASFKLPEQISGGITLEYENNSFTINFTALDFETYQKVKYYFQLVGFDKDLRIANYDQR
                     DISYTNIDNGKYTFKIYAADQDESWVSDTAYLNIRITTPFWESWWFYSLCGVSSIATI
                     YFIVKLRIWAIQKQKNHLESLVEVRTDQLKTEIEKQQIIENKLKDEIENRAKFTRALV
                     HELKTPLTSLSISSELFTGEATNEPFVSLSRSIERSVTNLSKRCDEMLDLARGETGLL
                     KISKQMVDLDSFVEGIKTDLLSIAFSKGIHLTFEYAKNTRKAYIDPDRINEVINNLTD
                     NALKFTPPNGTITIKTDISNEQFIFEISDTGCGINKDYQKRMFSPGYQGETNPRLDGL
                     GIGLILAKMFIELHKGTIWVKSKPKSGSIFGFSIPIGEKD"
     sig_peptide     complement(287837..287914)
                     /locus_tag="DehaBAV1_0275"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.995 at
                     residue 26"
     misc_feature    complement(286328..287902)
                     /locus_tag="DehaBAV1_0275"
                     /note="Predicted periplasmic ligand-binding sensor domain
                     [Signal transduction mechanisms]; Region: COG3292"
                     /db_xref="CDD:225829"
     misc_feature    complement(285587..285781)
                     /locus_tag="DehaBAV1_0275"
                     /note="Y_Y_Y domain; Region: Y_Y_Y; pfam07495"
                     /db_xref="CDD:254235"
     misc_feature    complement(284717..285523)
                     /locus_tag="DehaBAV1_0275"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(285191..285382)
                     /locus_tag="DehaBAV1_0275"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(285206..285208,285218..285220,
                     285227..285229,285239..285241,285248..285250,
                     285260..285262,285308..285310,285317..285319,
                     285329..285331,285338..285340,285350..285352,
                     285362..285364))
                     /locus_tag="DehaBAV1_0275"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(285344..285346)
                     /locus_tag="DehaBAV1_0275"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(284723..285019)
                     /locus_tag="DehaBAV1_0275"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(284735..284737,284741..284746,
                     284759..284761,284765..284767,284813..284824,
                     284897..284902,284906..284908,284912..284914,
                     284918..284920,284987..284989,284996..284998,
                     285008..285010))
                     /locus_tag="DehaBAV1_0275"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(284996..284998)
                     /locus_tag="DehaBAV1_0275"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(284816..284818,284822..284824,
                     284900..284902,284906..284908))
                     /locus_tag="DehaBAV1_0275"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            288132..289703
                     /locus_tag="DehaBAV1_0276"
                     /db_xref="GeneID:5132094"
     CDS             288132..289703
                     /locus_tag="DehaBAV1_0276"
                     /note="TIGRFAM: reductive dehalogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213741.1"
                     /db_xref="GI:147668923"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5132094"
                     /translation="MANFHSVINRRDFMKALGLVGAGAGAAAAVAPVFRDLDDLVASP
                     TATFPRAWWIKERDLWDITTEYDWKAMSRHDTCETMWIKHSWAKYVGVDKVKEAAASA
                     AAIKKEALETGKPGMDLRATALGSTSGLYNAPQPYFSYTKTAQGWGGGKSFTGQSTIK
                     GPDVLGVPKWQGDPDANLRMLRAALRFYGAAQIGVVPYDTNVKNKLTCVREGGMASMS
                     DKYIEKWPIPAVDARPFVFEDVEKGYETAEKLVIPDKKELFVVSVIQPMSREMWRQGS
                     GNLRVATNGHRYSLASVWQTKIQGFLTTLGYQGLGYPTRAYGPMPTIPGFIFSGLGEL
                     GRSNNVCLSPEYGSTHGSFHFLTDLPLTPTKPIDAGMWRFCKTCAICAENCPSQSISY
                     DKEPSWEITPSKYAPNVPVEYSVPGKKVFWRDEPSCKQWTESCGYSCGICMGSCVFNV
                     DNASMIHQVVKGTIATTSLFNGFMKQADKFFGYGLTPESEWNNWWDMNLPAYAFDTTV
                     GVTDGGYKAKGLLQQ"
     sig_peptide     288132..288221
                     /locus_tag="DehaBAV1_0276"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.988) with cleavage site probability 0.630 at
                     residue 30"
     misc_feature    288267..289214
                     /locus_tag="DehaBAV1_0276"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    288636..289583
                     /locus_tag="DehaBAV1_0276"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    289251..289478
                     /locus_tag="DehaBAV1_0276"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            289727..289999
                     /locus_tag="DehaBAV1_0277"
                     /db_xref="GeneID:5131041"
     CDS             289727..289999
                     /locus_tag="DehaBAV1_0277"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213742.1"
                     /db_xref="GI:147668924"
                     /db_xref="GeneID:5131041"
                     /translation="MWMIIGILVGLAIWGVVQFAKNKGLNLTWYDWVIGLLGLGLLLF
                     TFQNFIGAFAEAEDKAAYLFLLVTGLPSLILLAVAWQLAIRRTKKV"
     sig_peptide     289727..289789
                     /locus_tag="DehaBAV1_0277"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.628) with cleavage site probability 0.616 at
                     residue 21"
     gene            complement(290133..290546)
                     /locus_tag="DehaBAV1_0278"
                     /db_xref="GeneID:5131075"
     CDS             complement(290133..290546)
                     /locus_tag="DehaBAV1_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213743.1"
                     /db_xref="GI:147668925"
                     /db_xref="GeneID:5131075"
                     /translation="MFAFLALISGCEQTQPPSVQTEIPAACPDSQVEIDKLILSEFPF
                     ESEGTTESVTVFNSGIRQIYCTFWLTDDLCCTVITLQLKDNAQVLFEWKMNGNQIGFP
                     QTVIMEFETGLGTGQYLLEIYMDKKMRVNFELVIV"
     gene            complement(290722..292206)
                     /locus_tag="DehaBAV1_0279"
                     /db_xref="GeneID:5131072"
     CDS             complement(290722..292206)
                     /locus_tag="DehaBAV1_0279"
                     /note="PFAM: cobalamin B12-binding domain protein; Radical
                     SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_001213744.1"
                     /db_xref="GI:147668926"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:5131072"
                     /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYIASVLERAGHEVRIFD
                     NVVSELTPPDYAKDFAPEVVGFSVLTGPCIGNALVQSKEFKALLPGVKVVWGNVHATC
                     TTEQTLNEEAIDFVVRGDGEYTFLDLIEHLEKGEENYAEIQGLAWKDREGRVIINQPR
                     PFIHNLDELPNPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHQGHRADLSVERI
                     IAQIEHLQKNYKVKFIRFFEDNFTFNRKRMREFCQTVIERRIKIKWDTESRADMSEED
                     VALMAKAGCTSVGIGVETGSKRMLEYLNKGVDLDEMGRTFWRFVKHGIMPRLYIMLAV
                     PTETVEDFTETQDMLHRMEDPPFMYMRFVPYPGTPLYNQLVQDNRIKPPESLGEWAKF
                     SVYFATKGNLSELSDEVINQAISHWAHSYASRRVMFTLRHNPRYLLSAVKNPSEFFKA
                     VSSLIKNSLPVVFNKNTNIKPLVLEAVPNKMPGKQEPRLISNYE"
     misc_feature    complement(291757..292140)
                     /locus_tag="DehaBAV1_0279"
                     /note="B12 binding domain_like associated with radical SAM
                     domain. This domain shows similarity with B12
                     (adenosylcobamide) binding domains found in several
                     enzymes, such as glutamate mutase, methionine synthase and
                     methylmalonyl-CoA mutase, but it lacks the...; Region:
                     radical_SAM_B12_BD; cd02068"
                     /db_xref="CDD:239019"
     misc_feature    complement(291034..292137)
                     /locus_tag="DehaBAV1_0279"
                     /note="B12-binding domain/radical SAM domain protein,
                     MJ_1487 family; Region: B12_SAM_MJ_1487; TIGR04013"
                     /db_xref="CDD:234440"
     misc_feature    complement(291049..291648)
                     /locus_tag="DehaBAV1_0279"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(291121..291126,291214..291216,
                     291334..291336,291400..291408,291487..291492,
                     291496..291498,291604..291612,291616..291618,
                     291622..291624,291628..291630))
                     /locus_tag="DehaBAV1_0279"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(292229..292978)
                     /locus_tag="DehaBAV1_0280"
                     /db_xref="GeneID:5132412"
     CDS             complement(292229..292978)
                     /locus_tag="DehaBAV1_0280"
                     /note="PFAM: Radical SAM domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_001213745.1"
                     /db_xref="GI:147668927"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:5132412"
                     /translation="MKVYHLIYEPSYKSAVFHHWTECNLDCKGCFCRVEKLDFGLFPD
                     ALERLKDKAPETAPTDFLESPEEALKLLEGCELERAVFIGTEPALDPDLPALAKALHQ
                     KYGSYNVLLTNGVRLCDLSAIDEIIFSLKAVTNAIYQDYTGRSNEKTLDNFKKVHASG
                     KKLQAECLLIPGLIEADEVEKIAKFIATVDKDITLRIDGYFPIPGCPWRGATPKEVTE
                     ASQRAGKHLAKVNYLSADLPRQGEKPLRLFG"
     misc_feature    complement(292364..292912)
                     /locus_tag="DehaBAV1_0280"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(292379..292384,292475..292477,
                     292592..292594,292640..292648,292721..292726,
                     292730..292732,292886..292894,292898..292900,
                     292904..292906,292910..292912))
                     /locus_tag="DehaBAV1_0280"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(292421..292912)
                     /locus_tag="DehaBAV1_0280"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     gene            complement(293045..294457)
                     /locus_tag="DehaBAV1_0281"
                     /db_xref="GeneID:5132381"
     CDS             complement(293045..294457)
                     /locus_tag="DehaBAV1_0281"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213746.1"
                     /db_xref="GI:147668928"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5132381"
                     /translation="MTNYHSSVSRRDFMKAMGLVGAGMGAATAVTPAFRDLDELTATA
                     DLSVYNKWWIKENDFGQLTTEIDWKVFSSFDPAKHPMPVMFGPTANGAMSAKNLANRK
                     KRQTDGILNKWPGSTLRDLALDGATGGNYPSIPWTGPNATTPESRGVPKWEGTPEDNT
                     IMCKAATHFYGAPRCGAIEVDDNVKKFFNTSVVWENIDTAYIGDDGKQHVPNKCKWIL
                     TWLTKQNHAMNKYTLRNDPNDPWYNTVFRQGKAGENMAYSHAPQIQYQVMGFLKGLGY
                     QAIKATASGNTQFGVWSGLCESGRTTYALSPDYGLMVRYIDFAITDLPLAPTKPIDAG
                     LAVFCKNCMTCAKVCPSNTISLEKEPSWNTKDPGNNPGLKTWYLNWTTCAEYGGPFDC
                     VNCQTVCPFSHDNDKSAIHNIIRGTVGTTHLFDGFFANMEKFWGYNTQLSDQAHTDWW
                     YRDLDTWEHDTLLGFGTKGW"
     sig_peptide     complement(294368..294457)
                     /locus_tag="DehaBAV1_0281"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.981) with cleavage site probability 0.973 at
                     residue 30"
     misc_feature    complement(294362..294436)
                     /locus_tag="DehaBAV1_0281"
                     /note="Tat (twin-arginine translocation) pathway signal
                     sequence; Region: TAT_signal_seq; TIGR01409"
                     /db_xref="CDD:233399"
     misc_feature    complement(293483..294304)
                     /locus_tag="DehaBAV1_0281"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(293144..294007)
                     /locus_tag="DehaBAV1_0281"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(293252..293446)
                     /locus_tag="DehaBAV1_0281"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            complement(294482..294757)
                     /locus_tag="DehaBAV1_0282"
                     /db_xref="GeneID:5131073"
     CDS             complement(294482..294757)
                     /locus_tag="DehaBAV1_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213747.1"
                     /db_xref="GI:147668929"
                     /db_xref="GeneID:5131073"
                     /translation="MWFLIGIAVGAAVLGIVTLLRAKKIALTWYEWVLGIIGLGLLLF
                     TLQNFFGSFAELETKAAYIFLIIPGLPSLIMLALAWQLAARRQNKSV"
     gene            complement(294908..295174)
                     /locus_tag="DehaBAV1_0283"
                     /db_xref="GeneID:5132358"
     CDS             complement(294908..295174)
                     /locus_tag="DehaBAV1_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213748.1"
                     /db_xref="GI:147668930"
                     /db_xref="GeneID:5132358"
                     /translation="MWLGLFLGLVFGIGAMWLLKKGLVIKWHIWALSALAFLSLYGGI
                     THYVGSIHEYEPTAGLFGLIIFGAISLILAGFAFQLGWRQNKSR"
     gene            complement(295198..296688)
                     /locus_tag="DehaBAV1_0284"
                     /db_xref="GeneID:5132431"
     CDS             complement(295198..296688)
                     /locus_tag="DehaBAV1_0284"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213749.1"
                     /db_xref="GI:147668931"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5132431"
                     /translation="MSDFHSTLSRREFMKALGLTGAGVGAVAASAPVIHDVDELLASA
                     EESEIKHQNPWWVKERDYFNPTVPIDWDLKWRVDGRNARLYNVQDSKWFFNAYSETQA
                     QIYADACMKEDPDFKWGDARRMALEAGCSFAQFGSLTLNSGTYSLHSYLGNPPNRTPE
                     RDGYAKWVGTPEENLLLLRGAVRFFGGDDVGVMEHDTHLDRVLCTYDMNGFKNSFEDI
                     DEPYQTTNPKVTGIPNSYKWCFTWTLRQPMDVTRRQQGGIMRAYPNYNKYGEAESVGV
                     WRAYSELAIVENRLQLFLRGLGYRGIAGGMSAITSGNAIATVAGCMEHARMGQVAVHP
                     KFGSTVRGTYKMMTNFPLAPTKPIDAGIYEFCKACQICAEHCPTGIIQKNDPTWTTGR
                     NPEDGNDNGTFGEPLPYQAQGFEGWRTDIGKCPHCPVCQGTCPFNELPNASWVHTLVK
                     ATAANTTLFNSFFAQMDRTFEYGRKPFIGYWDDFGTRPTYDLDTYR"
     sig_peptide     complement(296602..296688)
                     /locus_tag="DehaBAV1_0284"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.940) with cleavage site probability 0.486 at
                     residue 29"
     misc_feature    complement(295633..296538)
                     /locus_tag="DehaBAV1_0284"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    complement(295270..296193)
                     /locus_tag="DehaBAV1_0284"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    complement(295378..295596)
                     /locus_tag="DehaBAV1_0284"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            complement(296763..297491)
                     /locus_tag="DehaBAV1_0285"
                     /db_xref="GeneID:5132085"
     CDS             complement(296763..297491)
                     /locus_tag="DehaBAV1_0285"
                     /note="TIGRFAM: putative ATP binding protein;
                     PFAM: protein of unknown function DUF71, ATP-binding
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP binding protein"
                     /protein_id="YP_001213750.1"
                     /db_xref="GI:147668932"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="GeneID:5132085"
                     /translation="MADVFISWSGGKDCCLSAYRAIRDGHNIRYLASIITNNTGRLWP
                     HLLTPEVLNMQAQAMGIPLLEWDTDISNYNSEYIKMLQYLKGKGVNHGVFGDVSIGNA
                     QANEHKSWIDSVCVPNGIVSHLPLWDETRESLWRDLLESGFEAIIIAVDNDKLGKDYL
                     GQRLDKNLLSELKVRHQLSPTGEVGYYHTFVVDGPIFSHRLKLVKAEPIQYAVPKDVW
                     YLDIQECKLEKKESYSPSLKISQY"
     misc_feature    complement(296901..297482)
                     /locus_tag="DehaBAV1_0285"
                     /note="This is a subfamily of Adenine nucleotide alpha
                     hydrolases superfamily.Adeninosine nucleotide alpha
                     hydrolases superfamily  includes N type ATP PPases and ATP
                     sulphurylases. It forms a apha/beta/apha fold which  binds
                     to Adenosine group.  This subfamily; Region:
                     Alpha_ANH_like_IV; cd01994"
                     /db_xref="CDD:238952"
     misc_feature    complement(order(297390..297392,297396..297398,
                     297450..297461,297465..297473))
                     /locus_tag="DehaBAV1_0285"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238952"
     gene            complement(297683..298363)
                     /locus_tag="DehaBAV1_0286"
                     /db_xref="GeneID:5132090"
     CDS             complement(297683..298363)
                     /locus_tag="DehaBAV1_0286"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_001213751.1"
                     /db_xref="GI:147668933"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5132090"
                     /translation="MKILVIEDNKDIIEFISLAFQVGWPSVKLEIAHKGEDGLELVEK
                     ETPDAVILDLGLPDIDGFEVLKRIRLFSQIPIIILTVRKEELDIVRGLELGADEYMTK
                     PFGQMELLARLRAMLRRQNILTEEPSIIAGPFRFSYYMHKLHYNNKEIPLTTTEGMIL
                     YHLAINSGNIISHKSLAETVWGEEYDGAADSLKVYIRRLREKIEEDPSDPKIIITKSG
                     VGYMLVKK"
     misc_feature    complement(297686..298363)
                     /locus_tag="DehaBAV1_0286"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(298013..298354)
                     /locus_tag="DehaBAV1_0286"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(298055..298060,298067..298069,
                     298124..298126,298181..298183,298205..298207,
                     298340..298345))
                     /locus_tag="DehaBAV1_0286"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(298205..298207)
                     /locus_tag="DehaBAV1_0286"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(298181..298189,298193..298198))
                     /locus_tag="DehaBAV1_0286"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(298052..298060)
                     /locus_tag="DehaBAV1_0286"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(297695..297979)
                     /locus_tag="DehaBAV1_0286"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(297704..297706,297719..297721,
                     297755..297760,297782..297784,297791..297793,
                     297845..297850,297905..297907))
                     /locus_tag="DehaBAV1_0286"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(298344..298790)
                     /locus_tag="DehaBAV1_0287"
                     /db_xref="GeneID:5132087"
     CDS             complement(298344..298790)
                     /locus_tag="DehaBAV1_0287"
                     /note="PFAM: ATP-binding region, ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001213752.1"
                     /db_xref="GI:147668934"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:5132087"
                     /translation="MNKQIFITDLPDKLPLVWGDEERIQQIILNFLDNAFKYTPRDGQ
                     VTLKAYTHGNKIAIEVRDTGPGILDEEKARIFKAYTRFKKQCRRESGLGLGLALAAMI
                     VELHKGKIWCDSVGNQGSVFGFSIPINLLKLDKPDGNGELNENPSD"
     misc_feature    complement(298413..298721)
                     /locus_tag="DehaBAV1_0287"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(298425..298427,298431..298436,
                     298449..298451,298455..298457,298590..298595,
                     298599..298601,298605..298607,298611..298613,
                     298680..298682,298689..298691,298701..298703))
                     /locus_tag="DehaBAV1_0287"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(298689..298691)
                     /locus_tag="DehaBAV1_0287"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(298593..298595,298599..298601))
                     /locus_tag="DehaBAV1_0287"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            298979..299257
                     /locus_tag="DehaBAV1_0288"
                     /db_xref="GeneID:5132097"
     CDS             298979..299257
                     /locus_tag="DehaBAV1_0288"
                     /note="PFAM: transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001213753.1"
                     /db_xref="GI:147668935"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:5132097"
                     /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYR
                     WRQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
     misc_feature    298985..299206
                     /locus_tag="DehaBAV1_0288"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            299398..300093
                     /locus_tag="DehaBAV1_0289"
                     /db_xref="GeneID:5132362"
     CDS             299398..300093
                     /locus_tag="DehaBAV1_0289"
                     /note="PFAM: Integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001213754.1"
                     /db_xref="GI:147668936"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:5132362"
                     /translation="MADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEGL
                     RVPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTRE
                     CLAITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTLF
                     IEPGSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGYR
                     PPAPEAIMAVVTT"
     misc_feature    299407..299553
                     /locus_tag="DehaBAV1_0289"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    299596..299946
                     /locus_tag="DehaBAV1_0289"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    299857..300057
                     /locus_tag="DehaBAV1_0289"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(300086..301930)
                     /locus_tag="DehaBAV1_0290"
                     /db_xref="GeneID:5132396"
     CDS             complement(300086..301930)
                     /locus_tag="DehaBAV1_0290"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: histidine kinase A domain protein; PAS fold-3 domain
                     protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PAS/PAC sensor protein"
                     /protein_id="YP_001213755.1"
                     /db_xref="GI:147668937"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5132396"
                     /translation="MKANKIQINDIPKLFDMFFNESRDGLLLLDAPTGIIKLANPEFQ
                     HQICLPLEKILGKHIWDLRPPKDRPLGKALYQQRFNSNVKLSTHEVIYKRGDNTEIIV
                     ELLSKLLEYDGEKNLIIITRDVTGLKRLDRISRITQFVVDNAGDAIFWLDNLGNIVYA
                     NNSTALLLGYSKEELLSLTIFDINVNLNQLNWESYFIDSGNTSANNKETLFKAKNKQN
                     VPVSIISNRLIYEGVAYNCVFARDLSESNRNKEALLMTQFAIDRAADSIFWLDDQGQF
                     IYSNNATSLLLGYTQAELSNMQIFEIDINFSRSIWRKEFKKLKNDTAGYVETLYRTKE
                     SDFIPVSVMGNYLQYDGKGFNCCFVRDLSKVKQADKAYRMAQFAIDTSGDAIFWLDRN
                     GKIIYANRATTELLGYTASQLSNMTVNQIDPTVVLEEWPNRFDILKSMGSDVVESILK
                     TKDGSILPVSIMGNYMYYDGKEYNFVFVRDISERLKIEESLRQQQTLLEKTVLERTSE
                     LTDTNSLLQVEITERKNAEIKLEKLLEQEAFLRQQIEGQMAQRIEFTRALVHELKTPL
                     TPILGASAMLANNFTEEPWHSIALNIENGAQHLNKRVDLPPIVIPLFK"
     misc_feature    complement(301535..301894)
                     /locus_tag="DehaBAV1_0290"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(301559..301867)
                     /locus_tag="DehaBAV1_0290"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(301640..301642,301655..301657,
                     301736..301747,301784..301786,301802..301804,
                     301814..301816))
                     /locus_tag="DehaBAV1_0290"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(301613..301615,301619..301621,
                     301706..301711,301718..301720,301742..301744,
                     301754..301756))
                     /locus_tag="DehaBAV1_0290"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(<301382..301501)
                     /locus_tag="DehaBAV1_0290"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(300827..301492)
                     /locus_tag="DehaBAV1_0290"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(300851..301144)
                     /locus_tag="DehaBAV1_0290"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(300926..300928,300941..300943,
                     301025..301027,301064..301066,301082..301084,
                     301094..301096))
                     /locus_tag="DehaBAV1_0290"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(300896..300898,300905..300907,
                     300998..301003,301010..301012,301034..301036))
                     /locus_tag="DehaBAV1_0290"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(300458..300799)
                     /locus_tag="DehaBAV1_0290"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(300488..300787)
                     /locus_tag="DehaBAV1_0290"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(300569..300571,300584..300586,
                     300668..300670,300707..300709,300725..300727,
                     300737..300739))
                     /locus_tag="DehaBAV1_0290"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(300542..300544,300548..300550,
                     300641..300646,300653..300655,300677..300679))
                     /locus_tag="DehaBAV1_0290"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(300119..300289)
                     /locus_tag="DehaBAV1_0290"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(300125..300127,300134..300136,
                     300146..300148,300155..300157,300164..300166,
                     300215..300217,300224..300226,300236..300238,
                     300245..300247,300257..300259,300269..300271))
                     /locus_tag="DehaBAV1_0290"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(300251..300253)
                     /locus_tag="DehaBAV1_0290"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     gene            302601..302891
                     /locus_tag="DehaBAV1_0291"
                     /pseudo
                     /db_xref="GeneID:5132349"
     gene            complement(302909..303697)
                     /locus_tag="DehaBAV1_0292"
                     /db_xref="GeneID:5132069"
     CDS             complement(302909..303697)
                     /locus_tag="DehaBAV1_0292"
                     /note="PFAM: Integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_001213756.1"
                     /db_xref="GI:147668938"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:5132069"
                     /translation="MKLIDRQYLATPFYGARKIALELKKQAGLTVNRKRVRRLMQLMG
                     IRAIYRRPRTSTPATGHKVYPYLLRELEITRPNQVWAADITYIPMSRGFLYLVAIIDW
                     YSRYVISWRLSNTLDADFCVAALEEALSKGTPEIFNTDQGSQFTSEAFTALLKEHNVG
                     ISMDGKGSYNDNLFIERLWRTVKYEEVYLKAYQDGREARISLCKYFRFYNTNRIHQSL
                     GYLTPVEVYAGAMDKTCNDVVKSSITKPAGMAELSLNKVPILSY"
     misc_feature    complement(303539..303697)
                     /locus_tag="DehaBAV1_0292"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(303143..303478)
                     /locus_tag="DehaBAV1_0292"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(303050..303469)
                     /locus_tag="DehaBAV1_0292"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     misc_feature    complement(303029..303229)
                     /locus_tag="DehaBAV1_0292"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(303835..304119)
                     /locus_tag="DehaBAV1_0293"
                     /db_xref="GeneID:5132216"
     CDS             complement(303835..304119)
                     /locus_tag="DehaBAV1_0293"
                     /note="PFAM: transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_001213757.1"
                     /db_xref="GI:147668939"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:5132216"
                     /translation="MEENRRKHSPSFKAKVALEAIKGEETIAQLASRFDVHPSQVHKW
                     KKELAEGAVGIFGDERKHQKPDNQQLVSQLYQQIGQLKVERDFLENALGR"
     misc_feature    complement(<303844..304119)
                     /locus_tag="DehaBAV1_0293"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(303910..304107)
                     /locus_tag="DehaBAV1_0293"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            304200..304961
                     /locus_tag="DehaBAV1_0294"
                     /db_xref="GeneID:5132363"
     CDS             304200..304961
                     /locus_tag="DehaBAV1_0294"
                     /note="PFAM: ATP-binding region, ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001213758.1"
                     /db_xref="GI:147668940"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:5132363"
                     /translation="MFDGKEYNCGIVRDITNRKIIEEELRCKNIQLEKKGKRIKALSK
                     AYVQAQEQEREWISIEIHDRIIQPLTSLFQQMQTVFSVDPTNERIVDGKLLVLVKSAI
                     KETRNIMNDLYPSDLGRHGLVKVMNEQLLELENRTGIKTQLSMGFCVTIPHSIEVTLY
                     RIFHEALLNIERHSQANNVSVYLTLSDDRTLIELLVKDDGQGFDLETILNNSKSKGIQ
                     SMKRRAEVVGGELFLDSRRGKGTAIEVHLPVKEMN"
     misc_feature    304356..304550
                     /locus_tag="DehaBAV1_0294"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    304674..304940
                     /locus_tag="DehaBAV1_0294"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(304692..304694,304704..304706,304713..304715,
                     304785..304787,304791..304793,304797..304799,
                     304803..304808,304845..304850,304896..304898,
                     304902..304904,304917..304922,304926..304928)
                     /locus_tag="DehaBAV1_0294"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    304704..304706
                     /locus_tag="DehaBAV1_0294"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(304797..304799,304803..304805,304845..304847)
                     /locus_tag="DehaBAV1_0294"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            304962..305693
                     /locus_tag="DehaBAV1_0295"
                     /db_xref="GeneID:5132347"
     CDS             304962..305693
                     /locus_tag="DehaBAV1_0295"
                     /note="PFAM: regulatory protein, LuxR; response regulator
                     receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="two component LuxR family transcriptional
                     regulator"
                     /protein_id="YP_001213759.1"
                     /db_xref="GI:147668941"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:5132347"
                     /translation="MVNNQQYQSTKHSNHIEHKIRVILVDDHEIARQGLRTILSSASD
                     IQVIGEAANFEQMMDLLNDTIADVALIDIQIPGKNGIELAKELQICFPQMATLLITGY
                     QSNLYVAEALNCGIPGLITKDSRQGLIINAVRVAANGGSVWENAVLSETIKSMTRLCE
                     AQYSMRTYSGNSQFQQGKTVLLSPKQLELIKLVACGLTNKQIGSKMGYSEATVKKYLS
                     VLMYLLGVSKRTQVGIMATHFDINQ"
     misc_feature    305019..305669
                     /locus_tag="DehaBAV1_0295"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    305028..305372
                     /locus_tag="DehaBAV1_0295"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(305037..305042,305175..305177,305199..305201,
                     305259..305261,305316..305318,305325..305330)
                     /locus_tag="DehaBAV1_0295"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    305175..305177
                     /locus_tag="DehaBAV1_0295"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(305184..305189,305193..305201)
                     /locus_tag="DehaBAV1_0295"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    305325..305333
                     /locus_tag="DehaBAV1_0295"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    305505..305669
                     /locus_tag="DehaBAV1_0295"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(305508..305516,305553..305561,305583..305588,
                     305592..305597,305601..305615,305646..305648)
                     /locus_tag="DehaBAV1_0295"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(305541..305543,305547..305549,305553..305555,
                     305646..305654,305661..305663)
                     /locus_tag="DehaBAV1_0295"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            305957..307495
                     /locus_tag="DehaBAV1_0296"
                     /db_xref="GeneID:5132361"
     CDS             305957..307495
                     /locus_tag="DehaBAV1_0296"
                     /note="TIGRFAM: reductive dehalogenase;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="reductive dehalogenase"
                     /protein_id="YP_001213760.1"
                     /db_xref="GI:147668942"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012832"
                     /db_xref="GeneID:5132361"
                     /translation="MEMNIYHSTISRRNFMKGLGLSGAALGAATASAPVFHDLDEMIT
                     SVPKSTTQHAWWVKERDYEDITTPVDWTVWSRREALKNPMPPGFAGNYVPKEQARLQS
                     FRNEIKRGITEKIPGATLRDWALSEAGRSNTTSSSWMGLDVKPPWLWGEASALPVEPW
                     PEGAPKWESTPEDNLRTVQAAGHYFGTPQVGAMEINEHMIRMFDKDGFEHNYSASYEK
                     PMMRFRSEWFEDIPVGFQDANQVKHIPKSCKWAVTYIAAKENALQMTYGMRTGDPQDP
                     WYKRIFPLGYTTGEAYSKADYVKVQFMKFIKMLGYQTYYMGLAGGTSSNSPAGIFSGL
                     AEEARPALACSPYYGNAVRHIGIIVTDMPLSPTKPIDAGIVNFCKVCKKCAETCPSGA
                     ISMETEQQWEPACTGNNPGRKTWYLDWFKCRPWGSPYYCPNCQTVCPFNNPNKAIIHN
                     AVRMTAATTPIFNSFFSSLDKSFGYAHQRSDEERLNWWYRDLNTWQYDDVFGMGTKDP
                     KSWL"
     sig_peptide     305957..306052
                     /locus_tag="DehaBAV1_0296"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.966) with cleavage site probability 0.769 at
                     residue 32"
     misc_feature    306101..307048
                     /locus_tag="DehaBAV1_0296"
                     /note="Reductive dehalogenase subunit; Region:
                     Dehalogenase; pfam13486"
                     /db_xref="CDD:257810"
     misc_feature    306452..307381
                     /locus_tag="DehaBAV1_0296"
                     /note="reductive dehalogenase; Region: RDH; TIGR02486"
                     /db_xref="CDD:233890"
     misc_feature    307085..307279
                     /locus_tag="DehaBAV1_0296"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            307553..307783
                     /locus_tag="DehaBAV1_0297"
                     /db_xref="GeneID:5132073"
     CDS             307553..307783
                     /locus_tag="DehaBAV1_0297"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213761.1"
                     /db_xref="GI:147668943"
                     /db_xref="GeneID:5132073"
                     /translation="MVFYWIRSKHYKLTWYEWVIGISGALLLLFTIQNFLGSFAELQT
                     LAAYLFLLVTGLPSLIMLAVVWQLVVRRAKKT"
     gene            308094..308381
                     /locus_tag="DehaBAV1_0298"
                     /db_xref="GeneID:5132082"
     CDS             308094..308381
                     /locus_tag="DehaBAV1_0298"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213762.1"
                     /db_xref="GI:147668944"
                     /db_xref="GeneID:5132082"
                     /translation="MLDALSWGLHLIVLTGVCQLLDATARYLIDRDIAPDSRVMVIEN
                     PACPDEKITSCSLAGVSSQRFGCFSVMVGFNKLGVNKRSSNLRLKNNFLKN"
     misc_feature    <308097..308267
                     /locus_tag="DehaBAV1_0298"
                     /note="S-AdoMet dependent tetrapyrrole methylases; Region:
                     TP_methylase; cl00304"
                     /db_xref="CDD:260339"
     gene            complement(308492..308707)
                     /locus_tag="DehaBAV1_0299"
                     /db_xref="GeneID:5132064"
     CDS             complement(308492..308707)
                     /locus_tag="DehaBAV1_0299"
                     /note="PFAM: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001213763.1"
                     /db_xref="GI:147668945"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:5132064"
                     /translation="MTKKTIEQRFGERIRVLRKKAEISQEELAFRAGVHRTYLGGIER
                     GERNPSLKNIEAIAKALEVPISDLFIN"
     misc_feature    complement(308504..308677)
                     /locus_tag="DehaBAV1_0299"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(308576..308578,308651..308653,
                     308663..308665))
                     /locus_tag="DehaBAV1_0299"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(308579..308581,308654..308656))
                     /locus_tag="DehaBAV1_0299"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(308573..308578,308588..308590,
                     308597..308599,308630..308635))
                     /locus_tag="DehaBAV1_0299"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            308790..309389
                     /locus_tag="DehaBAV1_0300"
                     /db_xref="GeneID:5132078"
     CDS             308790..309389
                     /locus_tag="DehaBAV1_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213764.1"
                     /db_xref="GI:147668946"
                     /db_xref="GeneID:5132078"
                     /translation="MEDILVIKFIRSVATGLLIIMAGLALLNWVNSSESDNPISSTVA
                     YIPTKSSILQSPLALDSLKTSAHYADGYVFLDFYDPYRLSNYLNKYDYSETHQPYAEG
                     ERYGMYFSDVFYLVPGDNLKIVIYSDVPLGTDLACEISEYKNNGVSGSTPAYTVERYE
                     NGYRAIISCHATESGEYQFKLWHRDKSQSERCAIVFYFE"
     gene            complement(309434..309559)
                     /locus_tag="DehaBAV1_0301"
                     /db_xref="GeneID:5132298"
     CDS             complement(309434..309559)
                     /locus_tag="DehaBAV1_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213765.1"
                     /db_xref="GI:147668947"
                     /db_xref="GeneID:5132298"
                     /translation="MGRKKIAKTTTIDPQVKQRLEILSRIITRQYLIDKAKKRAR"
     gene            309679..310638
                     /locus_tag="DehaBAV1_0302"
                     /db_xref="GeneID:5132316"
     CDS             309679..310638
                     /locus_tag="DehaBAV1_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213766.1"
                     /db_xref="GI:147668948"
                     /db_xref="GeneID:5132316"
                     /translation="MPRKKAPSIKETREWLDLYESGWSEALLAQRKGRDIRTIRRYLA
                     KAQDERRLDLVESELIKSALAKHQEQLLLTLDNLYSAIALPEPYLSLNSTGNNGRIEL
                     NSGRVVVTQVAESTGVAVHLESEDSVLFSLVEEHLDHDLLFLMLNEWKSKLENYVRAC
                     SYIKESRTERLSRRGADERSYNIKEKSADEQICKSICMSDLSEFIYKNSLNYIIKNDK
                     SVLTKARERLAINKERGELILKPGNTLLSCPGKEAEYLQKTLELLTEESLQEHKGPIQ
                     QAYRKLEDETSKLKKVIEEIKLCNFIPGECRVCRRLKGQGGLR"
     gene            310635..312281
                     /locus_tag="DehaBAV1_0303"
                     /db_xref="GeneID:5132307"
     CDS             310635..312281
                     /locus_tag="DehaBAV1_0303"
                     /note="PFAM: Resolvase, N-terminal domain; Recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="YP_001213767.1"
                     /db_xref="GI:147668949"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="InterPro:IPR011109"
                     /db_xref="GeneID:5132307"
                     /translation="MKVALYARVSSEAQDVELSIAAQLRALRDYAAKNEQQIVYEFID
                     EAESGRTASRPEFKKMIALAKSNTSPFEAILVWKYSRFARNRVDSITYKTLLQKKGIK
                     VISINEPLDDTPTGKLMEGIIESLDEFYSANLGQDIKRGMKENALRGFFNGSQPPLGY
                     RIIKVKDGPKQRNRLEPESDTSSGIKTVRHIFGLAGKGQGCKEIAVTLNREGYRTRAG
                     ERWGRTTVHKILTNEAYIGTLVWGARAGRPASKNGEGVKLGNAFPGIIDKEVFQRVQQ
                     NMTARQPGNIHPRTIPSQYLLSGLAFCGCGASLTGHSAKSGRHFYYQCNRKFKQGNEV
                     CNGQAIPKSKLESAVITQIKSRILTEENLENLVSLVNKDLELASVQYNERLAVIDTEL
                     EDIRQRLNRLYEAIESGKLDYSDLSPRIKDLRSRQSDLEKSRIVAEAELLASGSESIK
                     IEQVKAYAGDLKQLLAEAEISECKAFLKTFVKKIEINGNKATLKYRLPLPGLKNGKEV
                     LPIETLGGAEGIRTPDLLLAKEALSRLSYSPTEHHYTKFE"
     misc_feature    310635..311357
                     /locus_tag="DehaBAV1_0303"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    310647..311057
                     /locus_tag="DehaBAV1_0303"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    order(310656..310658,310662..310664,310872..310877,
                     310884..310886)
                     /locus_tag="DehaBAV1_0303"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    310662..310664
                     /locus_tag="DehaBAV1_0303"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     misc_feature    311187..311462
                     /locus_tag="DehaBAV1_0303"
                     /note="Recombinase; Region: Recombinase; pfam07508"
                     /db_xref="CDD:254248"
     misc_feature    311520..311696
                     /locus_tag="DehaBAV1_0303"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     gene            complement(312176..312251)
                     /locus_tag="DehaBAV1_R0005"
                     /note="tRNA-Ala3"
                     /db_xref="GeneID:5132344"
     tRNA            complement(312176..312251)
                     /locus_tag="DehaBAV1_R0005"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:5132344"
     gene            complement(312287..313114)
                     /locus_tag="DehaBAV1_0304"
                     /db_xref="GeneID:5132053"
     CDS             complement(312287..313114)
                     /locus_tag="DehaBAV1_0304"
                     /note="PFAM: Patatin"
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="YP_001213768.1"
                     /db_xref="GI:147668950"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="GeneID:5132053"
                     /translation="MPKSKVPKIGIALGGGAARGIIHIGVLEVLEKEGLPLDLVTGTS
                     MGAIIGALYASGHKPQEMKEIVHNLSWKQLMPLLDLAAPRAGFLSSRKIKSYLKELIG
                     DITFAELKKPFACVAADVKTGEEVIFNEGLVIDGVIASMSLPIIFRPVKNKNRFLVDG
                     GIITPIPAQIVRDMGADFVIAVNAIYRHDYIKQNSDSEPSVFDTAFQIVNIMSIHMAQ
                     ENLLAADIAIEPDLSGIGPGDFLKAPEIVLRGELGATDAVPHLKHLLLQKFSYAPPI"
     misc_feature    complement(312338..313096)
                     /locus_tag="DehaBAV1_0304"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    complement(312563..313090)
                     /locus_tag="DehaBAV1_0304"
                     /note="Bacterial patatin-like phospholipase domain
                     containing protein 6; Region: Pat_NTE_like_bacteria;
                     cd07228"
                     /db_xref="CDD:132866"
     misc_feature    complement(order(312638..312640,312983..312985,
                     313058..313060,313064..313069))
                     /locus_tag="DehaBAV1_0304"
                     /note="active site"
                     /db_xref="CDD:132866"
     misc_feature    complement(312977..312991)
                     /locus_tag="DehaBAV1_0304"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132866"
     gene            complement(313092..313727)
                     /locus_tag="DehaBAV1_0305"
                     /db_xref="GeneID:5132341"
     CDS             complement(313092..313727)
                     /locus_tag="DehaBAV1_0305"
                     /note="PFAM: GCN5-related N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_001213769.1"
                     /db_xref="GI:147668951"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:5132341"
                     /translation="MPDIFEATNGQGFKQAVVESQNLRLRIIQAADAYKAFSLIKDPE
                     VTRYLMWDGPKTINELRLAYQDEAADFETGHRYSFAIERVDKPGLIGSLAFRLIGYKE
                     QALIGYWLGHKYWTKGYMTEAIRLSVHFAFKHLKAERIFGGVFKGNQPSRRTLEKNGF
                     QLDGTLRRDILVRGTWTDVWFMSLLREEWEQNPARYIPLTEEVIHAQIQSA"
     misc_feature    complement(313245..313664)
                     /locus_tag="DehaBAV1_0305"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    complement(313191..313655)
                     /locus_tag="DehaBAV1_0305"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            complement(313732..315324)
                     /locus_tag="DehaBAV1_0306"
                     /db_xref="GeneID:5132301"
     CDS             complement(313732..315324)
                     /locus_tag="DehaBAV1_0306"
                     /note="PFAM: protein of unknown function DUF87"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213770.1"
                     /db_xref="GI:147668952"
                     /db_xref="InterPro:IPR002789"
                     /db_xref="GeneID:5132301"
                     /translation="MTTENKLGIVIGGSLSGGVDVRLNGETLVEDMAVGRYVTIQGKT
                     KRFLGMITDVSLGVTDQRLMLTPPASDEKFLAEILSGTAAYGDLKVIPYLVLGSDEKS
                     LLDGPQPVKTIPSHYAPVDIASNEDIEMVFGKEDATHFYVGNPLDMETRLCLNLPELV
                     KRSNGIFGKSGTGKTFLTRTLLVGMLQKGSCVNLVFDMHSEYGWEGTSEKKHKVKALK
                     QLFPDRVAVFTLDGESSRKRKVSVDFEVKIGYDEIEPEDISLLRQTLNLTEQAVEAVY
                     QLRKHFKKNWIKEANNIGDEEEDKKLLDTLSIHESTFQNLRRGLNTLTRLPFIVENAP
                     VKAVDRVLEYLNRNINVVLEFGRYTDITAYILVANLLTRRIYTSYRDHMEQAMAEDAS
                     KPTPLVITIEEAHKFLNPEVASRTIFGTIAREMRKYNVTLLIIDQRPSGIDPEVMSQL
                     GTKITALLDNEKDIDAVLSGVSGKNELKGVLAKLASRQQALIFGAAVPMPVAFVPREY
                     DQNIYNEVSQKKISSEEIEELF"
     misc_feature    complement(313795..315312)
                     /locus_tag="DehaBAV1_0306"
                     /note="HerA helicase [Replication, recombination, and
                     repair]; Region: COG0433"
                     /db_xref="CDD:223510"
     misc_feature    complement(315040..315306)
                     /locus_tag="DehaBAV1_0306"
                     /note="HAS barrel domain; Region: HAS-barrel; pfam09378"
                     /db_xref="CDD:255328"
     misc_feature    complement(314200..314907)
                     /locus_tag="DehaBAV1_0306"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     pfam01935"
                     /db_xref="CDD:250980"
     gene            complement(315321..315920)
                     /locus_tag="DehaBAV1_0307"
                     /db_xref="GeneID:5132331"
     CDS             complement(315321..315920)
                     /locus_tag="DehaBAV1_0307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213771.1"
                     /db_xref="GI:147668953"
                     /db_xref="GeneID:5132331"
                     /translation="MDNLSTSRIGEVIDTSTTDFTAQCYQLYNTPALGALVKTGEGEN
                     TIYAAVYHATTSSIEPGRKPIARGQDAVSEEAIYAQSPQLSKLLRSEFSCLILGHRGQ
                     GQILHYLPPRPAHIHSFAESCTPEETAEFCKSFGFLNILVNSELPVPPDEVTAACLRH
                     LSAAAPDKQTFLVKAGKELAKLLPGQYQRLKVILERIQL"
     gene            complement(315990..317195)
                     /locus_tag="DehaBAV1_0308"
                     /db_xref="GeneID:5132099"
     CDS             complement(315990..317195)
                     /locus_tag="DehaBAV1_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213772.1"
                     /db_xref="GI:147668954"
                     /db_xref="GeneID:5132099"
                     /translation="MSLNLDKTALQIQDMVSELKGRDLEHQKHLQACLDGMARTPAEY
                     QRLLDKVERSKTTFLLARPAEIPNAVHQPPVLPQSYRILATDGSQIDVDRHQLSRCYL
                     INIGRVQLEYGKAPSASLESLPVLYARPEDMVISCGSKELAVEGTLLGIKRSVEETRH
                     LSEMADAAAPGLPTLALGDGTLILWSLLSKEFPEYVVENLLVDGYLKYLEQIKNLNTK
                     DRQVALASYISYPRSTDVVNTLRLLYCPYEPANCISKCDQLANGKRPCDILSGITDSM
                     LFDRILKPGERSALFASSSSILEKYYGEHHVYFYYLKTSEEIARVELPAWTVHCAELL
                     NLSHSLILEQCRLGHGYPVSLSEAHEQAVVSGQDRRIFNQLVEEMLTASQINPSSSAK
                     SLSKKTRWV"
     misc_feature    complement(316104..316955)
                     /locus_tag="DehaBAV1_0308"
                     /note="NurA nuclease; Region: NurA; smart00933"
                     /db_xref="CDD:214920"
     gene            317320..317943
                     /locus_tag="DehaBAV1_0309"
                     /db_xref="GeneID:5132232"
     CDS             317320..317943
                     /locus_tag="DehaBAV1_0309"
                     /note="PFAM: Lysine exporter protein (LYSE/YGGA)"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine exporter protein LysE/YggA"
                     /protein_id="YP_001213773.1"
                     /db_xref="GI:147668955"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="GeneID:5132232"
                     /translation="MTFMLTTLLSVMVISFSGVLMPGPMFALTLSRSYHTPWAGAQIV
                     LGHILVELPIILLIYFGFAGFFELIWVQILLSLAGGVMIVYMGLGMIKARREASQDKA
                     SFKHNTVVSGAAMSALNPFFLVWWATVGAMLVMKVSDYGLAGLGALAATHWLVDLAWL
                     CLISFIVYRTHRLWGSRVRELVFIGCGLLLVVFGVYFIISGLKLWLA"
     sig_peptide     317320..317382
                     /locus_tag="DehaBAV1_0309"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.851) with cleavage site probability 0.326 at
                     residue 21"
     misc_feature    317365..317922
                     /locus_tag="DehaBAV1_0309"
                     /note="LysE type translocator; Region: LysE; cl00565"
                     /db_xref="CDD:260502"
     gene            317970..318995
                     /locus_tag="DehaBAV1_0310"
                     /db_xref="GeneID:5131742"
     CDS             317970..318995
                     /locus_tag="DehaBAV1_0310"
                     /note="PFAM: histone deacetylase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase superfamily protein"
                     /protein_id="YP_001213774.1"
                     /db_xref="GI:147668956"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="GeneID:5131742"
                     /translation="MAVGLVYNHIYLNHDTGTHVENPDRLLAIMEYLETHGLKDRLVH
                     VEPKRVGMRELESFHKRSYISRVEEVGFSGGGWLDQDTVISLDSYEAALYAVGGVIEG
                     VDKVLSRELDSVFVLCRPPGHHALPEASMGFCVFNNVALGALHALNKHKLKRVAVVDF
                     DVHHGNGIQHVCLNDPRLIYLSLHQIHHFPFTGDSRENGPFQNILNIPLPAGCGDSHY
                     QKAFDEVIGPYLRKFAPELILVCAGYDAHFADDMGEMCLSQQGFAGITRAIKHAAEEV
                     CGGKLVFSLEGGYHYLGLAEGVGATLAVLLNEALPPPNTKAPEGAVGNPDIDLMINDL
                     RHINGIR"
     misc_feature    318024..318887
                     /locus_tag="DehaBAV1_0310"
                     /note="Histone deacetylases and histone-like deacetylases,
                     classII; Region: HDAC_classII; cd09992"
                     /db_xref="CDD:212518"
     misc_feature    order(318336..318341,318363..318368,318450..318452,
                     318456..318458,318702..318704,318828..318830)
                     /locus_tag="DehaBAV1_0310"
                     /note="active site"
                     /db_xref="CDD:212518"
     misc_feature    order(318450..318452,318456..318458,318702..318704)
                     /locus_tag="DehaBAV1_0310"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:212518"
     gene            complement(318969..319904)
                     /locus_tag="DehaBAV1_0311"
                     /db_xref="GeneID:5132074"
     CDS             complement(318969..319904)
                     /locus_tag="DehaBAV1_0311"
                     /note="TIGRFAM: cation diffusion facilitator family
                     transporter;
                     PFAM: cation efflux protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="YP_001213775.1"
                     /db_xref="GI:147668957"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="GeneID:5132074"
                     /translation="MATRKTRAASFSIASNSTLIAMKTVVGFVTGSVSILAEAIHSTL
                     DLIAAVIAFFGVKASDKPADIDHPYGHGKWENVSGTVEAVLIFVAAIWIIYEAVNRLI
                     GGSAPEMLEWGVVIMGISVVANTLVSRYLKKIAHETDSVALEADASHLTTDVITSAGV
                     LVGLVLVKITGWVILDPIVALLVALLIIKAAWDILNKSFGALVDARLPKEEVEAITSL
                     INEHTSKLVEFHNLRTRKAGSYRYVDLHLVMPKTLSVEKSHAICDHLEQDLKDKLKVD
                     YVTIHVEPCTEENCPECQMSCKKRHSELPDTVNMP"
     sig_peptide     complement(319839..319904)
                     /locus_tag="DehaBAV1_0311"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.728) with cleavage site probability 0.334 at
                     residue 22"
     misc_feature    complement(319029..319886)
                     /locus_tag="DehaBAV1_0311"
                     /note="Predicted Co/Zn/Cd cation transporters [Inorganic
                     ion transport and metabolism]; Region: MMT1; COG0053"
                     /db_xref="CDD:223131"
     gene            complement(319927..320832)
                     /gene="secF"
                     /locus_tag="DehaBAV1_0312"
                     /db_xref="GeneID:5132328"
     CDS             complement(319927..320832)
                     /gene="secF"
                     /locus_tag="DehaBAV1_0312"
                     /note="forms a complex with SecD and YajC; SecDFyajC
                     stimulates the proton motive force-driven protein
                     translocation; seems to modulate the cycling of SecA by
                     stabilizing its membrane-inserted state and appears to be
                     required for the release of mature proteins from the
                     extracytoplasmic side of the membrane; in some organisms,
                     such as Bacillus subtilis, SecD is fused to SecF"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecF"
                     /protein_id="YP_001213776.1"
                     /db_xref="GI:147668958"
                     /db_xref="InterPro:IPR003335"
                     /db_xref="InterPro:IPR005665"
                     /db_xref="GeneID:5132328"
                     /translation="MNKIIQHRPLFIFISALIILAGLASLLIFGLKPGIEFSSGSMLT
                     VKFDQTVSIDELTQELRSLGQNEAIVQVTGDGDYLIRTSQLDVSQKISLETSLEETFG
                     NLTERGFENVDPMIARQTTQMALIAIGAALVGILLYVTWAFRRMPKPFHYGTCAVIAL
                     FHDALVVLGIFALLAGIFGWEINLMFIIGIMAVIGYSINNTVVVFDRIRENQLKGIHP
                     SFEVVVNQSIMETVVRSINSSFTVIITVVALMLFLGASIQNLSIVMLIGLIAGTYDSL
                     FVAPSLLVTWENGDWGKLLKPFKKA"
     sig_peptide     complement(320758..320832)
                     /gene="secF"
                     /locus_tag="DehaBAV1_0312"
                     /product="preprotein translocase subunit SecF"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.932) with cleavage site probability 0.452 at
                     residue 25"
     misc_feature    complement(319969..320826)
                     /gene="secF"
                     /locus_tag="DehaBAV1_0312"
                     /note="preprotein translocase subunit SecF; Reviewed;
                     Region: secF; PRK13022"
                     /db_xref="CDD:237275"
     misc_feature    complement(319975..320556)
                     /gene="secF"
                     /locus_tag="DehaBAV1_0312"
                     /note="Protein export membrane protein; Region: SecD_SecF;
                     pfam02355"
                     /db_xref="CDD:216990"
     gene            complement(320825..322174)
                     /gene="secD"
                     /locus_tag="DehaBAV1_0313"
                     /db_xref="GeneID:5131470"
     CDS             complement(320825..322174)
                     /gene="secD"
                     /locus_tag="DehaBAV1_0313"
                     /note="part of the preprotein secretory system; when
                     complexed with proteins SecF and YajC, SecDFyajC
                     stimulates the proton motive force-driven protein
                     translocation, and appears to be required for the release
                     of mature proteins from the extracytoplasmic side of the
                     membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecD"
                     /protein_id="YP_001213777.1"
                     /db_xref="GI:147668959"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR003335"
                     /db_xref="InterPro:IPR005791"
                     /db_xref="GeneID:5131470"
                     /translation="MRRKNGLVFLAILAAMILAFTIVLPTDKGTLLGKGILFGLDLKG
                     GLHMVYQADLSNVDESDIDGVMDGVVEVISNRINPLGVTEALIQRQGDDRIVVELPGL
                     DITDEQKARIGRTALLEFGELAADGEDYKWENSLGKWKPVTATIDGVEYALTSAYFKD
                     STYVNRDQYGNILLVFEWDATGAKLSKEITTRLLNQQLGIFEGDEALSGDDGVPIAPV
                     INNVIETSGVIEGLSYNEADMLSNQLNAGRLPVPLESIYEQTVSPTLGQNFVDLAVKA
                     GLVGIILVMIFMIAFYRLPGLLSSIALVFYGVIVMALFKLVPVTLTLAGIGGFIVSAG
                     MAVDANILIFARLKEELLSGKTLGAAVEAGFSRAWSAIWDSNVTTFIACGILFWVGGT
                     IAAGAPVKGFAVTLFLGVAVSMFTAIFVTRTLLRLFVGTKTGKKLALFTTQTRGKNE"
     sig_peptide     complement(322109..322174)
                     /gene="secD"
                     /locus_tag="DehaBAV1_0313"
                     /product="preprotein translocase subunit SecD"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.576 at
                     residue 22"
     misc_feature    complement(320855..322150)
                     /gene="secD"
                     /locus_tag="DehaBAV1_0313"
                     /note="preprotein translocase subunit SecD; Reviewed;
                     Region: secD; PRK05812"
                     /db_xref="CDD:235615"
     misc_feature    complement(320921..321391)
                     /gene="secD"
                     /locus_tag="DehaBAV1_0313"
                     /note="protein-export membrane protein, SecD/SecF family;
                     Region: 2A0604s01; TIGR00916"
                     /db_xref="CDD:233183"
     gene            complement(322188..323684)
                     /locus_tag="DehaBAV1_0314"
                     /db_xref="GeneID:5131463"
     CDS             complement(322188..323684)
                     /locus_tag="DehaBAV1_0314"
                     /note="PFAM: Polynucleotide adenylyltransferase region;
                     metal-dependent phosphohydrolase, HD sub domain;
                     SMART: metal-dependent phosphohydrolase, HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide adenylyltransferase/metal
                     dependent phosphohydrolase"
                     /protein_id="YP_001213778.1"
                     /db_xref="GI:147668960"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:5131463"
                     /translation="MTNKNQLLHTDKKTAALLEDLHRLLSAEGTETYLVGGFLRNLVL
                     KKPTADIDLCVIGNGFSAASKISRHFKATQIVLDADNDVTRVMLPGFQLDISGTPDIS
                     ANLARRDFNLNAMAAPLSALNHGNLQIHAIVDPMQGLRDIENRVIRVTSSEVFRADPI
                     RLIRAIRLSAELGFELDEQTQSLITTHAGLISTVAGERIREELLKLLETSQTGIWEKC
                     LELGLLLSIFTELDPCYRHPQPYEHTWDVLEHSIKTIYALDAILGKSVWPYQKPEITS
                     EIYRDSNFEKYFIQQISGTSRIRTLAKLAALLHDIAKPQTRSTDPDGRVRFTGHPLEG
                     SRITSEILTRLRFSKKEISLVEKMVCYHLRPVQMNPDGQLPSSKAIYRYFRDLSEAAT
                     ATLYLSLADHLATDGPNLMVANWQEHVNIVAHILSEQKRQLTRLTPKRLITGTDLIER
                     FALRPGPRIKILLGEIAEAQAAGEIKTRREAFKFISQRLGGKPENNLN"
     misc_feature    complement(323253..323654)
                     /locus_tag="DehaBAV1_0314"
                     /note="RelA- and SpoT-like ppGpp Synthetases and
                     Hydrolases, catalytic domain; Region: Rel-Spo_like;
                     cl11966"
                     /db_xref="CDD:264491"
     misc_feature    complement(order(323403..323405,323529..323531,
                     323535..323537))
                     /locus_tag="DehaBAV1_0314"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143387"
     misc_feature    complement(322983..323168)
                     /locus_tag="DehaBAV1_0314"
                     /note="Probable RNA and SrmB- binding site of polymerase
                     A; Region: PolyA_pol_RNAbd; pfam12627"
                     /db_xref="CDD:257174"
     misc_feature    complement(322470..322790)
                     /locus_tag="DehaBAV1_0314"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(322482..322484,322755..322760))
                     /locus_tag="DehaBAV1_0314"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(322755..322757)
                     /locus_tag="DehaBAV1_0314"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(322242..322670)
                     /locus_tag="DehaBAV1_0314"
                     /note="tRNA nucleotidyltransferase domain 2 putative;
                     Region: tRNA_NucTran2_2; pfam13735"
                     /db_xref="CDD:258031"
     gene            complement(323844..324245)
                     /locus_tag="DehaBAV1_0315"
                     /db_xref="GeneID:5131581"
     CDS             complement(323844..324245)
                     /locus_tag="DehaBAV1_0315"
                     /note="PFAM: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_001213779.1"
                     /db_xref="GI:147668961"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:5131581"
                     /translation="MSKATSSNGWADLGEIIRQQRVKIPLTLQELAAKTSVSPSHLGR
                     IERGERFPSARILKRIAHPLGFEEDELFTLAGYLTPQKDSISEMEAEYTSIPRQLDPY
                     VAKVLAQEPIELQRAVIAILAMLKSISKSMT"
     misc_feature    complement(324033..324206)
                     /locus_tag="DehaBAV1_0315"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(324105..324107,324180..324182,
                     324192..324194))
                     /locus_tag="DehaBAV1_0315"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(324108..324110,324183..324185))
                     /locus_tag="DehaBAV1_0315"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(324102..324107,324117..324119,
                     324126..324128,324159..324164))
                     /locus_tag="DehaBAV1_0315"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(324505..326952)
                     /locus_tag="DehaBAV1_0316"
                     /db_xref="GeneID:5131478"
     CDS             complement(324505..326952)
                     /locus_tag="DehaBAV1_0316"
                     /note="TIGRFAM: primosomal protein N';
                     PFAM: helicase domain protein; type III restriction
                     enzyme, res subunit; DEAD/DEAH box helicase domain
                     protein;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="YP_001213780.1"
                     /db_xref="GI:147668962"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005259"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5131478"
                     /translation="MAFAELAVNTPVLRPGSFSYSIPLGLEIKPGQAVWAPFGPKIVQ
                     GIVLEVSDQPAFGQTREICGVISDTPLLSFHQLNLAAWISQTYLCSIYEALSPMLPPS
                     FERRSVAYISLEPSPLNKSEKPPATLSPSLQKIFDWLQTRDITPQTELENIFGKKTTQ
                     TAIPKLINQGLINRTYQISPVRTQTKFEKHFGLSEQALAFIKDQTLTKLSPRQTEVFE
                     CLRENPQGISKSRLNLLVKNNAAILKALEKKELILSEEHQVFRQPINYSQIETLPHLK
                     LSPPQEKCLESINRSLNTPPEDDQNPRTFLLHGITGSGKTEIYLQALAEALRLGKKAI
                     VLVPEISLTPQTIARFAGRFPGRVAVLHSRLSPGEQFDEWQRIKNGQADIVIGPRSAL
                     FAPLDKPGIIIIDEEHEWTYKQQNSQPRYHTRTVALKMTEEYGAVLVLGSATPDIDSY
                     FKAQNGLYQLLELPERLTPYRGASLPKTELVDMRTELSEGNRSIFSRNLHASIEKVLA
                     KHEQAILFINRRGGASFIQCRDCGYVAMCKSCDTPLTYHPDQENLVCHQCGRHYPNPL
                     TCPNCKSRRIKYLGMGTQKLEEETGLAFPQAKLLRWDSDVTKGKDSHQQIMDKFSRHQ
                     ADILIGTQMVAKGLDLPGVTLVGVINADISLNLPDFRAGERTFQLLAQVAGRAGRGLA
                     GGKVVIQTYTPENYAIQSAVCHDYPGFYAKEIAYRRELNNPPFQKLACLVFSHLNHDF
                     CQQQAILLAQTLREKADSTGSGTLEILGPAPAFIQRLRGRYRYQIILRSPNPANFLRD
                     INLGQGWSIDIDPYGLC"
     misc_feature    complement(324517..326952)
                     /locus_tag="DehaBAV1_0316"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     misc_feature    complement(325618..326040)
                     /locus_tag="DehaBAV1_0316"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(326005..326019)
                     /locus_tag="DehaBAV1_0316"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(325729..325740)
                     /locus_tag="DehaBAV1_0316"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(<325264..325344)
                     /locus_tag="DehaBAV1_0316"
                     /note="Trm112p-like protein; Region: Trm112p; cl01066"
                     /db_xref="CDD:260771"
     misc_feature    complement(324964..>325113)
                     /locus_tag="DehaBAV1_0316"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     gene            complement(326973..327368)
                     /gene="rplS"
                     /locus_tag="DehaBAV1_0317"
                     /db_xref="GeneID:5131464"
     CDS             complement(326973..327368)
                     /gene="rplS"
                     /locus_tag="DehaBAV1_0317"
                     /note="this protein is located at the 30S-50S ribosomal
                     subunit interface and may play a role in the structure and
                     function of the aminoacyl-tRNA binding site"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="YP_001213781.1"
                     /db_xref="GI:147668963"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="GeneID:5131464"
                     /translation="MEETMNNQEAPETSEEETVAVENTKAEKVLPNFGPGDTIKVHAR
                     IKEGDKERIQMFQGVVLKVKQAADGGNFTVRRISYGVGVERTFPFLSPNVTKVEIMKK
                     GRVRRARLFYLRKLSGKAARIKEVKQTPS"
     misc_feature    complement(326988..327311)
                     /gene="rplS"
                     /locus_tag="DehaBAV1_0317"
                     /note="50S ribosomal protein L19; Provisional; Region:
                     rplS; PRK05338"
                     /db_xref="CDD:235418"
     gene            complement(327492..328238)
                     /gene="trmD"
                     /locus_tag="DehaBAV1_0318"
                     /db_xref="GeneID:5131576"
     CDS             complement(327492..328238)
                     /gene="trmD"
                     /locus_tag="DehaBAV1_0318"
                     /EC_number="2.1.1.31"
                     /note="methylates guanosine-37 in various tRNAs; uses
                     S-adenosyl-L-methionine to transfer methyl group to tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /protein_id="YP_001213782.1"
                     /db_xref="GI:147668964"
                     /db_xref="InterPro:IPR002649"
                     /db_xref="GeneID:5131576"
                     /translation="MKIDVLTLFPEMFQSPFEESIFKRATDNNLVRLEIHNFRDFAHD
                     KHHAVDDSPYGGGAGMLLKPEPLFEAVEDVLREDPTPAPVILLSPQGRSFNQEVAREL
                     AKHERLIIICGHYEGFDERVREHLSTDEISIGDFVLTGGELAAMVVIDAVSRLIPGVL
                     GSGESSQDDSHSNGLLEHPHYTRPPVFRGWGIPDVLLSGNHAQINRWRRKESLRRTLK
                     RRPDMFEKIPLSKADRKLVDEILAEENTQG"
     misc_feature    complement(327507..328238)
                     /gene="trmD"
                     /locus_tag="DehaBAV1_0318"
                     /note="tRNA (guanine-N(1)-)-methyltransferase; Reviewed;
                     Region: trmD; PRK00026"
                     /db_xref="CDD:234581"
     gene            328421..328849
                     /locus_tag="DehaBAV1_0319"
                     /db_xref="GeneID:5132133"
     CDS             328421..328849
                     /locus_tag="DehaBAV1_0319"
                     /note="TIGRFAM: MraZ protein;
                     PFAM: protein of unknown function UPF0040"
                     /codon_start=1
                     /transl_table=11
                     /product="MraZ protein"
                     /protein_id="YP_001213783.1"
                     /db_xref="GI:147668965"
                     /db_xref="InterPro:IPR003444"
                     /db_xref="GeneID:5132133"
                     /translation="MFFGEFEYKLDEKGRFPLPPAIRPSLKDGLILAPGTGEKCIYAY
                     PLCEWKKLAESLKSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKTYAGVNI
                     EVIVAGVNNYLEIWDKETWESEKKASQEQAWQIIETLEEH"
     misc_feature    328421..328810
                     /locus_tag="DehaBAV1_0319"
                     /note="cell division protein MraZ; Reviewed; Region:
                     PRK00326"
                     /db_xref="CDD:234728"
     misc_feature    328421..>328594
                     /locus_tag="DehaBAV1_0319"
                     /note="MraZ protein; Region: MraZ; pfam02381"
                     /db_xref="CDD:111290"
     misc_feature    328637..328810
                     /locus_tag="DehaBAV1_0319"
                     /note="MraZ protein; Region: MraZ; pfam02381"
                     /db_xref="CDD:111290"
     gene            328856..329905
                     /gene="mraW"
                     /locus_tag="DehaBAV1_0320"
                     /db_xref="GeneID:5132289"
     CDS             328856..329905
                     /gene="mraW"
                     /locus_tag="DehaBAV1_0320"
                     /note="TIGRFAM: S-adenosyl-methyltransferase MraW;
                     PFAM: methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-methyltransferase MraW"
                     /protein_id="YP_001213784.1"
                     /db_xref="GI:147668966"
                     /db_xref="InterPro:IPR002903"
                     /db_xref="GeneID:5132289"
                     /translation="MIEYPHIPVMLEESIQGLGVIPGGRYVDCTLGAGGHSEAILEHS
                     YPGGQLLSIDADPSAITLAAERLKSFGSSVLLVNDNFANLKDICQRYEYMPVHGILFD
                     LGLSSMQLDRQESGFSFQTEAPLDMRFSPEQELTAADIINGYDVTELSDLIWKYGEEP
                     FSRRIARAIAEKRPFKTTTELAAAIERAVGGRHGRIHPATRTFQALRIAVNEELSHLE
                     SALSQAHSLLGHGGRLVVISYHSLEDRIVKQYFQKEAKGCICPDDIPQCVCDHQPSLR
                     IINRRVITPSDEEISRNPRSRSAKMRVAERIIEPGEGRFFSSREDELVNHVSRTGSVQ
                     HGQAKHKGVVQRGGS"
     misc_feature    328865..329776
                     /gene="mraW"
                     /locus_tag="DehaBAV1_0320"
                     /note="16S rRNA m(4)C1402 methyltranserfase; Provisional;
                     Region: PRK00050"
                     /db_xref="CDD:234597"
     gene            329976..331202
                     /locus_tag="DehaBAV1_0321"
                     /db_xref="GeneID:5132158"
     CDS             329976..331202
                     /locus_tag="DehaBAV1_0321"
                     /note="PFAM: cell division protein FtsA"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="YP_001213785.1"
                     /db_xref="GI:147668967"
                     /db_xref="InterPro:IPR003494"
                     /db_xref="GeneID:5132158"
                     /translation="MKNRIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHK
                     GLVVNINDARESIRESIRKAEQASGYKVESAYVGVTGRHVTSMNNKGVVAITRNDRLV
                     RSDDLKRVMATAQNISVPNDRKLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIIT
                     AAATSVQNLVKCIRGLGIDIDDLVLEPIASSEAVLTDDEKQVGVILADIGGGTTDICV
                     FKDGSIWHTAIIPVAGYQLTRDVAIGLGLPFDVAEEMKKRYGSVLPVYETKMESPSPI
                     CEDGHGVSYQDLCDIIRARVEEVLRLIMLEIPNSDYDSLVPAGLVLTGGSSNLAGMET
                     LGRDILRIPVRVGNPDKVYGIVDSLHDPAYATGVGLLLWGAKHQPVKKSWLDNIGFFG
                     RMRNLLKGFAGLFGTN"
     misc_feature    329976..331178
                     /locus_tag="DehaBAV1_0321"
                     /note="Cell division ATPase FtsA [Cell division and
                     chromosome partitioning]; Region: ftsA; COG0849"
                     /db_xref="CDD:223918"
     misc_feature    329991..330557
                     /locus_tag="DehaBAV1_0321"
                     /note="Cell division protein FtsA; Region: FtsA;
                     smart00842"
                     /db_xref="CDD:214850"
     misc_feature    330585..331019
                     /locus_tag="DehaBAV1_0321"
                     /note="Cell division protein FtsA; Region: FtsA;
                     pfam14450"
                     /db_xref="CDD:258601"
     gene            331242..332372
                     /locus_tag="DehaBAV1_0322"
                     /db_xref="GeneID:5132173"
     CDS             331242..332372
                     /locus_tag="DehaBAV1_0322"
                     /note="GTPase; similar structure to tubulin; forms
                     ring-shaped polymers at the site of cell division; other
                     proteins such as FtsA, ZipA, and ZapA, interact with and
                     regulate FtsZ function"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="YP_001213786.1"
                     /db_xref="GI:147668968"
                     /db_xref="InterPro:IPR000158"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="GeneID:5132173"
                     /translation="MAKTSFVPNPARIKVFGCGGGGCNAVTRMVREEIQGVEFIAINT
                     DAQALAITEAPIRLQIGERVTRGLGAGGDHNMGQKAAEESRDEIREIVNGADMVFVTA
                     GMGGGTGTGSAPIVAEESKKSGALTIAVVTKPFTFEGAHRASTAKEGINRLLGKVDTL
                     IIIPNDRLLDLCDQKTGVDAAFKMADDVLRHGVQAISEVITVPGLINLDFADVRAVMR
                     DAGPAWMSIGYGSGKNRASDAAKSALASPLLDVSITGSKGVLFNIVGGPDLSLMEVNE
                     AADVIKQAVDPDANIIFGVASDASMGSNVKITLIATGFVSKMGMAEEEGDDAITRQLK
                     GIKTEDELDVPSFLRRPLFNRARPVAPPVDTRSNKPSSRISW"
     misc_feature    331266..332291
                     /locus_tag="DehaBAV1_0322"
                     /note="cell division protein FtsZ; Validated; Region:
                     PRK09330"
                     /db_xref="CDD:236468"
     misc_feature    331272..332180
                     /locus_tag="DehaBAV1_0322"
                     /note="FtsZ is a GTPase that is similar to the eukaryotic
                     tubulins and is essential for cell division in
                     prokaryotes.  FtsZ is capable of polymerizing in a
                     GTP-driven process into structures similar to those formed
                     by tubulin. FtsZ forms a ring-shaped septum at...; Region:
                     FtsZ_type1; cd02201"
                     /db_xref="CDD:100021"
     misc_feature    order(331296..331304,331311..331313,331383..331385,
                     331548..331568,331641..331646,331665..331667,
                     331734..331736,331785..331787,331794..331799,
                     331806..331808)
                     /locus_tag="DehaBAV1_0322"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100021"
     misc_feature    order(331857..331862,331866..331868,332043..332054,
                     332061..332063)
                     /locus_tag="DehaBAV1_0322"
                     /note="SulA interaction site; other site"
                     /db_xref="CDD:100021"
     gene            332516..333043
                     /gene="nrdR"
                     /locus_tag="DehaBAV1_0323"
                     /db_xref="GeneID:5131509"
     CDS             332516..333043
                     /gene="nrdR"
                     /locus_tag="DehaBAV1_0323"
                     /note="PFAM: ATP-cone domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NrdR"
                     /protein_id="YP_001213787.1"
                     /db_xref="GI:147668969"
                     /db_xref="InterPro:IPR003796"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="GeneID:5131509"
                     /translation="MNCPYCSHPDSKVIDSRDVDDGVRRRRECVVCGQRFTTYERFQP
                     AGLFVVKKDQRREEFNKEKLLSGLRRACEKRPLPAGAVDKVAGDIEAELYNMGKAEIP
                     STLLGDMVMERLKMLDNIAYVRFASVYREFTDITQLKKVVDNLVNGQDEGIHKGQLSL
                     LPEDKAAPKTRYQRR"
     misc_feature    332516..332968
                     /gene="nrdR"
                     /locus_tag="DehaBAV1_0323"
                     /note="transcriptional regulator NrdR; Validated; Region:
                     nrdR; PRK00464"
                     /db_xref="CDD:234774"
     misc_feature    332654..332920
                     /gene="nrdR"
                     /locus_tag="DehaBAV1_0323"
                     /note="ATP cone domain; Region: ATP-cone; pfam03477"
                     /db_xref="CDD:251987"
     gene            333045..335645
                     /locus_tag="DehaBAV1_0324"
                     /db_xref="GeneID:5131516"
     CDS             333045..335645
                     /locus_tag="DehaBAV1_0324"
                     /EC_number="1.17.4.1"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="YP_001213788.1"
                     /db_xref="GI:147668970"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR013344"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="GeneID:5131516"
                     /translation="MVNHVSGKKPTPVNRNRVARAMFVAAASMGISDRVQIETLISQL
                     IKRLEKPVGLPGMEDLLPSDLKAPAVLATDDEIDIMVKEVLDAGNKDKQNQIETQAKE
                     EEPMPVKVQVKSEMKADARTEGLKLTDNAMCVLERRYLKKDKQGKTTETVEDMFRRVA
                     RTIAMGELIYNPKADVRSREDEFFNLMTRLEFLPNSPTLMNAGRELGQLSACFVLPVD
                     DSIESIFDAVKHTAMIHKSGGGTGFSFSRLRPEQDRVGTTGGVASGPVSFMRAFDVAT
                     DVIKQGGTRRGANMAILSIDHPDIMKFVHAKDKAGVLTNFNLSVAITDKFMQAVKDGV
                     DYDLLNPHNGEVVSSLNASEVFNKIVHMAWKTGDPGIVFIDRINAYNPTPQLGRIEST
                     NPCGEQPLLPYESCNLGSINLSRMVTVSGGQNTVDYKKLSRVIKSAVRFLDNVIDVNK
                     FPLPQIEEMTKKSRKIGLGVMGFADMLLELGVPYNSENSIKLAEEIMCFVNDEAHKFS
                     SELAVERGVFPAYRGSIYEKSGRPMRNASCTTIAPTGTLSIIAGCSSGIEPHFALCFT
                     RNILDGTKMIEVNPYFERAAKEGGYYSEELIKSLAEGAHLDEVDVPQDAKDLFVTAHQ
                     IVPEWHVRIQAAFQKCTDNAVSKTVNFSRDAGECDVAEVYKMAHASNLKGITIYRDGS
                     REDQPMSTGKAENKIETPAVAVNPNLMPRKRSKVTQGITERVTTGCGYIYVTVNSDEH
                     GICEVFSSLGKAGGCASAQLESTCRLISLALRSGMEVASVVKQLRGIRCPSIAWDDSK
                     AVLSCADAIASVLEKHVNGYSQPVAASTKTGSVSGLVRNIAGQCPECGSILVYQEGCF
                     ICPGCGYTKC"
     misc_feature    333390..335642
                     /locus_tag="DehaBAV1_0324"
                     /note="ribonucleotide-diphosphate reductase subunit alpha;
                     Validated; Region: PRK08665"
                     /db_xref="CDD:236330"
     misc_feature    333417..333665
                     /locus_tag="DehaBAV1_0324"
                     /note="Ribonucleotide reductase, all-alpha domain; Region:
                     Ribonuc_red_lgN; pfam00317"
                     /db_xref="CDD:249765"
     misc_feature    333582..335087
                     /locus_tag="DehaBAV1_0324"
                     /note="Class II ribonucleotide reductase, dimeric form;
                     Region: RNR_II_dimer; cd02888"
                     /db_xref="CDD:153089"
     misc_feature    order(333627..333632,333675..333677,333756..333764,
                     333897..333902,333906..333908,334221..334229,
                     334233..334235,334266..334268,334668..334685)
                     /locus_tag="DehaBAV1_0324"
                     /note="active site"
                     /db_xref="CDD:153089"
     misc_feature    order(333660..333662,333705..333710,333717..333722,
                     333726..333731,333738..333743,333750..333752,
                     333804..333806,333813..333824,333831..333833,
                     333846..333848,333855..333857,333864..333869,
                     333876..333878,333882..333890,333894..333896)
                     /locus_tag="DehaBAV1_0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153089"
     misc_feature    order(333696..333698,333702..333707,333714..333716,
                     333750..333752,333789..333791,333807..333809,
                     333813..333815,333828..333833,333846..333848,
                     333876..333884)
                     /locus_tag="DehaBAV1_0324"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153089"
     misc_feature    335211..335489
                     /locus_tag="DehaBAV1_0324"
                     /note="TSCPD domain; Region: TSCPD; pfam12637"
                     /db_xref="CDD:257182"
     misc_feature    335565..335633
                     /locus_tag="DehaBAV1_0324"
                     /note="PhnA Zinc-Ribbon; Region: PhnA_Zn_Ribbon;
                     pfam08274"
                     /db_xref="CDD:254700"
     gene            335639..335758
                     /locus_tag="DehaBAV1_0325"
                     /db_xref="GeneID:5131714"
     CDS             335639..335758
                     /locus_tag="DehaBAV1_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213789.1"
                     /db_xref="GI:147668971"
                     /db_xref="GeneID:5131714"
                     /translation="MLKNIGGYKMENTKDMLALVLVAAGFMYLMIVTVAGLIA"
     gene            335875..336459
                     /locus_tag="DehaBAV1_0326"
                     /db_xref="GeneID:5131735"
     CDS             335875..336459
                     /locus_tag="DehaBAV1_0326"
                     /note="PFAM: protein of unknown function DUF88"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213790.1"
                     /db_xref="GI:147668972"
                     /db_xref="InterPro:IPR002790"
                     /db_xref="GeneID:5131735"
                     /translation="MTDTLERVMIFIDGSNMYHYLKSHFQRTDIDFGCFCSKIAGHRR
                     LVRIYYYNAEVGRKEEPERFNDQKKFFTSLEKIPYMELRLGRLVYSGWPATPPYEKGV
                     DVLLSTDMLSHGFKNNFDTAILVAGDSDFVSALQAVKDNGKNVEVALFGKESTSVELR
                     KVADKIIAVDGRLLRNCWKQQRNNYGTQRPPQES"
     misc_feature    335875..336375
                     /locus_tag="DehaBAV1_0326"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1432"
                     /db_xref="CDD:224349"
     misc_feature    335896..336375
                     /locus_tag="DehaBAV1_0326"
                     /note="LabA_like proteins; Region: LabA_like; cd06167"
                     /db_xref="CDD:199895"
     misc_feature    order(335911..335913,335920..335922,336181..336183,
                     336250..336252,336256..336258,336262..336264)
                     /locus_tag="DehaBAV1_0326"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199895"
     gene            336428..338062
                     /locus_tag="DehaBAV1_0327"
                     /db_xref="GeneID:5131740"
     CDS             336428..338062
                     /locus_tag="DehaBAV1_0327"
                     /note="PFAM: Radical SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_001213791.1"
                     /db_xref="GI:147668973"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:5131740"
                     /translation="MARKDRLKNRKELSRTRVSYASSQRVAGESGVVIKDWGGRLPLA
                     VAYPNSYYVGMSNLGLHTLYRLINNYPEYLAERFFWEGGTAKGRPTLSVESRRPLTDY
                     VALLFTLSYELDFLNIPSMLADCGMPLYARERDEAFPLVIGGGACIMSNPSPVADFFD
                     AFCIGEAEAILPELLAVLSETAGESKGLILERLAKIPGLYVPSIPPEQPIERVFPSEL
                     TQGVGTAVFSTATELGEMYLMEVERGCGHQCRFCLVAGVFCPLRYHPLELLLKQAEEG
                     MLKRKRIGLVGPVVSDHPQVTELVSRLRNMGFGLSVSSLRIKPLSEKMLDELALSGVS
                     SLAMAPEAGSERLRRIIRKGITEDDIIRAAALVAEKGFRQLKFYFMLGLPGEADEDVE
                     EMIVLAEKAQQAMSSKGRGVRLSLNIAPFVPKPATPFQWLGMEDAALIKRRLDTIRLR
                     LEGQGIEVRAESPEMSQIQAVLSRGDSSLSNLLATAGGDSLACWKRAAKSLEIDSQSL
                     AKTRFDLADELPWHMLENQKQRQKLETEYKAAFKEI"
     misc_feature    336509..338056
                     /locus_tag="DehaBAV1_0327"
                     /note="radical SAM family uncharacterized protein; Region:
                     rSAM_fuse_unch; TIGR03960"
                     /db_xref="CDD:188475"
     misc_feature    337142..>337612
                     /locus_tag="DehaBAV1_0327"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(337160..337162,337166..337168,337172..337174,
                     337178..337186,337283..337285,337289..337294,
                     337364..337372,337442..337444,337565..337567)
                     /locus_tag="DehaBAV1_0327"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(338112..338561)
                     /locus_tag="DehaBAV1_0328"
                     /db_xref="GeneID:5131727"
     CDS             complement(338112..338561)
                     /locus_tag="DehaBAV1_0328"
                     /note="PFAM: GatB/Yqey domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GatB/Yqey domain-containing protein"
                     /protein_id="YP_001213792.1"
                     /db_xref="GI:147668974"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="GeneID:5131727"
                     /translation="MPTLKEKFGEEVKLSLRQGEKLKCSVLRMLVSAISYAEIAKQKT
                     FTDEEIIGVIAKEIKQRRESIDAYKQANRPELVEKEQQEMEILQSYMPEQMGEAELTL
                     IIKKVISETGASTPQDKGKVMGKLMPLVKGKADGQMVNAIVTALLNN"
     misc_feature    complement(338121..338549)
                     /locus_tag="DehaBAV1_0328"
                     /note="Yqey-like protein; Region: YqeY; pfam09424"
                     /db_xref="CDD:255357"
     gene            complement(338563..338757)
                     /gene="rpsU"
                     /locus_tag="DehaBAV1_0329"
                     /db_xref="GeneID:5131720"
     CDS             complement(338563..338757)
                     /gene="rpsU"
                     /locus_tag="DehaBAV1_0329"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="YP_001213793.1"
                     /db_xref="GI:147668975"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="GeneID:5131720"
                     /translation="MADVRPENNESFESMLKRFNRKVQQDGILSEARRRTRFERPPTR
                     RKRKDAAKRRLAIKAARKAT"
     misc_feature    complement(338572..338757)
                     /gene="rpsU"
                     /locus_tag="DehaBAV1_0329"
                     /note="30S ribosomal protein S21; Reviewed; Region: rpsU;
                     PRK00270"
                     /db_xref="CDD:234707"
     gene            complement(338931..340652)
                     /locus_tag="DehaBAV1_0330"
                     /db_xref="GeneID:5132145"
     CDS             complement(338931..340652)
                     /locus_tag="DehaBAV1_0330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213794.1"
                     /db_xref="GI:147668976"
                     /db_xref="GeneID:5132145"
                     /translation="MALLIVALPLSPVSAAASITLYPNSGPAGSLVNFSIATTATNGT
                     TAWILFGGTQITTATVSGGSASGSFTVPTTVTRGAYTVSTLGLESVASATFTVTPSIT
                     LASATGYVGDSVAVTGSGFAPSTTVNFYLSGSTTAFAHLNSSSTGTVSGTITIPPAKQ
                     GVLSITANDSGTPGTAPVNFTINPKITLSTDNPGVGDSITVTGSGFYEGIIQISVDSG
                     TAANAGVSVGSNGSFSTTFTIPALTRGIHTLTANDAWNKSAQATFDIAQKISVTPTSG
                     TVGTSITVKGSGFNTTGSVTLTYFGQSVTVALTSGTFTTTFVIPGVQAGVYTLSATDG
                     SVIATTTLTVTTNITMSPTNNASTPGSVGQEITLTGSGLKANDTVLVTFDSAQLTITP
                     SPIVDSNGGFSLIFKIPATTAGPHTITVISGTTSKTFTFFVEGTAPATPAPLTPEMGL
                     KAKQPVVFDWEDVTDPSGVTYVLEIATDENFATILYQIKDLTDSTYTMTEAQKLESVS
                     SDSPYWWRVKAVDGAGNASAYTGAGSFTVGFSLDLPAWATYVLIGIGGLLLLALGFWL
                     GRRNADY"
     sig_peptide     complement(340599..340652)
                     /locus_tag="DehaBAV1_0330"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.922) with cleavage site probability 0.478 at
                     residue 18"
     misc_feature    complement(340149..340361)
                     /locus_tag="DehaBAV1_0330"
                     /note="CARDB; Region: CARDB; pfam07705"
                     /db_xref="CDD:254374"
     gene            340905..341219
                     /locus_tag="DehaBAV1_0331"
                     /db_xref="GeneID:5132153"
     CDS             340905..341219
                     /locus_tag="DehaBAV1_0331"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213795.1"
                     /db_xref="GI:147668977"
                     /db_xref="GeneID:5132153"
                     /translation="MTLLENDLRIEEADLLPELTSYPDQGCEFSKTCLGCPLPVCIFD
                     QPRGRQRWLKRQRDKEIVSLFQHGQSERELADRFRLSIRTIQRVLKKSLAGVNINRNA
                     EV"
     misc_feature    <341040..341177
                     /locus_tag="DehaBAV1_0331"
                     /note="Mor transcription activator family; Region: Mor;
                     cl02360"
                     /db_xref="CDD:243003"
     gene            341229..342593
                     /locus_tag="DehaBAV1_0332"
                     /db_xref="GeneID:5132151"
     CDS             341229..342593
                     /locus_tag="DehaBAV1_0332"
                     /note="PFAM: phage portal protein, SPP1"
                     /codon_start=1
                     /transl_table=11
                     /product="phage portal protein, SPP1"
                     /protein_id="YP_001213796.1"
                     /db_xref="GI:147668978"
                     /db_xref="InterPro:IPR006428"
                     /db_xref="GeneID:5132151"
                     /translation="MVQVFNPGELASRDLDRLKRYMNLLDFYQGKQWEIRPSRNEKQL
                     TFNYARVVVDKLCSYLMSGVNFGAEAVTDQGSEKAALARSMLNEVYQQNNLEQLDLET
                     EIDCAVLGDGCFKVIWDAAAGRVRVSAPDIQGIYAWWSPDDMSRIYRVASRYALNSEE
                     AAVSYGLELSAKRSFLTEVWTEETFELWLDEKLLESKPNPYGFIPFVIFPNLREPKRF
                     WGVSDLDEIMEPQRELNRALSQLSRILELSGNPIAVLENVEQSEDIAVRPGAVWNLPE
                     DTRAYLLDLLQGGGVGLHINYVDLLYRTLHDIAEAPRAAFGGSGRDLSGVALEIELQP
                     LLQRVWRKRLIRSVAYRKRSGMILRLLEKYRGLDFNGVDPSISFSPVLPRDLSVVVGN
                     EQTMVQSGIHSRRKAMNELGIKDPDAEFERWCEERRRILEMNRDSSVKSGKQRQSERV
                     ALEE"
     misc_feature    341274..342536
                     /locus_tag="DehaBAV1_0332"
                     /note="Phage portal protein, SPP1 Gp6-like; Region:
                     Phage_prot_Gp6; cl19531"
                     /db_xref="CDD:267884"
     gene            342617..343066
                     /locus_tag="DehaBAV1_0333"
                     /db_xref="GeneID:5132148"
     CDS             342617..343066
                     /locus_tag="DehaBAV1_0333"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213797.1"
                     /db_xref="GI:147668979"
                     /db_xref="GeneID:5132148"
                     /translation="MKTTEKEPEPLVSETEAVSTEDSAESMDSLKERLALSQSRAEEL
                     LKSQQEACERVTQLEVELRLAVESYRRLMVEQNPEVIPELISGQTVEEINRSLEVSRK
                     LVARVKQSLEKDAVLARVPLGQASRQKPDFSSLSAREKIKYAVGGTN"
     misc_feature    <342773..342955
                     /locus_tag="DehaBAV1_0333"
                     /note="Flagellar basal body-associated protein FliL;
                     Region: FliL; cl00681"
                     /db_xref="CDD:260568"
     gene            343069..343989
                     /locus_tag="DehaBAV1_0334"
                     /db_xref="GeneID:5132403"
     CDS             343069..343989
                     /locus_tag="DehaBAV1_0334"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213798.1"
                     /db_xref="GI:147668980"
                     /db_xref="GeneID:5132403"
                     /translation="MAISLTEASKLSNDILKQGVIETIVRESPVLANMPFIEVMGNGL
                     TYNQEKTLPDISFYDTGDTWDESTPTFEQKTAQLKIMGGDADVDNFLKTTRSNVQDLE
                     TAIIELKAKALKDKFEEVFIYGDSAVSSKQFDGLRKLINPASASSQLVAAGASGASLS
                     LAKLDELVDAVKGGKPDMLLMSRRSRRKLNALLRAGGGMLETDRDKWGNFIQFWDGIP
                     IGVSDWILDTHVVAEGLETATSGGGCSAIYALQFGEGGLCGLSSPGFVQVEALGSLED
                     KDASRTRVKWYCSLALFSAVKAAALIGVTD"
     misc_feature    343123..>343761
                     /locus_tag="DehaBAV1_0334"
                     /note="Phage capsid family; Region: Phage_capsid; cl19393"
                     /db_xref="CDD:267746"
     gene            344057..344656
                     /locus_tag="DehaBAV1_0335"
                     /db_xref="GeneID:5131582"
     CDS             344057..344656
                     /locus_tag="DehaBAV1_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213799.1"
                     /db_xref="GI:147668981"
                     /db_xref="GeneID:5131582"
                     /translation="MNLVAMRTLVRRDLHDEDEVNRRWTDAELDRHIGHALEELSRSV
                     PLETECLIPVTDGDREFTLSTLEGFIRLQAVEYPIDSYPPVFHRFDCRADKMKLLDEV
                     LPEDGYIRLYYSASHTMTAESTSLPSYLEDLVAIGAEGFASLEWAVFCVNRVNSGGTD
                     TPKVFEAIGRERLVYFRNELRRLCSQNKVRVNSLFTPAG"
     gene            344703..344942
                     /locus_tag="DehaBAV1_0336"
                     /db_xref="GeneID:5131543"
     CDS             344703..344942
                     /locus_tag="DehaBAV1_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213800.1"
                     /db_xref="GI:147668982"
                     /db_xref="GeneID:5131543"
                     /translation="MNFYRELWSRIGGRPWTYILRDFWHKYEGLCILALVAGGAFLGH
                     WLWHNVLWYLLNFTFGYIAGHLFWGKDYIPDQKGD"
     gene            344943..346943
                     /locus_tag="DehaBAV1_0337"
                     /db_xref="GeneID:5131680"
     CDS             344943..346943
                     /locus_tag="DehaBAV1_0337"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213801.1"
                     /db_xref="GI:147668983"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="GeneID:5131680"
                     /translation="MYPLSPSLLSAQQSACACPKVKLTVRNRLDGASKLKWEEIYAGT
                     QPEGYHSVAIAGDGAMIRIRIGDNPDNYRLYFQRVAQPAPGADFGQWTYSGSYFFSRA
                     GVVSFGNKVCVVAVDYNRNMFIFESTNNGQTWSAPVKIGTSNTSHVYGVSIAFKPNGD
                     MAVFYIERTLLCYKKRVNGNWQSRQQWDKSTDVLSGVSAVYDGDWRLAVSGTDLFGCS
                     KVWSLSLGDGADFAVGVWSSLYEFASAPAGGLYSYTSVSMDCPDVFRVCYLENYTGSV
                     ADKRAFLSHLVADTGFNDNIWRESVPTSMSSDYGFAMVNDGQYVYLAGISRIYRAKIA
                     QNSLEIGADILRLESACGNLKGSLAVELDNSSGRYTGAGNGELDMLAPGSEIEFYPGY
                     ETESGNEYGPGQLYVIQSLGRRIAGGKSSLLIRAEDAFCRLKRWRATNQMRWNRNSSQ
                     LSVRGILGYVLSKAGIRMEVLNASAQLGNFYPDFTIHVGDDGFELMGKLLSFVTDLVF
                     LQGNCLYSIYPQAADNPLYSYGVTHPVFSGIYADTSSEVNRVVLEGVDAASNLFMVQG
                     FVWEEIYQNHDLTLRLYDRNINTLAQAGERLDSCLRMAVLKQQMGQIVVPINCGQQLF
                     DVISISQPECGLEGLIRRINGIRTSYEPCKGIYRQELSLGKV"
     gene            346953..347165
                     /locus_tag="DehaBAV1_0338"
                     /db_xref="GeneID:5132299"
     CDS             346953..347165
                     /locus_tag="DehaBAV1_0338"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213802.1"
                     /db_xref="GI:147668984"
                     /db_xref="GeneID:5132299"
                     /translation="MDIKRAVLKVFNSTSYTASIQLAGDYKSVLEEVKVARNIPSSEM
                     LAGRNLGVWFYDDHNTKDTLVIAVYS"
     gene            complement(347280..348653)
                     /locus_tag="DehaBAV1_0339"
                     /db_xref="GeneID:5131496"
     CDS             complement(347280..348653)
                     /locus_tag="DehaBAV1_0339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213803.1"
                     /db_xref="GI:147668985"
                     /db_xref="GeneID:5131496"
                     /translation="MINKLRPYQQDVARAVLRSIFNQQGQTFSVEIARQGGKNELSSQ
                     LELLLLTLYMFEPKNLVKCAPTFKPQLNISMMRLKDRLNEAGFTNIYHTEGGYIIRLN
                     QARAVFLSAEPSASVVGNTAHLLLEVDEAQDVNKEKYSKEFKPMGATTNVTTVLYGTT
                     WDSFSLLEEIKEQNIEKEQKDGLKRHFRYDWEAVAAHNPAYLAYALSEKERLGENHPL
                     FLTQYRLLPVSGGGGMFSNEQLDLLKGNHPCQIYPEKGKVYVAGLDLAGEDSQTGGIS
                     PTTVNLRRDSSVLTIAELDYTFAKAPYNLPQVRLVCHYSWQGTRHALLYEKLVELLGK
                     VWKCRKVAVDATGLGQPVASFLRESLGSRILPFAFQPASKSRLGFNLLSAVNSGRLKM
                     YAANGSSEYTLFWQEMGLARADYRQSQQMNFYVETTRGHDDYLMSLALCLEAAEAYAP
                     RSAKGSN"
     misc_feature    complement(347325..348428)
                     /locus_tag="DehaBAV1_0339"
                     /note="Terminase-like family; Region: Terminase_6;
                     pfam03237"
                     /db_xref="CDD:251820"
     gene            complement(348643..349005)
                     /locus_tag="DehaBAV1_0340"
                     /db_xref="GeneID:5131566"
     CDS             complement(348643..349005)
                     /locus_tag="DehaBAV1_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213804.1"
                     /db_xref="GI:147668986"
                     /db_xref="GeneID:5131566"
                     /translation="MTQEFIERKKGAPYGNQNARKHGFYSRVLDTDELEDYEQATLTE
                     GIDEEIALLRVKIKSVLRHDPDNLKLLMQAVTTLSLLLSARYNISRQDKGGLKEAIFN
                     VLRDVAVPLGIIKATFDK"
     misc_feature    complement(<348889..>348975)
                     /locus_tag="DehaBAV1_0340"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5484"
                     /db_xref="CDD:227771"
     gene            349113..349808
                     /locus_tag="DehaBAV1_0341"
                     /db_xref="GeneID:5131477"
     CDS             349113..349808
                     /locus_tag="DehaBAV1_0341"
                     /note="PFAM: protein of unknown function DUF164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213805.1"
                     /db_xref="GI:147668987"
                     /db_xref="InterPro:IPR003743"
                     /db_xref="GeneID:5131477"
                     /translation="MQLAKELYQLQELELDLESHLMQASKLQAILQDDSALRQAENNL
                     VEAASHLKEQQASLRELESQSADLDAKINEIKKSLYSGRINNPKELSNLSKEQEILEA
                     KRTQIDDQALAGMDRLEELQTNCNQVMEGLETARSEWQQNQTQNTQSLNLILLEIEKL
                     KNERHEFMSCFEQPDLVLFQTLRKSKGRAVSKVEQGNCRGCGLKLTAAWMQRARAGTL
                     VQCSGCQRILYLD"
     misc_feature    349122..349805
                     /locus_tag="DehaBAV1_0341"
                     /note="Zn-ribbon protein, possibly nucleic acid-binding
                     [General function prediction only]; Region: COG1579"
                     /db_xref="CDD:224495"
     misc_feature    349638..349796
                     /locus_tag="DehaBAV1_0341"
                     /note="Putative zinc ribbon domain; Region: DUF164;
                     pfam02591"
                     /db_xref="CDD:251399"
     gene            349848..350231
                     /locus_tag="DehaBAV1_0342"
                     /pseudo
                     /db_xref="GeneID:5132046"
     gene            350362..350665
                     /locus_tag="DehaBAV1_R0006"
                     /db_xref="GeneID:5132066"
     misc_RNA        350362..350665
                     /locus_tag="DehaBAV1_R0006"
                     /product="RNAse P"
                     /note="Bacterial RNase P class A as predicted by Rfam
                     (RF00010), score 243.33"
                     /db_xref="GeneID:5132066"
     gene            complement(350773..351390)
                     /locus_tag="DehaBAV1_0343"
                     /db_xref="GeneID:5131221"
     CDS             complement(350773..351390)
                     /locus_tag="DehaBAV1_0343"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213806.1"
                     /db_xref="GI:147668988"
                     /db_xref="GeneID:5131221"
                     /translation="MLGRLLLVLLGLSMLSGIYLAVQQSHLSAFLNTTSQTNFVIPSY
                     LHLCEEAVDQATLGLNILLAVSFVSGMFYLYLSHAFYVNLHRITPRYKSRRVFPGFLI
                     PVINLVFPLLFTAETWQLSKQPLETQTALPEYKINLLFKFWWILCLLAVTLFVFPQIS
                     PFALSDSYSSRESVANIFTVATVIAASGGSFILFYQFNTRLKLSN"
     sig_peptide     complement(351325..351390)
                     /locus_tag="DehaBAV1_0343"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.955) with cleavage site probability 0.791 at
                     residue 22"
     misc_feature    complement(350794..351303)
                     /locus_tag="DehaBAV1_0343"
                     /note="Domain of unknown function (DUF4328); Region:
                     DUF4328; pfam14219"
                     /db_xref="CDD:258411"
     gene            complement(351502..351675)
                     /locus_tag="DehaBAV1_0344"
                     /db_xref="GeneID:5131420"
     CDS             complement(351502..351675)
                     /locus_tag="DehaBAV1_0344"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213807.1"
                     /db_xref="GI:147668989"
                     /db_xref="GeneID:5131420"
                     /translation="MRSIIYNQSNPLVNLTNGWYLCILSILALKSSLFEASRVPDFII
                     WENHPPADITCNS"
     gene            351733..351963
                     /locus_tag="DehaBAV1_0345"
                     /db_xref="GeneID:5131476"
     CDS             351733..351963
                     /locus_tag="DehaBAV1_0345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213808.1"
                     /db_xref="GI:147668990"
                     /db_xref="GeneID:5131476"
                     /translation="MEDLNISALDFVQFCHRRCGQEWPELYDEMCRVAGRRLYRGMGY
                     YELNNLGIPLDLANLDSTLALVDQFKSNQKCS"
     gene            352061..353194
                     /locus_tag="DehaBAV1_0346"
                     /db_xref="GeneID:5132136"
     CDS             352061..353194
                     /locus_tag="DehaBAV1_0346"
                     /EC_number="3.4.21.102"
                     /note="TIGRFAM: carboxyl-terminal protease;
                     PFAM: PDZ/DHR/GLGF domain protein; peptidase S41"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyl-terminal protease"
                     /protein_id="YP_001213809.1"
                     /db_xref="GI:147668991"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR004447"
                     /db_xref="InterPro:IPR005151"
                     /db_xref="GeneID:5132136"
                     /translation="MTFRIKVLLGTILSMVGLLGSFALGYFSGGVSALNSDENLSSIV
                     TAWQIITTEYVEPDIIDQAALAEAAIKGMMDELNDPHSVYLNAEDYQASLEYDDGQYV
                     GIGATVQIEDGVITLIPYEGSPAALAGIQAGDILLEVDGQSVDGFSLADLSPLVRGEK
                     GTLITLKVERSISAQPLLFNVTRDEILIPSVSSEMMGDIAYIRLSRFSERTDAELEQV
                     LKNLGDAKGIVLDLRGNPGGLVSSVINVTSRFVSSGVVLTTVDNAGNSEEYKIVPKAV
                     TTSLPMVVLVDQYSASGSEALSGALQDYGRATIVGKTTYGKGSVNRTFDVTGNTGIYL
                     TIGRWYTPNGRMIEGQGITPDIELELAGDEAVNWALNFMHGEA"
     misc_feature    352061..353152
                     /locus_tag="DehaBAV1_0346"
                     /note="Periplasmic protease [Cell envelope biogenesis,
                     outer membrane]; Region: Prc; COG0793"
                     /db_xref="CDD:223864"
     sig_peptide     352061..352162
                     /locus_tag="DehaBAV1_0346"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.837 at
                     residue 34"
     misc_feature    352361..352612
                     /locus_tag="DehaBAV1_0346"
                     /note="PDZ domain of C-terminal processing-,
                     tail-specific-, and tricorn proteases, which function in
                     posttranslational protein processing, maturation, and
                     disassembly or degradation, in Bacteria, Archaea, and
                     plant chloroplasts. May be responsible for...; Region:
                     PDZ_CTP_protease; cd00988"
                     /db_xref="CDD:238488"
     misc_feature    order(352367..352378,352382..352384,352514..352519,
                     352526..352531)
                     /locus_tag="DehaBAV1_0346"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238488"
     misc_feature    <352637..353137
                     /locus_tag="DehaBAV1_0346"
                     /note="C-terminal processing peptidase; serine protease
                     family S41; Region: Peptidase_S41_CPP; cd07560"
                     /db_xref="CDD:143476"
     misc_feature    order(352934..352936,353009..353011)
                     /locus_tag="DehaBAV1_0346"
                     /note="Catalytic dyad [active]"
                     /db_xref="CDD:143476"
     gene            353310..354350
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /db_xref="GeneID:5132139"
     CDS             353310..354350
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /EC_number="6.1.1.20"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a heterotetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_001213810.1"
                     /db_xref="GI:147668992"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004188"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="GeneID:5132139"
                     /translation="MEEIKNITDITQSALAELEAITDLKDLEAWRVRYLGKKSLLTGA
                     LRNLASLPIEERKAAGAAANEAKAALEAAFLQKEQISKEKQFASRNEGLDITLPGRPW
                     PIGRIHPLTQVTNEVTTIFSSLGFSVVEGPEIEDDYHNFEALNIPEDHPARENMQTFW
                     IDRPNDNGRLDTLLRTHTSPMQVRYMEKNKPPIRIVVPGKVYRYEATDATHIPMFTQV
                     EGLVVDRGISMAHLKGTLMEFCRRFFGANRKVRFRCDYFPFVEPGVEVAVSCTCGGKK
                     ECSVCHGSGWLEILGAGMVHPKVLERVGIDSEQYTGFAFGMGLERLPMLRYGIDDIRL
                     FYSNDTRFLRQF"
     misc_feature    353319..354347
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="phenylalanyl-tRNA synthetase subunit alpha;
                     Validated; Region: pheS; PRK00488"
                     /db_xref="CDD:234780"
     misc_feature    353364..>353477
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="Aminoacyl tRNA synthetase class II, N-terminal
                     domain; Region: Phe_tRNA-synt_N; pfam02912"
                     /db_xref="CDD:111764"
     misc_feature    353631..354332
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) alpha chain
                     catalytic core domain. PheRS belongs to class II
                     aminoacyl-tRNA synthetases (aaRS) based upon its structure
                     and the presence of three characteristic sequence motifs.
                     This domain is primarily responsible...; Region:
                     PheRS_alpha_core; cd00496"
                     /db_xref="CDD:238277"
     misc_feature    order(353631..353633,353640..353642,353649..353654,
                     353673..353675,353688..353693,353697..353705,
                     353754..353756,353769..353771,353781..353798,
                     353862..353864,353883..353891,353901..353903,
                     353907..353909,353913..353915,353919..353921,
                     353943..353945,353994..354002,354006..354011,
                     354069..354071,354090..354098,354102..354104,
                     354195..354200,354315..354317,354321..354329)
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238277"
     misc_feature    353685..353705
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="motif 1; other site"
                     /db_xref="CDD:238277"
     misc_feature    order(353769..353777,353838..353840,353844..353846,
                     353853..353855,353916..353918,353922..353924,
                     353937..353945,353952..353954,353958..353960,
                     353964..353966,354078..354080,354084..354089,
                     354171..354188,354252..354263,354270..354272,
                     354303..354305)
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="active site"
                     /db_xref="CDD:238277"
     misc_feature    353913..353924
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="motif 2; other site"
                     /db_xref="CDD:238277"
     misc_feature    354255..354272
                     /gene="pheS"
                     /locus_tag="DehaBAV1_0347"
                     /note="motif 3; other site"
                     /db_xref="CDD:238277"
     gene            354352..356781
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /db_xref="GeneID:5132226"
     CDS             354352..356781
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /EC_number="6.1.1.20"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a tetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 2 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="YP_001213811.1"
                     /db_xref="GI:147668993"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR004532"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="GeneID:5132226"
                     /translation="MKIPLKWLKEYLPTDIQPAELAERMTMAGTEVTVLNSHKDKWPN
                     VYVGQIMEVNRHPNADRLVLVKVDWGQGQETVVTGAPNCKVGDKVVFARTGAVLIDGH
                     NGKEIVLKPAVLRGVESCGMVCSERELGLSDEHEGILVLPADALVGMLASEYLGEVIL
                     DLELTPNRGDLMCVTGVARELGALIDRLPAISDPDFKATGPDIKEKIEIEINNSKLCT
                     RYTASLIEGIKLGESPDWLKERLIACGMRPINNVVDATNYVMLEFGQPLHAFDYDQIK
                     SRHIIVRPAAEGEVLTTLDGVERKLSPDMLLITEPDRIIALAGVMGGENTEVTEKTSR
                     ILLESATFDKQSIRKTARGLKLQSEASARFEKGLSYELAPIALKRATQLILEIAGGQA
                     ASGLIDVLPNKKERNGIVLSLAKVNQILGYEKEPPDACKIAKRLGFIWLPEYVPGMEE
                     FGYGATEDMVRIYPGYWRMDIETDIDMIEEVARIAGYHTIPCLPLDKAIPKIETPPLP
                     GMKRFLRQILSGYGFQELISYSFTSREMLSRVSSGAEPEFLAISNPMSSEQEVMRTSL
                     RPSLYASLAANRRFEKDGLRLYELGRVYLPKENKKQEEPEMLCAVIAGGSSQSRWQRN
                     TAGFDFFDVKGIVESMVSRLGLSADFVVSHEHGLSHGYQAGILVGDMPVGILGQVSPQ
                     IADIFDITEPVYMFEINLSKLITRAMVRRKFNPINRFPAVERDLALVIDRHITNRQVI
                     DILSEYDLVKNAELFDMYQGKQIAENKKSLAYHLLFQSDTHTLKDAEVDGVMSQILGR
                     LNTETGAVLRS"
     misc_feature    354352..356778
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="phenylalanyl-tRNA synthetase subunit beta;
                     Reviewed; Region: pheT; PRK00629"
                     /db_xref="CDD:234804"
     misc_feature    354484..354798
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="tRNA-binding-domain-containing prokaryotic
                     phenylalanly tRNA synthetase (PheRS) beta chain.  PheRS
                     aminoacylate phenylalanine transfer RNAs (tRNAphe).
                     PheRSs belong structurally to class II aminoacyl tRNA
                     synthetases (aaRSs) but, as they aminoacylate...; Region:
                     tRNA_bind_bactPheRS; cd02796"
                     /db_xref="CDD:239196"
     misc_feature    order(354532..354534,354571..354573,354631..354633,
                     354685..354687,354706..354708,354715..354717)
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239196"
     misc_feature    354997..355518
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="B3/4 domain; Region: B3_4; pfam03483"
                     /db_xref="CDD:251992"
     misc_feature    355576..355812
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="tRNA synthetase B5 domain; Region: B5; pfam03484"
                     /db_xref="CDD:251993"
     misc_feature    355891..356460
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) beta chain
                     core domain. PheRS belongs to class II aminoacyl-tRNA
                     synthetases (aaRS) based upon its structure. While class
                     II aaRSs generally aminoacylate the 3'-OH ribose of the
                     appropriate tRNA,  PheRS is an...; Region:
                     PheRS_beta_core; cd00769"
                     /db_xref="CDD:238392"
     misc_feature    order(355897..355899,355906..355908,355918..355920,
                     355924..355926,355930..355938,355996..356007,
                     356038..356040,356080..356082,356110..356112,
                     356125..356127,356131..356133,356137..356139,
                     356158..356160,356257..356259)
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238392"
     misc_feature    355918..355938
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="motif 1; other site"
                     /db_xref="CDD:238392"
     misc_feature    356056..356067
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="motif 3; other site"
                     /db_xref="CDD:238392"
     misc_feature    356131..356139
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="motif 2; other site"
                     /db_xref="CDD:238392"
     misc_feature    356503..356775
                     /gene="pheT"
                     /locus_tag="DehaBAV1_0348"
                     /note="Ferredoxin-fold anticodon binding domain; Region:
                     FDX-ACB; pfam03147"
                     /db_xref="CDD:251758"
     gene            356871..357506
                     /locus_tag="DehaBAV1_0349"
                     /db_xref="GeneID:5132128"
     CDS             356871..357506
                     /locus_tag="DehaBAV1_0349"
                     /EC_number="3.6.1.1"
                     /note="PFAM: Inorganic pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic diphosphatase"
                     /protein_id="YP_001213812.1"
                     /db_xref="GI:147668994"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="GeneID:5132128"
                     /translation="MLSDSSKKIKKEVEAINSEFKTIVGCGEAKCPKLKRLRLASTPD
                     ITLTVMIEIPKGSRNKYEYDKERKVIKFDRMLFSAVHYPSDYGFIVDTLAEDGDPLDA
                     LVLVWEPTFPGCMIETKPVGLFKMYDEKGPDAKLLCVPIGDPHFNFIRDLSDVPPHLL
                     KEIFHFFNIYKELESKKTGVEGWEDRESAIKTYWESHQRYLDTLKDTKQEK"
     misc_feature    357006..357464
                     /locus_tag="DehaBAV1_0349"
                     /note="Inorganic pyrophosphatase. These enzymes hydrolyze
                     inorganic pyrophosphate (PPi) to two molecules of
                     orthophosphates (Pi). The reaction requires bivalent
                     cations. The enzymes in general exist as homooligomers;
                     Region: pyrophosphatase; cd00412"
                     /db_xref="CDD:238239"
     misc_feature    order(357033..357038,357192..357197)
                     /locus_tag="DehaBAV1_0349"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238239"
     misc_feature    order(357048..357050,357090..357092,357126..357128,
                     357378..357383)
                     /locus_tag="DehaBAV1_0349"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238239"
     misc_feature    order(357054..357056,357156..357158,357171..357173,
                     357252..357254,357267..357269)
                     /locus_tag="DehaBAV1_0349"
                     /note="metal binding sites [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238239"
     gene            complement(357571..359280)
                     /locus_tag="DehaBAV1_0350"
                     /db_xref="GeneID:5131469"
     CDS             complement(357571..359280)
                     /locus_tag="DehaBAV1_0350"
                     /EC_number="6.1.1.15"
                     /note="catalyzes the formation of prolyl-tRNA(Pro) from
                     proline and tRNA(Pro)"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="YP_001213813.1"
                     /db_xref="GI:147668995"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="GeneID:5131469"
                     /translation="MRYSRLFGKTQREIPSDAETISHQLLLRSGMIAQLTAGVYSFMP
                     LAWRSIQKIETIIRQEMNKAGCQELAMPVLQPVEIWQQSGREAPFGQTLFHLKDRKDR
                     NLVLGPTHEEVITDLASRYIQSYRDLPQRLYQIQAKFRDEPRPRGGLIRVREFIMKDM
                     YSFDASPEGLDDSYQTMKQAYESVYRRCGLESMVIDADSGAIGGKASHEFMIVAESGE
                     DSIIYCPKCSYAANAEKAVFKKKTLSKETLKDLEEVATPGQKAISDVARFLAVKPENT
                     LKAVFYMADGKFVMAVIRGDLDINEVKLKNLLKCNDLRLAEDGEVKAAGVVAGSASPV
                     GLKNILIVADDSVENGSNFVAGANKDGFHLKNVNCGRDFRADKMADIALAAEGSACPF
                     CDGTFASKRGVEVGHIFKLGTFLSERFGANFTDAEGVSHPIIMGCYGMGVGRLLAAAI
                     EQNHDEKGIIWPMPIAPYQVYICGLFLDNPVVRESAEKIYKELEAKSIEVLFDDRELT
                     AGVKFNDADLLGIPLRLTISPRNLDKGGVEFKLRRNKESELVPLDSIVERVIATIKSE
                     SDL"
     misc_feature    complement(357589..359280)
                     /locus_tag="DehaBAV1_0350"
                     /note="prolyl-tRNA synthetase; Provisional; Region:
                     PRK09194"
                     /db_xref="CDD:236405"
     misc_feature    complement(357925..359232)
                     /locus_tag="DehaBAV1_0350"
                     /note="Prolyl-tRNA synthetase (ProRS) class II core
                     catalytic domain. ProRS is a homodimer. It is responsible
                     for the attachment of proline to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ProRS_core_prok;
                     cd00779"
                     /db_xref="CDD:238402"
     misc_feature    complement(order(358819..358821,358870..358872,
                     358930..358932,358984..358998,359002..359004,
                     359062..359067,359071..359079,359128..359130,
                     359149..359160,359179..359184))
                     /locus_tag="DehaBAV1_0350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(359062..359085)
                     /locus_tag="DehaBAV1_0350"
                     /note="motif 1; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(order(357949..357951,357958..357960,
                     357964..357972,358060..358062,358066..358071,
                     358075..358077,358804..358806,358810..358812,
                     358816..358818,358825..358833,358855..358857,
                     358861..358863,358948..358950,358954..358956))
                     /locus_tag="DehaBAV1_0350"
                     /note="active site"
                     /db_xref="CDD:238402"
     misc_feature    complement(358855..358866)
                     /locus_tag="DehaBAV1_0350"
                     /note="motif 2; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(358138..358602)
                     /locus_tag="DehaBAV1_0350"
                     /note="INS is an amino acid-editing domain inserted (INS)
                     into the bacterial class II prolyl-tRNA synthetase (ProRS)
                     however, this CD is not exclusively bacterial. It is also
                     found at the N-terminus of the eukaryotic/archaea-like
                     ProRS's of yeasts and...; Region: ProRS-INS; cd04334"
                     /db_xref="CDD:239826"
     misc_feature    complement(order(358213..358215,358291..358296,
                     358447..358449))
                     /locus_tag="DehaBAV1_0350"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239826"
     misc_feature    complement(357949..357966)
                     /locus_tag="DehaBAV1_0350"
                     /note="motif 3; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(357604..357882)
                     /locus_tag="DehaBAV1_0350"
                     /note="ProRS Prolyl-anticodon binding domain, short
                     version found predominantly in bacteria. ProRS belongs to
                     class II aminoacyl-tRNA synthetases (aaRS). This alignment
                     contains the anticodon binding domain, which is
                     responsible for specificity in tRNA-binding; Region:
                     ProRS_anticodon_short; cd00861"
                     /db_xref="CDD:238438"
     misc_feature    complement(order(357661..357663,357667..357669,
                     357697..357699,357721..357723,357739..357741,
                     357853..357858))
                     /locus_tag="DehaBAV1_0350"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238438"
     gene            complement(359374..360420)
                     /gene="ispG"
                     /locus_tag="DehaBAV1_0351"
                     /db_xref="GeneID:5131479"
     CDS             complement(359374..360420)
                     /gene="ispG"
                     /locus_tag="DehaBAV1_0351"
                     /EC_number="1.17.7.1"
                     /note="catalyzes the conversion of 2C-methyl-D-erythritol
                     2,4-cyclodiphosphate into 4-hydroxy-3-methyl-2-en-1-yl
                     diphosphate; involved in isoprenoid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="YP_001213814.1"
                     /db_xref="GI:147668996"
                     /db_xref="InterPro:IPR004588"
                     /db_xref="GeneID:5131479"
                     /translation="MITRRQSTEIRLGNLTIGGSAPISVQSMTKTDTRNIPATIAQIK
                     ELEECGCEIIRLAIPDMEAASALKSIRPKVKIPIVADIHFDYRLALASLSAGVDGLRL
                     NPGNIGDPERVKAVVKSAKEREIPIRIGVNAGSLPKDLPPELTIAQKMVKAAMGHIKI
                     LEGLDFGLIKVSLKAFDVPTTIEAYTQIASLIPYPLHVGITETGTPKTGLVRSAVGIG
                     NLLYMGIGDTIRVSLTAPPHEEVFAAYEILKSLNLRQRGPILVSCPTCSRTEVDIVGI
                     ASQVQEALNKIDKPIRVAVMGCAVNGPGEAKEADLGIACGKGQGLLFRKGEKIAVVPE
                     DELVDALLREIASL"
     misc_feature    complement(359386..360420)
                     /gene="ispG"
                     /locus_tag="DehaBAV1_0351"
                     /note="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase; Reviewed; Region: ispG; PRK00366"
                     /db_xref="CDD:234737"
     misc_feature    complement(359386..360411)
                     /gene="ispG"
                     /locus_tag="DehaBAV1_0351"
                     /note="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
                     synthase; Region: ispG_gcpE; TIGR00612"
                     /db_xref="CDD:233052"
     gene            complement(360456..361493)
                     /locus_tag="DehaBAV1_0352"
                     /db_xref="GeneID:5131497"
     CDS             complement(360456..361493)
                     /locus_tag="DehaBAV1_0352"
                     /note="PFAM: PDZ/DHR/GLGF domain protein; peptidase M50"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M50"
                     /protein_id="YP_001213815.1"
                     /db_xref="GI:147668997"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="InterPro:IPR008915"
                     /db_xref="GeneID:5131497"
                     /translation="MLLTVVSFLIIFSIVVISHELGHFFTAKAIGVKVEEFGFGYPPR
                     IFGRKFGQTEYTLNWLPLGGFVKVEDDPVNNKGLSSKSAGKRLLFFSSGALVNAILPI
                     ILFAFALIVPHDVLVGRVNVEEVVPNSPAAEAGLVTGDTILSINDQEIRNTAEFSRAS
                     QLNLGQSIEITVLHADQTQSTVSLTPRWQPPAGEGPVGISLQTLDYQITSESESVLKA
                     IPLSVKQNFETLVLFKNSILGLIMGSVPFDVVGPVGLAQMTGDVARAGVGPLLEFTAF
                     LSLNLAIINLLPLPALDGGRIFFVFIEWIRGGRRISPKVENLIHMIGFFLLIGLMLTV
                     TFQDIIRIAGN"
     misc_feature    complement(360468..361493)
                     /locus_tag="DehaBAV1_0352"
                     /note="RIP metalloprotease RseP; Region: TIGR00054"
                     /db_xref="CDD:232801"
     misc_feature    complement(360471..361481)
                     /locus_tag="DehaBAV1_0352"
                     /note="RseP-like Site-2 proteases (S2P), zinc
                     metalloproteases (MEROPS family M50A), cleave
                     transmembrane domains of substrate proteins, regulating
                     intramembrane proteolysis (RIP) of diverse signal
                     transduction mechanisms. In Escherichia coli, the S2P
                     homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163"
                     /db_xref="CDD:100084"
     misc_feature    complement(order(360615..360617,360639..360641,
                     361425..361427,361434..361439))
                     /locus_tag="DehaBAV1_0352"
                     /note="active site"
                     /db_xref="CDD:100084"
     misc_feature    complement(360936..361181)
                     /locus_tag="DehaBAV1_0352"
                     /note="PDZ domain of bacterial and plant zinc
                     metalloprotases, presumably membrane-associated or
                     integral membrane proteases, which may be involved in
                     signalling and regulatory mechanisms. May be responsible
                     for substrate recognition and/or binding, as most PDZ...;
                     Region: PDZ_metalloprotease; cd00989"
                     /db_xref="CDD:238489"
     misc_feature    complement(order(361011..361016,361023..361028,
                     361167..361169,361173..361181))
                     /locus_tag="DehaBAV1_0352"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238489"
     misc_feature    complement(360630..360641)
                     /locus_tag="DehaBAV1_0352"
                     /note="putative substrate binding region [chemical
                     binding]; other site"
                     /db_xref="CDD:100084"
     gene            complement(361494..362627)
                     /locus_tag="DehaBAV1_0353"
                     /db_xref="GeneID:5131578"
     CDS             complement(361494..362627)
                     /locus_tag="DehaBAV1_0353"
                     /EC_number="1.1.1.267"
                     /note="catalyzes the NADP-dependent rearrangement and
                     reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to
                     2-C-methyl-D-erythritol 4-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="YP_001213816.1"
                     /db_xref="GI:147668998"
                     /db_xref="InterPro:IPR003821"
                     /db_xref="InterPro:IPR013512"
                     /db_xref="InterPro:IPR013644"
                     /db_xref="GeneID:5131578"
                     /translation="MVHSIKKVVILGSTGSIGRQTLEVIRSLPDHFKVLGLAGGANVN
                     LLKEQAGEFRPEYIYCRDCHKESACNSRFIPMEEMAALPEADVIVVATPGGAGLQPVL
                     AAAKASKVIALANKESLVSAGEIVTGIVRENKAKLLPVDSEHSAIWQCLSGEVTPPSR
                     IILTASGGPFRSLTKNEIDKVTPEQALKHPSWKMGLKVTIDSASLMNKGLEIIEARWL
                     FDMHIQNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQYALTYPERVANHTLP
                     RLNWAEVGKLDFEIPDMTRFPCLGLAISAGEEGKTFPAALCAADEVAVDLFLKGKISF
                     GQIPELIAKVLDAHQPVSKPDIDDILAADAWARQKVTELAGNL"
     misc_feature    complement(361497..362612)
                     /locus_tag="DehaBAV1_0353"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase;
                     Provisional; Region: PRK05447"
                     /db_xref="CDD:235472"
     misc_feature    complement(362259..362606)
                     /locus_tag="DehaBAV1_0353"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase;
                     Region: DXP_reductoisom; pfam02670"
                     /db_xref="CDD:251461"
     misc_feature    complement(361971..362219)
                     /locus_tag="DehaBAV1_0353"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase
                     C-terminal; Region: DXP_redisom_C; pfam08436"
                     /db_xref="CDD:254800"
     misc_feature    complement(361518..361877)
                     /locus_tag="DehaBAV1_0353"
                     /note="DXP reductoisomerase C-terminal domain; Region:
                     DXPR_C; pfam13288"
                     /db_xref="CDD:257629"
     gene            complement(362612..363415)
                     /locus_tag="DehaBAV1_0354"
                     /db_xref="GeneID:5131484"
     CDS             complement(362612..363415)
                     /locus_tag="DehaBAV1_0354"
                     /note="PFAM: phosphatidate cytidylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="YP_001213817.1"
                     /db_xref="GI:147668999"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="GeneID:5131484"
                     /translation="MLKKRILSGCLLALISLVVIWVDQPIAWLTLAMAVVVALALNEF
                     YNAVTVYLKSQPFKALGIFWGMLIVISPHLQIESILPFLLGSFSLTSLIYLLTLKDRT
                     DAFPRWAWTLSGVIYIGLLASFWVALRELPMGREWVLWTLILTSATDTMAFFIGSRFG
                     KQKMAPSISPNKSWQGAVGGAVFSIIVAPIFADLMDLPINMFIAMLLGLLVSVAGQTG
                     DIAESLFKRNMHCKDSGNLIPGHGGIMDRLDSLLFTGIVVYYYVIWFIQ"
     sig_peptide     complement(363347..363415)
                     /locus_tag="DehaBAV1_0354"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.974) with cleavage site probability 0.737 at
                     residue 23"
     misc_feature    complement(362621..363409)
                     /locus_tag="DehaBAV1_0354"
                     /note="Cytidylyltransferase family; Region: CTP_transf_1;
                     pfam01148"
                     /db_xref="CDD:250399"
     gene            complement(363419..364129)
                     /locus_tag="DehaBAV1_0355"
                     /db_xref="GeneID:5131585"
     CDS             complement(363419..364129)
                     /locus_tag="DehaBAV1_0355"
                     /EC_number="2.5.1.31"
                     /note="TIGRFAM: undecaprenyl diphosphate synthase;
                     PFAM: Di-trans-poly-cis-decaprenylcistransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl diphosphate synthase"
                     /protein_id="YP_001213818.1"
                     /db_xref="GI:147669000"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="GeneID:5131585"
                     /translation="MDTTATINNTPPDHIAIIMDGNGRWAERRGLSRLEGHKAGLENA
                     RRVIRHLSSLGVKYVTLYSFSTENWKRPDAEIKGLFGLINDVISSYIPELAGNNIRLR
                     HLGHLDKLPAMLKHKLESLLSETSQNSGLTLSLAFDYGGRDEIIQAVKKLVKDGIEPD
                     KISEELFAGYLFTTGIPEAGLIIRTGGEIRLSNFLLWQSAYSELYFSEVMWPDFGEKE
                     IDRAISAFNQRQRRFGGL"
     misc_feature    complement(363446..364090)
                     /locus_tag="DehaBAV1_0355"
                     /note="Cis (Z)-Isoprenyl Diphosphate Synthases; Region:
                     Cis_IPPS; cd00475"
                     /db_xref="CDD:259850"
     misc_feature    complement(order(363554..363556,363560..363562,
                     363578..363580,363725..363727,363872..363874,
                     363881..363886,363905..363907,363917..363919,
                     363941..363943,363998..364000,364007..364009,
                     364019..364021,364031..364033,364058..364075))
                     /locus_tag="DehaBAV1_0355"
                     /note="active site"
                     /db_xref="CDD:259850"
     misc_feature    complement(order(363512..363514,363518..363532,
                     363536..363544,363551..363565,363596..363598,
                     363629..363631,363638..363646,363680..363685,
                     363692..363697,363701..363706))
                     /locus_tag="DehaBAV1_0355"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259850"
     gene            complement(364194..364715)
                     /gene="frr"
                     /locus_tag="DehaBAV1_0356"
                     /db_xref="GeneID:5131506"
     CDS             complement(364194..364715)
                     /gene="frr"
                     /locus_tag="DehaBAV1_0356"
                     /note="Rrf; Frr; ribosome-recycling factor; release factor
                     4; RF4; recycles ribosomes upon translation termination
                     along with release factor RF-3 and elongation factor EF-G;
                     A GTPase-dependent process results in release of 50S from
                     70S; inhibited by release factor RF-1; essential for
                     viability; structurally similar to tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="YP_001213819.1"
                     /db_xref="GI:147669001"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="GeneID:5131506"
                     /translation="MSASLDVLLQELSGIRTGRSSPALVEHIRVEYAGVPTPINHLAN
                     ISAPDPRYITIQPWDRSCLSAIEKAIMKSDLGLMPNNDGNIIRLNIPPLSEERRQEMI
                     KIVNKRLEEDKIAMRNVRRDAMDEMKKLEKAKEISQDDLKRGSDQLQKITDNFIAKAD
                     KLGADKEAELRQV"
     misc_feature    complement(364206..364715)
                     /gene="frr"
                     /locus_tag="DehaBAV1_0356"
                     /note="Ribosome recycling factor (RRF). Ribosome recycling
                     factor dissociates the posttermination complex, composed
                     of the ribosome, deacylated tRNA, and mRNA, after
                     termination of translation.  Thus ribosomes are 'recycled'
                     and ready for another...; Region: RRF; cd00520"
                     /db_xref="CDD:238288"
     misc_feature    complement(order(364437..364448,364656..364667))
                     /gene="frr"
                     /locus_tag="DehaBAV1_0356"
                     /note="hinge region; other site"
                     /db_xref="CDD:238288"
     gene            complement(364753..365478)
                     /gene="pyrH"
                     /locus_tag="DehaBAV1_0357"
                     /db_xref="GeneID:5132141"
     CDS             complement(364753..365478)
                     /gene="pyrH"
                     /locus_tag="DehaBAV1_0357"
                     /EC_number="2.7.4.-"
                     /note="Catalyzes the phosphorylation of UMP to UDP"
                     /codon_start=1
                     /transl_table=11
                     /product="uridylate kinase"
                     /protein_id="YP_001213820.1"
                     /db_xref="GI:147669002"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR011817"
                     /db_xref="GeneID:5132141"
                     /translation="MAEIKYKRILLKLSGEAFKGATGYGIDIPTVRNIAQEIKHICLM
                     GVEVAIVVGGGNIWRGATAAKEGIDRVSADYAGMLATIINAITLQDALEREGIVTRTQ
                     SALSVQQVAEPYIRRRAVRHLEKGRVVIFAGGTGNPYMTTDTAAALRAIEIEASVLLM
                     AKNKVDGVYTADPQKHPEATLFQHLTYMEAINKRLQVMDATALSLCLDNKLPIIVFDL
                     QSSESLVSAISGQPIGTLISSES"
     misc_feature    complement(364765..365460)
                     /gene="pyrH"
                     /locus_tag="DehaBAV1_0357"
                     /note="UMP kinase (UMPK)-Ec, the microbial/chloroplast
                     uridine monophosphate kinase (uridylate kinase) enzyme
                     that catalyzes UMP phosphorylation and plays a key role in
                     pyrimidine nucleotide biosynthesis; regulation of this
                     process is via feed-back control and...; Region:
                     AAK_UMPK-PyrH-Ec; cd04254"
                     /db_xref="CDD:239787"
     misc_feature    complement(order(364963..364968,364972..364974,
                     364978..364980,364987..364989,364993..364995,
                     365050..365055,365314..365322,365431..365436,
                     365443..365445))
                     /gene="pyrH"
                     /locus_tag="DehaBAV1_0357"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239787"
     misc_feature    complement(order(365053..365061,365065..365070,
                     365074..365076,365245..365250,365257..365259,
                     365299..365304,365314..365322))
                     /gene="pyrH"
                     /locus_tag="DehaBAV1_0357"
                     /note="uridine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239787"
     misc_feature    complement(order(364852..364854,365023..365028,
                     365035..365037,365062..365070,365074..365076,
                     365098..365100,365116..365118,365125..365127,
                     365137..365139,365179..365181,365209..365211,
                     365230..365232,365251..365256,365278..365283))
                     /gene="pyrH"
                     /locus_tag="DehaBAV1_0357"
                     /note="homohexameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239787"
     gene            complement(365493..365996)
                     /gene="tsf"
                     /locus_tag="DehaBAV1_0358"
                     /db_xref="GeneID:5132147"
     CDS             complement(365493..365996)
                     /gene="tsf"
                     /locus_tag="DehaBAV1_0358"
                     /note="EF-Ts; functions during elongation stage of protein
                     translation; forms a dimer; associates with EF-Tu-GDP
                     complex and promotes exchange of GDP to GTP resulting in
                     regeneration of the active form of EF-Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="YP_001213821.1"
                     /db_xref="GI:147669003"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001816"
                     /db_xref="GeneID:5132147"
                     /translation="MAINAEQIKELREKCGAGVMECRNALVDANGNVEKAQEILREKG
                     LVKAAKKAERETVQGIVESYIHTQGRIGALVELNCETDFVARTDAFKELAHNLAMQVA
                     AMCPLYLSEEDRPAECEVEAENACLLLQPYIKDPSKTINGLIIETVAKVGENIRLKRF
                     ARFELGG"
     misc_feature    complement(365496..365996)
                     /gene="tsf"
                     /locus_tag="DehaBAV1_0358"
                     /note="elongation factor Ts; Reviewed; Region: tsf;
                     PRK12332"
                     /db_xref="CDD:183447"
     misc_feature    complement(365877..365990)
                     /gene="tsf"
                     /locus_tag="DehaBAV1_0358"
                     /note="UBA/TS-N domain; Region: UBA; pfam00627"
                     /db_xref="CDD:250010"
     gene            complement(366021..366758)
                     /gene="rpsB"
                     /locus_tag="DehaBAV1_0359"
                     /db_xref="GeneID:5132121"
     CDS             complement(366021..366758)
                     /gene="rpsB"
                     /locus_tag="DehaBAV1_0359"
                     /note="one of the last subunits in the assembly of the 30S
                     subunit; absence of S2 does not inhibit assembly but
                     results in an inactive subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S2"
                     /protein_id="YP_001213822.1"
                     /db_xref="GI:147669004"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005706"
                     /db_xref="GeneID:5132121"
                     /translation="MPTTNIKELLEAGAHFGHQTSRWHPRMKKYIFTKRNGIHIIDLE
                     KTVVMLDKACNYINQVVSDGGKVLFVGTKKQAQEILAEEAKRCGMYFINQRWTGGILT
                     NFHSIQSRIDYLVRLEDQQARGDFSRLPKKEAQKLGEEIARLNRTMGGFKEMTRLPDV
                     IFVVDPIKEKIAMAEAKRMGVPLVAMVDTNCNPDEVDYPVPSNDDAMRAIKLICSKMA
                     DAVIEAQNAMKVTEVETTGEAQAETAG"
     misc_feature    complement(366090..366734)
                     /gene="rpsB"
                     /locus_tag="DehaBAV1_0359"
                     /note="Ribosomal protein S2 (RPS2), involved in formation
                     of the translation initiation complex, where it might
                     contact the messenger RNA and several components of the
                     ribosome. It has been shown that in Escherichia coli RPS2
                     is essential for the binding of...; Region: RPS2; cd01425"
                     /db_xref="CDD:100106"
     misc_feature    complement(order(366225..366227,366234..366236,
                     366450..366455,366462..366470,366474..366476,
                     366648..366656,366681..366686))
                     /gene="rpsB"
                     /locus_tag="DehaBAV1_0359"
                     /note="rRNA interaction site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100106"
     misc_feature    complement(order(366168..366179,366219..366221,
                     366225..366230))
                     /gene="rpsB"
                     /locus_tag="DehaBAV1_0359"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:100106"
     misc_feature    complement(366108..366125)
                     /gene="rpsB"
                     /locus_tag="DehaBAV1_0359"
                     /note="putative laminin-1 binding site; other site"
                     /db_xref="CDD:100106"
     gene            complement(366944..367711)
                     /locus_tag="DehaBAV1_0360"
                     /db_xref="GeneID:5132125"
     CDS             complement(366944..367711)
                     /locus_tag="DehaBAV1_0360"
                     /EC_number="6.3.5.3"
                     /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
                     I"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase I"
                     /protein_id="YP_001213823.1"
                     /db_xref="GI:147669005"
                     /db_xref="InterPro:IPR010075"
                     /db_xref="GeneID:5132125"
                     /translation="MSKVKTLILRTPGTNCDVETSYAFELAGSETELVHINKLLAKPS
                     LLSEFQIMAFPGGFGYGDDLGAGRVLANEVRLKLGEKISRFHESGGLIIGICNGFQAL
                     VKTGILPGPMKDGQKITLTDNNSGRFECRWTYLSVNPFSTCVFTQGLDRLYLPVAHGE
                     GKLLGSPEVINKLNSAVYYTDKDGKRNAPYPANPAGTLMDIAGIADESGRIFALMPHP
                     ERFVRGSQHPRWTGEGLKKEGDGLKIFTNAVKWAREV"
     misc_feature    complement(366965..367696)
                     /locus_tag="DehaBAV1_0360"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in Formylglycinamide ribonucleotide
                     amidotransferase; Region: GATase1_FGAR_AT; cd01740"
                     /db_xref="CDD:153211"
     misc_feature    complement(order(367052..367063,367067..367069,
                     367238..367243,367412..367414,367424..367426,
                     367526..367528,367538..367543))
                     /locus_tag="DehaBAV1_0360"
                     /note="putative active site [active]"
                     /db_xref="CDD:153211"
     misc_feature    complement(order(367055..367057,367061..367063,
                     367424..367426))
                     /locus_tag="DehaBAV1_0360"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153211"
     gene            complement(367718..370579)
                     /locus_tag="DehaBAV1_0361"
                     /db_xref="GeneID:5131715"
     CDS             complement(367718..370579)
                     /locus_tag="DehaBAV1_0361"
                     /EC_number="6.3.5.3"
                     /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
                     II;
                     PFAM: AIR synthase related protein; AIR synthase related
                     protein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase II"
                     /protein_id="YP_001213824.1"
                     /db_xref="GI:147669006"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR003850"
                     /db_xref="InterPro:IPR010074"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="GeneID:5131715"
                     /translation="MHRIEVSLKPEWPDPKGNGVCHDIQDLGITSVSEVRVIDVYWLE
                     GNLSDSEVLTISGELLSDQIIQTFKYDANCPLAEADGFSAIEVTYNAGVTDPVQETIL
                     KAISDLGIKGITAARTAKRYLLKGEISADELKTIGNKLLINPIVQHVVTSSSNPFPPN
                     PEYTFKLKKIDLLAEKLKDNMASLGKEYSLSHQELSVIYEHYLKLGRAPTDAELETLA
                     QTWSEHCCHKTFKAMLDYDGQIINNLLKQTIAKATAELNKPWCLSVFVDNSGVIEFDD
                     EWGVCFKAETHNHPSAVEPYGGAATGIGGVIRDILGTGLAAKPIANTDVFCFGPPDLA
                     EDKLPPGVLHPRRVFKGVRSGVADYGNRMGIPTVNGAVLFDERYTANPLVYCGTIGLI
                     PKKYALPGKQSTGDLVVLIGGRTGRDGIHGVTFASGELNDRSTELSFTAVQIGNAIVE
                     KRMLDTLLQARDRELFVRITDCGGGGLSSAVGEMAESTGVKIYLDKVPLKYSGLTYSE
                     IWISESQERMLLAVNKEKLGEILALFENEGVEASVIGEFTSDRHLKLFYQDHQVADLQ
                     MNFLHNGRPQLELRATHHKTRHPEADFDCPKDFETELKNILSHWNVCSREWIIRQYDH
                     EVQGGSVLKAMVGAENDGPGDAAVIRPVLGSKKAVVISNGINPSYADVDAYNMAASAI
                     DEALRQIIAVGGNLERVALLDNFSWGNASRPESLGDLVHACQACHDLSLVFGTPFISG
                     KDSLNNEFRYEDKLITIPHTLLISAIGVMEDGDKAISMDFKKSGNLIYIVGKTAEELG
                     GSHYFKNHRFIGNRAPAVNAKRAKENMQALSCATAGGLVAACHDLSEGGLGVTAAEMA
                     FSGKLGAHIRLADVPLAEKIEREDYILFSESNSRFLVEVAPKHQAEFEKLMSGCDFGL
                     VGEVMSEPSLEITGRDGKEILLNTPVSELKEAWQRPMRW"
     misc_feature    complement(370367..370573)
                     /locus_tag="DehaBAV1_0361"
                     /note="Phosphoribosylformylglycinamidine (FGAM) synthase;
                     Region: PurS; cl00789"
                     /db_xref="CDD:260624"
     misc_feature    complement(370139..370327)
                     /locus_tag="DehaBAV1_0361"
                     /note="Phosphoribosylformylglycinamidine (FGAM) synthase;
                     Region: PurS; cl00789"
                     /db_xref="CDD:260624"
     misc_feature    complement(367736..370039)
                     /locus_tag="DehaBAV1_0361"
                     /note="Phosphoribosylformylglycinamidine (FGAM) synthase,
                     synthetase domain [Nucleotide transport and metabolism];
                     Region: PurL; COG0046"
                     /db_xref="CDD:223124"
     misc_feature    complement(368885..369943)
                     /locus_tag="DehaBAV1_0361"
                     /note="PurL subunit of the formylglycinamide
                     ribonucleotide amidotransferase (FGAR-AT), first repeat.
                     FGAR-AT catalyzes the ATP-dependent conversion of
                     formylglycinamide ribonucleotide (FGAR) and glutamine to
                     formylglycinamidine ribonucleotide (FGAM), ADP; Region:
                     PurL_repeat1; cd02203"
                     /db_xref="CDD:100034"
     misc_feature    complement(order(369419..369421,369431..369436,
                     369467..369469,369599..369601,369608..369610,
                     369617..369619,369653..369655,369728..369730,
                     369734..369745))
                     /locus_tag="DehaBAV1_0361"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100034"
     misc_feature    complement(order(369467..369475,369653..369655,
                     369665..369667))
                     /locus_tag="DehaBAV1_0361"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100034"
     misc_feature    complement(367826..368647)
                     /locus_tag="DehaBAV1_0361"
                     /note="PurL subunit of the formylglycinamide
                     ribonucleotide amidotransferase (FGAR-AT), second repeat.
                     FGAR-AT catalyzes the ATP-dependent conversion of
                     formylglycinamide ribonucleotide (FGAR) and glutamine to
                     formylglycinamidine ribonucleotide (FGAM), ADP; Region:
                     PurL_repeat2; cd02204"
                     /db_xref="CDD:100035"
     misc_feature    complement(order(368288..368290,368300..368305,
                     368357..368359,368456..368458,368471..368473,
                     368480..368482,368516..368518,368591..368593,
                     368597..368608))
                     /locus_tag="DehaBAV1_0361"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100035"
     misc_feature    complement(order(368357..368365,368516..368518,
                     368528..368530))
                     /locus_tag="DehaBAV1_0361"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100035"
     gene            complement(370583..371464)
                     /locus_tag="DehaBAV1_0362"
                     /db_xref="GeneID:5131467"
     CDS             complement(370583..371464)
                     /locus_tag="DehaBAV1_0362"
                     /note="with PdxT forms pyridoxal 5'-phosphate from
                     glutamine, either ribose 5-phosphate or ribulose
                     5-phosphate, and either glyceraldehyde 3-phosphate or
                     dihydroxyacetone phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal biosynthesis lyase PdxS"
                     /protein_id="YP_001213825.1"
                     /db_xref="GI:147669007"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="GeneID:5131467"
                     /translation="METGTFKVKSGLAQMLKGGVIMDVTTPEQAKIAEEAGACAVMAL
                     ERVPSDIRAAGGVARMADPTIIEQIMKVVSIPVMAKCRIGHFVEAQILESMGVDYIDE
                     SEVLTPADENFHVWKHDFKVPFVCGCRDLGEALRRIGEGAAMIRTKGEAGTGNIVEAV
                     RHMRSVMGSVRRVQSMSPDELSAYAKEINAPLELVLELHKTGKLPVVNFAAGGVATPA
                     DAALMMQLGADGVFVGSGIFKSSNPSAMAKAVVKAVTHYKDAQILAEISKGLGDAMPG
                     LDIKQIDPDKLISQRGW"
     misc_feature    complement(370589..371437)
                     /locus_tag="DehaBAV1_0362"
                     /note="PdxS is a subunit of the pyridoxal 5'-phosphate
                     (PLP) synthase, an important enzyme in deoxyxylulose
                     5-phosphate (DXP)-independent pathway for de novo
                     biosynthesis of PLP,  present in some eubacteria, in
                     archaea, fungi, plants, plasmodia, and some...; Region:
                     pdxS; cd04727"
                     /db_xref="CDD:240078"
     misc_feature    complement(order(370769..370771,370826..370828,
                     371003..371011,371225..371227,371339..371341,
                     371396..371398))
                     /locus_tag="DehaBAV1_0362"
                     /note="active site"
                     /db_xref="CDD:240078"
     misc_feature    complement(order(370685..370687,370808..370813,
                     370820..370822,370973..370975,370982..370987,
                     370994..370996,371000..371008,371132..371146,
                     371195..371197,371204..371212,371219..371221,
                     371264..371266,371288..371290,371294..371296))
                     /locus_tag="DehaBAV1_0362"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240078"
     gene            371649..372047
                     /locus_tag="DehaBAV1_0363"
                     /db_xref="GeneID:5131473"
     CDS             371649..372047
                     /locus_tag="DehaBAV1_0363"
                     /note="PFAM: Rieske [2Fe-2S] domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske (2Fe-2S) domain-containing protein"
                     /protein_id="YP_001213826.1"
                     /db_xref="GI:147669008"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="GeneID:5131473"
                     /translation="MNIFKAIMGMCDTSPLADDVWSLMDSQIALDLAKVPALSEKGGA
                     GYMAGKGLAKPVLVVRGQDNNLYAYENACPHGGRKIDPMQGEAKLRCCSVNHSTFDYN
                     GKVLSGPAQHKHELRRLLTSQADGKLLISV"
     misc_feature    371748..371987
                     /locus_tag="DehaBAV1_0363"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cd03467"
                     /db_xref="CDD:239550"
     misc_feature    order(371865..371867,371871..371876,371919..371921,
                     371922..371924,371934..371936,371937..371939,
                     371943..371945)
                     /locus_tag="DehaBAV1_0363"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    order(371865..371867,371871..371876,371919..371921,
                     371934..371936,371937..371939)
                     /locus_tag="DehaBAV1_0363"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            372125..372199
                     /locus_tag="DehaBAV1_R0007"
                     /note="tRNA-Thr1"
                     /db_xref="GeneID:5131468"
     tRNA            372125..372199
                     /locus_tag="DehaBAV1_R0007"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:5131468"
     gene            372228..372998
                     /locus_tag="DehaBAV1_0364"
                     /db_xref="GeneID:5132103"
     CDS             372228..372998
                     /locus_tag="DehaBAV1_0364"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213827.1"
                     /db_xref="GI:147669009"
                     /db_xref="GeneID:5132103"
                     /translation="MSKFIDRLKNVSKGYVRPMGFNAVASAPQPKMLLAVELGIEDLT
                     AKEVFGGADVVLLSTGKTGAKKLKEAAGLLGDTVWGVMLGDKADEAEKMAKAGADFVV
                     FSPDAEVSPLTALEKTGKIIMLENNLTDFMIRAADCLSVGAVIVDGQPDALSLSWRKI
                     MLYQRFADILSKPFLVRVSANISLPELQALWALGIDGVLTNGSEGLSGLRTIIDGAEW
                     AAKRKRGHMSAIVPSIKMPASESVSPEEPEEPDEDDEE"
     gene            complement(373077..374222)
                     /locus_tag="DehaBAV1_0365"
                     /db_xref="GeneID:5131732"
     CDS             complement(373077..374222)
                     /locus_tag="DehaBAV1_0365"
                     /EC_number="1.1.1.205"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine 5-monophosphate dehydrogenase"
                     /protein_id="YP_001213828.1"
                     /db_xref="GI:147669010"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005992"
                     /db_xref="GeneID:5131732"
                     /translation="MTVPEFKTLRRTYGFDEVAIVPGGLTVNPEQVEVDFKIGDINFS
                     IPFIASAMDAVTNVDTAVAMSKMGGLSVLHLEGIYTRYENPQEILDQIISKPIDEVTS
                     FMQKVYTAEPIKEHLISKRVSEIKAKGGICAVSLMPANAKKLAPIAVEAGADIISVAS
                     TVTSARHVSKSSHGLVFEEFVKMIKVPVLVGNCVSYQACLELMRTGVHGVIIGVGPGA
                     ACTSREVLGIGVPQITASMDCAAARETYYKETGRYVPIITDGGFKKGGDVCKAICAGA
                     DAVMLGSPFAKATEAPGRGYHWGMSHPHPSLPRGTRIKVGTTGSLEQILFGPTSVTDG
                     TQNLVGALKTSMGVCGASNIREMQQVEMVIAPAITTEGKSYQLSKCQ"
     misc_feature    complement(373128..374222)
                     /locus_tag="DehaBAV1_0365"
                     /note="inosine 5-monophosphate dehydrogenase; Validated;
                     Region: PRK08649"
                     /db_xref="CDD:236322"
     misc_feature    complement(373131..374189)
                     /locus_tag="DehaBAV1_0365"
                     /note="IMPDH: The catalytic domain of the inosine
                     monophosphate dehydrogenase. IMPDH catalyzes the
                     NAD-dependent oxidation of inosine 5'-monophosphate (IMP)
                     to xanthosine 5' monophosphate (XMP). It is a
                     rate-limiting step in the de novo synthesis of...; Region:
                     IMPDH; cd00381"
                     /db_xref="CDD:238223"
     misc_feature    complement(order(373263..373268,373320..373328,
                     373332..373334,373374..373379,373440..373442,
                     373446..373448,373563..373571,374073..374075))
                     /locus_tag="DehaBAV1_0365"
                     /note="active site"
                     /db_xref="CDD:238223"
     gene            374484..375308
                     /locus_tag="DehaBAV1_0366"
                     /db_xref="GeneID:5131491"
     CDS             374484..375308
                     /locus_tag="DehaBAV1_0366"
                     /note="PFAM: Uroporphyrin-III C/tetrapyrrole
                     (Corrin/Porphyrin) methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C/tetrapyrrole
                     methyltransferase"
                     /protein_id="YP_001213829.1"
                     /db_xref="GI:147669011"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /db_xref="GeneID:5131491"
                     /translation="MALYVVATPIGNLEDITLRALRLLSEVKLIAAEDTRHTRKLLSA
                     HNIKTPLTSYFEHNRLSKLDYILEVLREGDVALVSDAGMPGISDPGYELIKAAHENGI
                     KVVPVPGASAVITAVAVSGLDSGSFSYLGFLPRQKSERRKALSEVEMLGASIVILEAP
                     HRLQGCLLDIKEVLGDRQISVCRELTKIYEEIFRGSISQSISHFSQPRGEFVLVVEGN
                     RQIPAQPELTGDIISELGLLKKQGKSAKESVALVSQKNGLSKKEIYRAWLKIDKAL"
     misc_feature    374490..375134
                     /locus_tag="DehaBAV1_0366"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(374511..374513,374724..374732,374739..374744,
                     374814..374819,374952..374954,375027..375029,
                     375033..375038,375111..375119)
                     /locus_tag="DehaBAV1_0366"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(374529..374540,374544..374546,374730..374747,
                     374754..374759,374763..374768,374799..374801,
                     374805..374816,374820..374825,374832..374837,
                     374862..374876)
                     /locus_tag="DehaBAV1_0366"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            375333..375548
                     /locus_tag="DehaBAV1_0367"
                     /db_xref="GeneID:5132353"
     CDS             375333..375548
                     /locus_tag="DehaBAV1_0367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213830.1"
                     /db_xref="GI:147669012"
                     /db_xref="GeneID:5132353"
                     /translation="MRRGCISLGEVVCTGCNNTVPYPERYLAVDEENGKEVDKGTTVH
                     YCVECALKKGYASYKEEKGERILTFLP"
     gene            375557..377218
                     /locus_tag="DehaBAV1_0368"
                     /db_xref="GeneID:5132119"
     CDS             375557..377218
                     /locus_tag="DehaBAV1_0368"
                     /EC_number="6.1.1.10"
                     /note="methionine--tRNA ligase; MetRS; adds methionine to
                     tRNA(Met) with cleavage of ATP to AMP and diphosphate;
                     some MetRS enzymes form dimers depending on a C-terminal
                     domain that is also found in other proteins such as
                     Trbp111 in Aquifex aeolicus and the cold-shock protein
                     CsaA from Bacillus subtilis while others do not; four
                     subfamilies exist based on sequence motifs and zinc
                     content"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA synthetase"
                     /protein_id="YP_001213831.1"
                     /db_xref="GI:147669013"
                     /db_xref="InterPro:IPR002304"
                     /db_xref="GeneID:5132119"
                     /translation="MSERIFIGVAWPYANSQLHLGHVAGAYLPADIFARYHRTRGDEV
                     LMVSGSDMHGTPITIRAEQEGITAAEVAERYHQRFMASWPKLGISWDFYTSTATANHA
                     RTAQEMFLSLYEKGYIYKNTVCQPFCSHCNRFLPDRYVEGTCPHCKYEGARGDQCDNC
                     GKPLNAAELLNFRCKNCGNPPEFRETEHFFLKLSAFEEELIRWVETKTHWRTNVLNFT
                     LRYLKEGLKDRAITRDLDWGVPLPLPGYEGKRLYVWFEAVIGYLSASKEWAASKGQPN
                     AWQKYWGVDTKSYYFIGKDNIPFHTIIWPAMLMGKGGLNLPYDVPSNEYLTTESQKFS
                     KSRNNAIWVDDVLSRYGVDTLRYLLSANMPESSDTDFSWREFVRRNNDELVATYGNLA
                     QRVLTMVCRNYDNKVPEYGELDERSLTLIEKTAAMLCETDKALYNCNFREAIRLAMAL
                     AQEANRYLDEKAPWKEIKVDKAAAARSLYVAMVALSGLRVAFYPFLPESSGRLSTYLG
                     FGSELEKEGWILKMPVVGQELTPPEPLFKKLEDSVVEEETARMGL"
     misc_feature    375557..377212
                     /locus_tag="DehaBAV1_0368"
                     /note="methionyl-tRNA synthetase; Reviewed; Region:
                     PRK12268"
                     /db_xref="CDD:237029"
     misc_feature    375566..376669
                     /locus_tag="DehaBAV1_0368"
                     /note="catalytic core domain of methioninyl-tRNA
                     synthetases; Region: MetRS_core; cd00814"
                     /db_xref="CDD:173907"
     misc_feature    order(375584..375589,375593..375595,375707..375709,
                     376316..376318,376325..376330,376337..376339,
                     376442..376444,376454..376456)
                     /locus_tag="DehaBAV1_0368"
                     /note="active site"
                     /db_xref="CDD:173907"
     misc_feature    375611..375622
                     /locus_tag="DehaBAV1_0368"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    376550..376564
                     /locus_tag="DehaBAV1_0368"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    376694..377065
                     /locus_tag="DehaBAV1_0368"
                     /note="Anticodon-binding domain of methionyl tRNA
                     synthetases; Region: Anticodon_Ia_Met; cd07957"
                     /db_xref="CDD:153411"
     misc_feature    order(376697..376699,376718..376723,376730..376735,
                     376742..376747,376754..376759,376766..376771,
                     376919..376924,376928..376933,376946..376948)
                     /locus_tag="DehaBAV1_0368"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153411"
     misc_feature    order(376718..376720,376730..376735,376742..376747,
                     376754..376759,376766..376771,376928..376930,
                     376946..376948)
                     /locus_tag="DehaBAV1_0368"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153411"
     gene            377240..378214
                     /locus_tag="DehaBAV1_0369"
                     /db_xref="GeneID:5132135"
     CDS             377240..378214
                     /locus_tag="DehaBAV1_0369"
                     /note="PFAM: Polyprenyl synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase"
                     /protein_id="YP_001213832.1"
                     /db_xref="GI:147669014"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="GeneID:5132135"
                     /translation="MLKLSSIYAPINEGLKGVEDEFKLVSESRKKSFPEMAEMLDYIL
                     VGGKVLRPALSMLSAMCFGAGIKKVLPLATSSEMLHIATLVHDDAIDKADTRRGRRTV
                     NAVWGLEKAILLGDFLFAHAAETAAETGNMGIVTLFSQTLQIIASGELKQAYASFNPD
                     QSYENYLERISGKTAALFVMATKGGAILADASPSDEEIMRSYGYNLGLSFQIVDDILD
                     FVGNAKDMGKPIGSDLNNGTVTLPALLLMDRYPDNNPIKDMLNATDRIPHVAKAVEMI
                     NSSDIIDLSYKEAKRYADLACRNLSQLPKTAARESLYQLAEFIVERKN"
     misc_feature    377333..378205
                     /locus_tag="DehaBAV1_0369"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    order(377474..377476,377483..377491,377495..377503,
                     377507..377512,377525..377530,377684..377686,
                     377693..377695,377756..377761,377768..377770,
                     377879..377884,377891..377893,377921..377923,
                     377936..377938,377951..377953)
                     /locus_tag="DehaBAV1_0369"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    377483..377512
                     /locus_tag="DehaBAV1_0369"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(377498..377503,377510..377512,377525..377530,
                     377693..377695,377756..377758,377879..377884,
                     377891..377893,377921..377923,377936..377938,
                     377951..377953)
                     /locus_tag="DehaBAV1_0369"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(377498..377503,377510..377512,377525..377530,
                     377756..377758,377879..377884)
                     /locus_tag="DehaBAV1_0369"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(377498..377503,377510..377512,377525..377530,
                     377693..377695,377756..377758)
                     /locus_tag="DehaBAV1_0369"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(377516..377560,377900..377905,377921..377938,
                     377945..377959)
                     /locus_tag="DehaBAV1_0369"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(377879..377884,377891..377893,377921..377923,
                     377936..377938,377951..377953)
                     /locus_tag="DehaBAV1_0369"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            complement(378429..380243)
                     /locus_tag="DehaBAV1_0370"
                     /db_xref="GeneID:5132129"
     CDS             complement(378429..380243)
                     /locus_tag="DehaBAV1_0370"
                     /note="TIGRFAM: ATP-dependent metalloprotease FtsH;
                     PFAM: peptidase M41; AAA ATPase, central domain protein;
                     peptidase M41, FtsH extracellular; ATPase associated with
                     various cellular activities, AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metalloprotease FtsH"
                     /protein_id="YP_001213833.1"
                     /db_xref="GI:147669015"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:5132129"
                     /translation="MNSNWKRSTIIYVVMLVAIIAIFSFLVPNAQKPEEVPLSQIITL
                     SQEHKIAEITVDSETIEVTTTDGTKLSTVKEYIASIYEIEGLDLTDVKVNIQPAGGLD
                     WGTMILTYLPFLIFGGLLIFIFTQARGANNQAVSFGRSKAKLFNMDKPTITFANVAGV
                     DEAKQEVGEVVEFLKSREKFQALGARIPKGILLIGPPGTGKTLLAKAIAGEAGVPFFS
                     ISGSEFVEMFVGVGASRVRDLFDQAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQ
                     TLNQILVEMDGFDTDTSVIVVAATNRPDILDPALLRPGRFDRRVVLDKPDITGREAIL
                     KIHAKGKPLADTVNLENLGKQTVGFSGADLANLLNEAAILAARKNRKVIETEDLEESI
                     DRVIAGPERKSRRISTQEKEVTAYHETGHGLVLRLVQGADPVHKISIVARGMTLGHTR
                     QLPTEDRYLMTRSQFKGMMAGLLAGYVAEELTFKELSTGASDDLRRATDIAHKMVTSY
                     GMSDKLGPRTFGNKEEMVFLGREISEQKDYGEKIADMIDDEVHGLIEEAHQKARKILT
                     ENKNRLKFIAEKLVEKETLEGVELESLFTGELPIAEST"
     sig_peptide     complement(380151..380243)
                     /locus_tag="DehaBAV1_0370"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.987) with cleavage site probability 0.965 at
                     residue 31"
     misc_feature    complement(379983..380216)
                     /locus_tag="DehaBAV1_0370"
                     /note="FtsH Extracellular; Region: FtsH_ext; pfam06480"
                     /db_xref="CDD:253758"
     misc_feature    complement(378462..379940)
                     /locus_tag="DehaBAV1_0370"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    complement(379272..379715)
                     /locus_tag="DehaBAV1_0370"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(379638..379661)
                     /locus_tag="DehaBAV1_0370"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(379341..379343,379482..379484,
                     379635..379658))
                     /locus_tag="DehaBAV1_0370"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(379479..379496)
                     /locus_tag="DehaBAV1_0370"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(379299..379301)
                     /locus_tag="DehaBAV1_0370"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(378465..379034)
                     /locus_tag="DehaBAV1_0370"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:250619"
     gene            complement(380315..381145)
                     /locus_tag="DehaBAV1_0371"
                     /db_xref="GeneID:5132070"
     CDS             complement(380315..381145)
                     /locus_tag="DehaBAV1_0371"
                     /EC_number="3.1.21.-"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     SMART: AP endonuclease, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease IV"
                     /protein_id="YP_001213834.1"
                     /db_xref="GI:147669016"
                     /db_xref="InterPro:IPR001719"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:5132070"
                     /translation="MAGLLFGTAGIPYSTPKHTTQNGIHRVAELGLDGMEIEFVRGVY
                     MKAPDTNPVRILSELLRIKLSAHAPYYLNFNAVEENKVKMSQHLLYQSAKMAHLCGAG
                     SLVFHPGFYLTDSPSAAYESIRDNIRPVASRLQEEGFDITLRPEVSGKVTQFGDLKET
                     MALCSEIPGLLPTIDFSHYHARTGKYNSYSEFSFMLSTMADYLGENAVLNMHIHVSGI
                     DYSPRGEKQHLNLADSDFNYKELLLALRDRGCAGLVICESPNIEEDALLLKETYFSLA
                     "
     misc_feature    complement(380336..381145)
                     /locus_tag="DehaBAV1_0371"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     misc_feature    complement(380330..381136)
                     /locus_tag="DehaBAV1_0371"
                     /note="Endonuclease IV [DNA replication, recombination,
                     and repair]; Region: Nfo; COG0648"
                     /db_xref="CDD:223721"
     gene            381265..381609
                     /locus_tag="DehaBAV1_0372"
                     /db_xref="GeneID:5132055"
     CDS             381265..381609
                     /locus_tag="DehaBAV1_0372"
                     /note="TIGRFAM: iojap-like protein;
                     PFAM: Iojap-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="iojap family protein"
                     /protein_id="YP_001213835.1"
                     /db_xref="GI:147669017"
                     /db_xref="InterPro:IPR004394"
                     /db_xref="GeneID:5132055"
                     /translation="MESIDIARQMVSMASEKQAEDIVLLDVRELVSYCDYFVLMSGAS
                     SRQLSAIADVVEKTLKPLKIGPRHREGDADSGWILLDFGGVIAHIFTPEIRSYYKLDR
                     LWENAPKLVAIQ"
     misc_feature    381280..381576
                     /locus_tag="DehaBAV1_0372"
                     /note="Oligomerization domain; Region: Oligomerization;
                     pfam02410"
                     /db_xref="CDD:251278"
     gene            complement(381610..382038)
                     /gene="ndk"
                     /locus_tag="DehaBAV1_0373"
                     /db_xref="GeneID:5132054"
     CDS             complement(381610..382038)
                     /gene="ndk"
                     /locus_tag="DehaBAV1_0373"
                     /EC_number="2.7.4.6"
                     /note="catalyzes the formation of nucleoside triphosphate
                     from ATP and nucleoside diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="YP_001213836.1"
                     /db_xref="GI:147669018"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="GeneID:5132054"
                     /translation="MERTLLLVKPDGVNRGLSGEILGRMEKLGLKLIGLRMLQMDAVL
                     ADKHYAPHRARPFFKDLVTYITSGPITAAVFEGENAVEKMRKAMGATDPAKSEKGTVR
                     GDLGIDIEQNTVHGSDSAENAKHEISLFFSESELVNYDRR"
     misc_feature    complement(381631..382035)
                     /gene="ndk"
                     /locus_tag="DehaBAV1_0373"
                     /note="Nucleoside diphosphate kinase; Region: NDK;
                     pfam00334"
                     /db_xref="CDD:249778"
     misc_feature    complement(381646..382035)
                     /gene="ndk"
                     /locus_tag="DehaBAV1_0373"
                     /note="Nucleoside diphosphate kinase Group I
                     (NDPk_I)-like: NDP kinase domains are present in a large
                     family of structurally and functionally conserved proteins
                     from bacteria to humans that generally catalyze the
                     transfer of gamma-phosphates of a nucleoside...; Region:
                     NDPk_I; cd04413"
                     /db_xref="CDD:239876"
     misc_feature    complement(order(381661..381663,381685..381690,
                     381694..381696,381703..381705,381733..381735,
                     381766..381768,381784..381786,381868..381870,
                     381892..381894,382012..382014))
                     /gene="ndk"
                     /locus_tag="DehaBAV1_0373"
                     /note="active site"
                     /db_xref="CDD:239876"
     misc_feature    complement(order(381928..381936,381961..381963,
                     381970..381972,381979..381987,382000..382002))
                     /gene="ndk"
                     /locus_tag="DehaBAV1_0373"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239876"
     gene            complement(382048..383418)
                     /locus_tag="DehaBAV1_0374"
                     /db_xref="GeneID:5132038"
     CDS             complement(382048..383418)
                     /locus_tag="DehaBAV1_0374"
                     /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
                     variant 3; HAD-superfamily hydrolase, subfamily IA,
                     variant 1;
                     PFAM: peptidase M22, glycoprotease; Haloacid dehalogenase
                     domain protein hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="YP_001213837.1"
                     /db_xref="GI:147669019"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR005833"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006402"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="GeneID:5132038"
                     /translation="MPVLIAIDTATPDTGLAILRDNEIVAQYNWLSHQNQTVELLPRL
                     DWLLESAGLSLKDATAIAVSIGPGSFNGLRIGLSTVKSLAYALDIPLCGIGTLELAAY
                     PYLASGLTVWALLPSGQQEYAAGAYVKDKEGLKEEIKPHITSLADLAAKITEPCVICG
                     PISQNVQTELKTLLGDKKTVFAPADIRPSRAVSLARLAKKRIEDGLTDNPAGLQPLYL
                     RRPQISPRKHPTGLPLSQNKAVIWDMDGVIADSAPLHFRAWQTTFTEMGYTFSEADFY
                     RTFGLRNDMIIYSVLGEKSEADIIHTLADRKEHLFREYAGQDIKIFPGVMDLLKSLKA
                     AGYRMAIASSAPLANIKLVMTKLGIGDYFLATISEKDVTKGKPNPQVFLLSAARLCTR
                     PEECLVIEDAPGGVEAAKKAGMKCLAVTNSQQPETLKEADLIVDTLGKIGVEDIAGFI
                     GSPGAK"
     misc_feature    complement(382762..383409)
                     /locus_tag="DehaBAV1_0374"
                     /note="tRNA threonylcarbamoyl adenosine modification
                     protein YeaZ; Region: T6A_YeaZ; TIGR03725"
                     /db_xref="CDD:234332"
     misc_feature    complement(382843..383328)
                     /locus_tag="DehaBAV1_0374"
                     /note="Glycoprotease family; Region: Peptidase_M22;
                     pfam00814"
                     /db_xref="CDD:250152"
     misc_feature    complement(382111..382707)
                     /locus_tag="DehaBAV1_0374"
                     /note="Predicted phosphatase/phosphohexomutase [General
                     function prediction only]; Region: COG0637"
                     /db_xref="CDD:223710"
     misc_feature    complement(382162..382515)
                     /locus_tag="DehaBAV1_0374"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(382390..382392)
                     /locus_tag="DehaBAV1_0374"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(383396..383887)
                     /locus_tag="DehaBAV1_0375"
                     /db_xref="GeneID:5132071"
     CDS             complement(383396..383887)
                     /locus_tag="DehaBAV1_0375"
                     /note="PFAM: protein of unknown function UPF0079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213838.1"
                     /db_xref="GI:147669020"
                     /db_xref="InterPro:IPR003442"
                     /db_xref="GeneID:5132071"
                     /translation="MNQLELVSHSTQQTQDLGKIIGELASAGDIIFLVGNLGAGKTNL
                     TQGLAKGLDITENALSPSFVLAREMYGRLPLYHIDLYRLDLSEEIEELGLEDYFYGSG
                     VTVVEWADKANELLPPENLQIEIAYLDDDTRKLTLSAWGIRYEELLNEIAQRVKDAGF
                     NSH"
     misc_feature    complement(383438..383878)
                     /locus_tag="DehaBAV1_0375"
                     /note="Predicted ATPase or kinase [General function
                     prediction only]; Region: COG0802"
                     /db_xref="CDD:223873"
     gene            complement(383884..384894)
                     /locus_tag="DehaBAV1_0376"
                     /db_xref="GeneID:5131096"
     CDS             complement(383884..384894)
                     /locus_tag="DehaBAV1_0376"
                     /note="TIGRFAM: thiamine-monophosphate kinase;
                     PFAM: AIR synthase related protein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="YP_001213839.1"
                     /db_xref="GI:147669021"
                     /db_xref="InterPro:IPR006283"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="GeneID:5131096"
                     /translation="MKVSDIGECQLIDRLNILLHQKPDENTPARENLILDIGDDAAVF
                     LPQGYQLVTVDSLIENVHFNRSMLNWADLGYKALAINMSDIAAMGGLPQYAVVNIDLP
                     PDTLVSSVTDCYNAMYSLANKYQTVIIAGDTNQSSIINLAITLLGSAENPSCLLTRNA
                     AQAGQKIAVTGYLGNAAAGLDMLLNQTEVTDESRQIFYRSFYRPEPRINEARLLVKEG
                     VHCCIDISDGLVTDLGHILRQSRVSARIELDKLPLHPSLRLSYPLQAQNMALYGGEDY
                     ELLFTASAKVIEQISVQSHIPVTIIGEIIPGKPEELKLVDKDGRALQPEKNGWEHFKK
                     PK"
     misc_feature    complement(383899..384885)
                     /locus_tag="DehaBAV1_0376"
                     /note="thiamine monophosphate kinase; Provisional; Region:
                     PRK05731"
                     /db_xref="CDD:235583"
     misc_feature    complement(383980..384876)
                     /locus_tag="DehaBAV1_0376"
                     /note="ThiL (Thiamine-monophosphate kinase) plays a dual
                     role in de novo biosynthesis and in salvage of exogenous
                     thiamine. Thiamine salvage occurs in two steps, with
                     thiamine kinase catalyzing the formation of thiamine
                     phosphate, and ThiL catalyzing the...; Region: ThiL;
                     cd02194"
                     /db_xref="CDD:100030"
     misc_feature    complement(order(384214..384219,384223..384225,
                     384421..384423,384499..384507,384553..384555,
                     384604..384606,384643..384645,384775..384783,
                     384859..384861))
                     /locus_tag="DehaBAV1_0376"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100030"
     misc_feature    complement(order(384463..384465,384469..384471,
                     384490..384501,384508..384510,384553..384555,
                     384721..384723,384727..384735,384772..384774,
                     384850..384852))
                     /locus_tag="DehaBAV1_0376"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100030"
     gene            385186..385962
                     /locus_tag="DehaBAV1_0377"
                     /db_xref="GeneID:5131026"
     CDS             385186..385962
                     /locus_tag="DehaBAV1_0377"
                     /EC_number="2.1.1.-"
                     /note="PFAM: UbiE/COQ5 methyltransferase;
                     Methyltransferase type 11; Methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="demethylmenaquinone methyltransferase"
                     /protein_id="YP_001213840.1"
                     /db_xref="GI:147669022"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:5131026"
                     /translation="MSSLAEAPIQDPGFDSEEAHKRKQYMVDLFVVQAKNYDFHDDVF
                     GLYAHRFWMRTVLKIIGKFMKGRTSTKMLDLACGTGFVTFNTARNFENIDIDSFDISP
                     DMLAVAKERYEKYFKGRSIKFWQGDAEVPFGENKYDLITTSFAYRNFANKGLATENVF
                     RALKPGGLFIIQDLTKPEHHPMRGLYIFYMKYVLPLFTSILGTEKSAARWLYKSAMMM
                     PTNGQIAKLMESKGFEKCQYKSLSLGIACVIWGFKPEKSE"
     misc_feature    385285..385947
                     /locus_tag="DehaBAV1_0377"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    385396..385710
                     /locus_tag="DehaBAV1_0377"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(385408..385428,385480..385485,385561..385569,
                     385612..385614)
                     /locus_tag="DehaBAV1_0377"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            385964..386731
                     /locus_tag="DehaBAV1_0378"
                     /db_xref="GeneID:5131020"
     CDS             385964..386731
                     /locus_tag="DehaBAV1_0378"
                     /note="PFAM: UbiE/COQ5 methyltransferase;
                     Methyltransferase type 11; Methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="YP_001213841.1"
                     /db_xref="GI:147669023"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:5131020"
                     /translation="MSSINVSVKDPGFESEEAQARKRYMLQLFGFQAKHYDLHDDIMG
                     MGIHRRWGKEMVLEILTYTRNMPQVKMLDLACGTGFVTFNTLRYMKNVDIDAFDITPE
                     MVEVAKGRLKKNFADRSVKFWVGDAEIPYGDAKYDVIGTCFAFRNFANKNLAAANIFK
                     ALKPGGLLVLQDMTKPEKQPMRGIYLFALKNLMPVMARIIGTEKRSARYLANSVLAMP
                     SNAEITAILQNQGFINIKSRYQSGGMGTLTVAYKPEN"
     misc_feature    386060..386722
                     /locus_tag="DehaBAV1_0378"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    386171..386476
                     /locus_tag="DehaBAV1_0378"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(386183..386203,386255..386260,386336..386344,
                     386387..386389)
                     /locus_tag="DehaBAV1_0378"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            386733..387827
                     /locus_tag="DehaBAV1_0379"
                     /db_xref="GeneID:5131071"
     CDS             386733..387827
                     /locus_tag="DehaBAV1_0379"
                     /EC_number="4.2.3.4"
                     /note="PFAM: 3-dehydroquinate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="YP_001213842.1"
                     /db_xref="GI:147669024"
                     /db_xref="InterPro:IPR002658"
                     /db_xref="GeneID:5131071"
                     /translation="MGKVDTLAYDIGNNRTRHVYIGSGILDSLPGYARELNADKFFII
                     TDSNLENILKDKIKNLLAGVAETHILAFPAGEASKTLSTLEDIGSKILDLRATKSSVI
                     VCLGGGVVGNLGGLTAALLFRGLRFFHIPTTMVAQIDSAIGQKQAVNYKMGKNLFGQY
                     YAPEFVFIDFDFLRTLPERQIRAGLAESVKHGLCQESTFFDYIEEHAGDYSPKVIDYI
                     SRHTIELKLELLKIDPFEGKLDPQLELGHTIGHAVEIIKNGQLLHGESIAIGMVAEAA
                     LSCEMGYMKPELAAKIERIFKKLGLPTRIPADVPLEGVLEALRYDNKRRTARTDFFLL
                     EDFTRFHKENGKIGTKVSEEVLKKVLESAY"
     misc_feature    386778..387815
                     /locus_tag="DehaBAV1_0379"
                     /note="2-deoxy-scyllo-inosose synthase (DOIS) catalyzes
                     carbocycle formation from D-glucose-6-phosphate to
                     2-deoxy-scyllo-inosose through a multistep reaction in the
                     biosynthesis of aminoglycoside antibiotics; Region: DOIS;
                     cd08197"
                     /db_xref="CDD:173956"
     misc_feature    order(386868..386870,387051..387059,387066..387068,
                     387075..387077,387126..387131,387135..387137,
                     387192..387194,387201..387203,387246..387248,
                     387270..387272,387291..387293,387303..387305,
                     387471..387473,387483..387485,387519..387521)
                     /locus_tag="DehaBAV1_0379"
                     /note="active site"
                     /db_xref="CDD:173956"
     misc_feature    order(386973..386975,386985..386987,386994..386996,
                     387006..387008,387024..387026,387090..387092,
                     387096..387101,387165..387173,387198..387206,
                     387696..387698,387702..387707)
                     /locus_tag="DehaBAV1_0379"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173956"
     misc_feature    order(387291..387293,387471..387473,387519..387521)
                     /locus_tag="DehaBAV1_0379"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173956"
     gene            387811..388731
                     /locus_tag="DehaBAV1_0380"
                     /db_xref="GeneID:5131174"
     CDS             387811..388731
                     /locus_tag="DehaBAV1_0380"
                     /EC_number="2.5.1.-"
                     /note="PFAM: UbiA prenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
                     /protein_id="YP_001213843.1"
                     /db_xref="GI:147669025"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="GeneID:5131174"
                     /translation="MKALTSERPGFQDWIQAARLKFLPQGVMPVVIAGALAFSEGTFN
                     VANFIVAFSAAAAVQIGLTMFNDTLDYVYGTDCKPIDAKNPFSGGSGVFTCGLIKPRQ
                     SLMVIFGLYLFALMCAIYMALDMGWGVMWIAIIGATISILYSAKPLRLAYHGLGELVM
                     LLGYGPVLTAWGYFVHTGMVSWDVLLIGVIPGLCMWTMILINEIPDYEEDRAAGKRNL
                     TYRLGPKNAKNLFIISLVVLYAYILALVFSGVMPPLSAIALGGIPLAVMAVRIAHRYY
                     DDPIKVAMANKLMVIIYSVTTATVAIGMLT"
     misc_feature    387853..388719
                     /locus_tag="DehaBAV1_0380"
                     /note="1,4-Dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: PT_UbiA_UBIAD1; cd13962"
                     /db_xref="CDD:260125"
     misc_feature    order(388006..388011,388018..388020,388414..388419,
                     388426..388428,388438..388440)
                     /locus_tag="DehaBAV1_0380"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     gene            388731..389333
                     /locus_tag="DehaBAV1_0381"
                     /db_xref="GeneID:5131152"
     CDS             388731..389333
                     /locus_tag="DehaBAV1_0381"
                     /note="PFAM: UbiE/COQ5 methyltransferase;
                     Methyltransferase type 11; Methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="YP_001213844.1"
                     /db_xref="GI:147669026"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:5131152"
                     /translation="MVAPSFFEKVAPVYEFLTRMFMLGTFESARNRMLNEDTSEFSVL
                     DLCTGTGYIANKIEAKRIVGLDQSVQMMALNDRTKRPNKTLVRGNAYHLPFEDGEFER
                     IYCSSASHEFKLFGKVLAECFRTLKPGGKVAIYDIYQPKNKFYSLIVNTIYRYPVEHN
                     IMWVHTLDEWRKLLTEAGFEVEELEAVRGVFVFVRAVRPA"
     misc_feature    388749..389327
                     /locus_tag="DehaBAV1_0381"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    388857..389132
                     /locus_tag="DehaBAV1_0381"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(388866..388886,388926..388931,388992..389000)
                     /locus_tag="DehaBAV1_0381"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            389414..390193
                     /locus_tag="DehaBAV1_0382"
                     /db_xref="GeneID:5131082"
     CDS             389414..390193
                     /locus_tag="DehaBAV1_0382"
                     /note="PFAM: metallophosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_001213845.1"
                     /db_xref="GI:147669027"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:5131082"
                     /translation="MDSAPLTNYALMVSLGMRYAVMADIHANLEALNAVLEDAYKRDA
                     TEIWCLGDIINYGPDPTACLEILMNHKHLAVAGNHDLAVAGKINHSLFELEAARCLAW
                     TRSQLSSDMIDYLAVLPEMLIVGDFSLVHGSLKRPVWDYITTPQLASENFGLMRTPYC
                     LVGHTHMPYVFTTGQNGICRGMPLMAGSMQPLRQTNLIINPGSVGQPRDGNPQASYGI
                     YNDEARTFCLYRVAYNIPATQKKMQKAKLPPFLSARLSKGR"
     misc_feature    389462..390085
                     /locus_tag="DehaBAV1_0382"
                     /note="Calcineurin-like phosphoesterase superfamily
                     domain; Region: Metallophos_2; pfam12850"
                     /db_xref="CDD:257348"
     misc_feature    order(389483..389485,389489..389491,389567..389569,
                     389645..389650,389804..389806,389903..389905)
                     /locus_tag="DehaBAV1_0382"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    order(389483..389485,389489..389491,389567..389569,
                     389645..389647,389804..389806,389903..389905)
                     /locus_tag="DehaBAV1_0382"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            390213..391088
                     /gene="ksgA"
                     /locus_tag="DehaBAV1_0383"
                     /db_xref="GeneID:5131137"
     CDS             390213..391088
                     /gene="ksgA"
                     /locus_tag="DehaBAV1_0383"
                     /EC_number="2.1.1.48"
                     /note="catalyzes the transfer of a total of four methyl
                     groups from S-adenosyl-l-methionine (S-AdoMet) to two
                     adjacent adenosine bases A1518 and A1519 in 16S rRNA;
                     mutations in ksgA causes resistance to the translation
                     initiation inhibitor kasugamycin"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="YP_001213846.1"
                     /db_xref="GI:147669028"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="GeneID:5131137"
                     /translation="MGKDVPLLVASAPSLMAQAKEMMEGYTLKARKGLGQHFLISQGV
                     LNKILAAADLKPTDTVIEVGPGLGVLTEELLKRAGQVIAVEVDDKLIDALTEKFKGYP
                     NFRLIHSDILKTSPEEILGQNVPYKLVANLPYYITSAVLRQFLEAKLKPESMVVMVQK
                     EVAKNIVAKTGDMGLLTLSIRFYGNPSLVSVVPGGAFYPPPEVDSAIVKIVIPQTTIM
                     EGVSEVDFFKLARAGFGTRRKTLLNALAQGLGISKPVILSLLNGAGIDPARRAETLSM
                     EEWKKLCLEYAGNPC"
     sig_peptide     390213..390272
                     /gene="ksgA"
                     /locus_tag="DehaBAV1_0383"
                     /product="dimethyladenosine transferase"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.973 at
                     residue 20"
     misc_feature    390387..390665
                     /gene="ksgA"
                     /locus_tag="DehaBAV1_0383"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(390399..390419,390465..390470,390537..390545,
                     390603..390605)
                     /gene="ksgA"
                     /locus_tag="DehaBAV1_0383"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            391082..391936
                     /locus_tag="DehaBAV1_0384"
                     /db_xref="GeneID:5131024"
     CDS             391082..391936
                     /locus_tag="DehaBAV1_0384"
                     /EC_number="2.7.1.148"
                     /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
                     kinase;
                     PFAM: GHMP kinase; GHMP kinase, C terminal domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="YP_001213847.1"
                     /db_xref="GI:147669029"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR004424"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="GeneID:5131024"
                     /translation="MLTLLAPAKVNLSLEVLYRRKDGYHELRSIIQSLSLCDRLSFSP
                     SKTVHISSDSQDWQADLSLVSKAVELFSERCGQNTGVNLKIAKRIPLVSGLGGDSSCA
                     AAVLKGLNKLWGCGYPCWRLMEIGAELGSDVPFFIMGGTAMMEGRGETVTPLPTLTQM
                     WAVLLVPALDMPADKTAALYRNLRPDSFTSGEISDKLLESICQGKLSLSLCFNAFEKV
                     AFELFPELVKYRWQFLEAGAYQISLAGAGPTLFTLLKDKNTAEKIYHNLCQKGHQAYL
                     VSTLGPLD"
     misc_feature    391082..391927
                     /locus_tag="DehaBAV1_0384"
                     /note="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;
                     Provisional; Region: ipk; PRK00128"
                     /db_xref="CDD:234652"
     misc_feature    391328..391501
                     /locus_tag="DehaBAV1_0384"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:249743"
     misc_feature    391697..391900
                     /locus_tag="DehaBAV1_0384"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:254869"
     gene            391992..392489
                     /locus_tag="DehaBAV1_0385"
                     /db_xref="GeneID:5131022"
     CDS             391992..392489
                     /locus_tag="DehaBAV1_0385"
                     /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="YP_001213848.1"
                     /db_xref="GI:147669030"
                     /db_xref="InterPro:IPR003251"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR009040"
                     /db_xref="GeneID:5131022"
                     /translation="MSSSENLKSAFAGESQANRKYLFFADKAEKEGFAHVARLFRAAA
                     EAETVHARNHFNVLKGVGNTAANLEEAVAGESYEFTSMYPSFIKEAETEGNSAALLSF
                     NHANKVEKIHHGLFEEVLKEVKFGTRAEDQVYYVCQVCGNTVPGAAPARCPICGAPAS
                     SFKLV"
     misc_feature    391992..392480
                     /locus_tag="DehaBAV1_0385"
                     /note="Rubrerythrin [Energy production and conversion];
                     Region: COG1592"
                     /db_xref="CDD:224508"
     misc_feature    392004..392363
                     /locus_tag="DehaBAV1_0385"
                     /note="Rubrerythrin, ferritin-like diiron-binding domain;
                     Region: Rubrerythrin; cd01041"
                     /db_xref="CDD:153100"
     misc_feature    order(392031..392033,392040..392042,392052..392054,
                     392130..392132,392139..392141,392211..392216,
                     392223..392225,392316..392318,392325..392327)
                     /locus_tag="DehaBAV1_0385"
                     /note="binuclear metal center [ion binding]; other site"
                     /db_xref="CDD:153100"
     misc_feature    392391..392486
                     /locus_tag="DehaBAV1_0385"
                     /note="Rubredoxin_like; nonheme iron binding domain
                     containing a [Fe(SCys)4] center. The family includes
                     rubredoxins, a small electron transfer protein, and a
                     slightly smaller modular rubredoxin domain present in
                     rubrerythrin and nigerythrin and detected either...;
                     Region: rubredoxin_like; cd00350"
                     /db_xref="CDD:238210"
     misc_feature    order(392400..392402,392409..392411,392445..392447,
                     392454..392456)
                     /locus_tag="DehaBAV1_0385"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238210"
     gene            complement(392569..392820)
                     /locus_tag="DehaBAV1_0386"
                     /db_xref="GeneID:5131019"
     CDS             complement(392569..392820)
                     /locus_tag="DehaBAV1_0386"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213849.1"
                     /db_xref="GI:147669031"
                     /db_xref="GeneID:5131019"
                     /translation="MELTLQIKKDLALTNKLLSQGMVSTRDPETGFRYIICASCPNDG
                     GDGTVSRIDRKDNVVERVLFCCSTCGKEFVVKPEDIFLT"
     gene            complement(392895..393704)
                     /locus_tag="DehaBAV1_0387"
                     /db_xref="GeneID:5131013"
     CDS             complement(392895..393704)
                     /locus_tag="DehaBAV1_0387"
                     /note="PFAM: Ion transport protein; Ion transport 2 domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ion transport protein"
                     /protein_id="YP_001213850.1"
                     /db_xref="GI:147669032"
                     /db_xref="InterPro:IPR003091"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="GeneID:5131013"
                     /translation="MTKYNLMKKVHNLLTFGFDSQPRRFISWFIISLICLNVLAVILG
                     SVDTIGRDYHDLLFGFEIFSVAVFSLEYILRVWSYTVELKYSHPFTGRIRFALSPLAL
                     MDLLAILPFYLPFLIHVDLRFLRTLRLLRLFRLGHLKRFNETSRMILNVLRERREALI
                     ISFAIILLLIIFTSSLMYFVENPAQPEVFKNIPDSMWWAVMTMTTVGYGDIYPITALG
                     KLLASIISILGLATFALPTAILSAGLLEEFRNKKGIHEHICPACGQEIPKP"
     sig_peptide     complement(393582..393704)
                     /locus_tag="DehaBAV1_0387"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.779) with cleavage site probability 0.772 at
                     residue 41"
     misc_feature    complement(392985..393527)
                     /locus_tag="DehaBAV1_0387"
                     /note="Ion transport protein; Region: Ion_trans;
                     pfam00520"
                     /db_xref="CDD:249927"
     misc_feature    complement(392982..393212)
                     /locus_tag="DehaBAV1_0387"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            complement(393697..394947)
                     /locus_tag="DehaBAV1_0388"
                     /db_xref="GeneID:5131127"
     CDS             complement(393697..394947)
                     /locus_tag="DehaBAV1_0388"
                     /note="PFAM: Polynucleotide adenylyltransferase region"
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide adenylyltransferase"
                     /protein_id="YP_001213851.1"
                     /db_xref="GI:147669033"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="InterPro:IPR003006"
                     /db_xref="GeneID:5131127"
                     /translation="MNAEELKSFLKNRLPPEINRLILHAAELAASQNLHLYLVGGLVR
                     DFLLNKTPNDADLVLATNAIKFGQGLLEGFNYKATLHPRFNNLSADINGFKLDISTAR
                     NEFYPDPGKLPEVLEGDIKADLFRRDFKINAMALSLSPQDFGCLVDPYNGLTDLKQHK
                     LSVLHPKSFRDDPSRIWRALRYSERLGFDISSETLTLLQRDAQLITLIGADRLRYEME
                     CIFKEAKPENILLKAEETGVLKNSLPFIKADNWLADKFAEARNMYGENVSPEIYLCLL
                     SVRLDKSQAEALITGLHLSKYISACLRDYQCLAEHLAELGRVDLKPSRLYGILAKCKK
                     EARQAFYIANDNLIVRKHLMLFQEELSSIKPCLKGTDLLTLGFAPGPDIKAVLAELLN
                     LKLDGKIPSRTDEIDYVKRRQADD"
     misc_feature    complement(394474..394905)
                     /locus_tag="DehaBAV1_0388"
                     /note="Nucleotidyltransferase (NT) domain of ClassII
                     CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398"
                     /db_xref="CDD:143388"
     misc_feature    complement(393730..394869)
                     /locus_tag="DehaBAV1_0388"
                     /note="tRNA nucleotidyltransferase/poly(A) polymerase
                     [Translation, ribosomal structure and biogenesis]; Region:
                     PcnB; COG0617"
                     /db_xref="CDD:223690"
     misc_feature    complement(order(394552..394554,394561..394572,
                     394642..394644,394657..394659,394696..394698,
                     394780..394782,394786..394788,394813..394818,
                     394825..394830))
                     /locus_tag="DehaBAV1_0388"
                     /note="active site"
                     /db_xref="CDD:143388"
     misc_feature    complement(order(394552..394554,394564..394572,
                     394780..394782,394786..394788,394816..394818,
                     394825..394830))
                     /locus_tag="DehaBAV1_0388"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143388"
     misc_feature    complement(order(394657..394659,394780..394782,
                     394786..394788))
                     /locus_tag="DehaBAV1_0388"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143388"
     misc_feature    complement(394204..394389)
                     /locus_tag="DehaBAV1_0388"
                     /note="Probable RNA and SrmB- binding site of polymerase
                     A; Region: PolyA_pol_RNAbd; pfam12627"
                     /db_xref="CDD:257174"
     gene            395028..395945
                     /locus_tag="DehaBAV1_0389"
                     /db_xref="GeneID:5131102"
     CDS             395028..395945
                     /locus_tag="DehaBAV1_0389"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_001213852.1"
                     /db_xref="GI:147669034"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5131102"
                     /translation="MNTHAIKVSNLVKRYKDCTALDGLSLEIEQGECFGLLGPNGAGK
                     TTLVRILTSLSPSDSGKVEVMGLDLSHHLRQIKAMFGVIPQLDNLDAELSVTENLVTF
                     ARFFDIKPADARQRAADILKLFKLEQKANSEVKALSGGMRRRLLLARGLINNPSIIIL
                     DEPSVGLDPQSKYLVWQKLKEFKANGITQLLTTQNMDEAAVLCDRIAIMHQGKVLDMD
                     TPKGLVDRHVGQCLIEIEVRSGEHETITAECIRRGLDFEDSGLIIQVFRCGEDNLLDE
                     LKALGWNVWQRIGTLEDVFLRLTGKGLVE"
     misc_feature    395031..395930
                     /locus_tag="DehaBAV1_0389"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    395043..395696
                     /locus_tag="DehaBAV1_0389"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    395139..395162
                     /locus_tag="DehaBAV1_0389"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(395148..395153,395157..395165,395280..395282,
                     395508..395513,395607..395609)
                     /locus_tag="DehaBAV1_0389"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    395271..395282
                     /locus_tag="DehaBAV1_0389"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    395436..395465
                     /locus_tag="DehaBAV1_0389"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    395496..395513
                     /locus_tag="DehaBAV1_0389"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    395520..395531
                     /locus_tag="DehaBAV1_0389"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    395595..395615
                     /locus_tag="DehaBAV1_0389"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            395942..396709
                     /locus_tag="DehaBAV1_0390"
                     /db_xref="GeneID:5131044"
     CDS             395942..396709
                     /locus_tag="DehaBAV1_0390"
                     /note="PFAM: ABC-2 type transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_001213853.1"
                     /db_xref="GI:147669035"
                     /db_xref="InterPro:IPR000412"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR013526"
                     /db_xref="GeneID:5131044"
                     /translation="MNWPTYRAFYMWLRNYNVFIRLFWSIAPGFVIEPVVLLVALGFG
                     FGSFIGDINGQPYMEFIIPGVIASYAMTSATFECTYNVFFRMDYRKTYDSILATPMNV
                     SDVVTGEVLWGATRSIITACIILLVAALFGIIHSPWALLAPIFAVLEGIMFASIGIFF
                     ASIVPSIYSFNYYFTLFIGPMTFFSGAFFPVSSFPEAVQAISNVVPLTPAVSLIRGAV
                     SGDFSGVNVVISLLAVIGVSAAFYIATLFSMKRRVME"
     misc_feature    395972..396706
                     /locus_tag="DehaBAV1_0390"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     cl17235"
                     /db_xref="CDD:266576"
     misc_feature    395984..396697
                     /locus_tag="DehaBAV1_0390"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: COG0842"
                     /db_xref="CDD:223912"
     gene            396759..397310
                     /locus_tag="DehaBAV1_0391"
                     /db_xref="GeneID:5131052"
     CDS             396759..397310
                     /locus_tag="DehaBAV1_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase-like protein"
                     /protein_id="YP_001213854.1"
                     /db_xref="GI:147669036"
                     /db_xref="InterPro:IPR011769"
                     /db_xref="GeneID:5131052"
                     /translation="MKVVALVGMPGAGKTEASRMFSKNGFIRIRFGDVTDEKLRELGL
                     PLNEENERKVRESLRKQYGMEAYAVLNLSSIDENLKNDNVVVDGLYSWEEYKFLKSYY
                     KEKLIVVAISSSPSTRYSRLCERADRPLNYDNAVSRDYSEIENINKAGPIVMADITVL
                     NELDLKDLEKQVKKLGLELRADA"
     misc_feature    396759..397283
                     /locus_tag="DehaBAV1_0391"
                     /note="hypothetical protein; Provisional; Region:
                     PRK01184"
                     /db_xref="CDD:234914"
     misc_feature    396768..397199
                     /locus_tag="DehaBAV1_0391"
                     /note="AAA domain; Region: AAA_18; pfam13238"
                     /db_xref="CDD:257595"
     gene            397307..397780
                     /locus_tag="DehaBAV1_0392"
                     /db_xref="GeneID:5131029"
     CDS             397307..397780
                     /locus_tag="DehaBAV1_0392"
                     /note="PFAM: CMP/dCMP deaminase, zinc-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding CMP/dCMP deaminase"
                     /protein_id="YP_001213855.1"
                     /db_xref="GI:147669037"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="GeneID:5131029"
                     /translation="MSRPNVDEYFLKIAAVVAERSTCVRHHVGAVAVRDKHILSSGYN
                     GAPAGLTDCLELGCLRDQNGIPSGTRHEICRAVHAEQNVIIQASLHGTSLEGATVYAT
                     HTPCVLCAKMLTNARIKRYVSYGKYADDSFIDMFKQAGIEVVIKDRPPCVVEYLD"
     misc_feature    397325..397714
                     /locus_tag="DehaBAV1_0392"
                     /note="Deoxycytidylate deaminase domain. Deoxycytidylate
                     deaminase catalyzes the deamination of dCMP to dUMP,
                     providing the nucleotide substrate for thymidylate
                     synthase. The enzyme binds Zn++, which is required for
                     catalytic activity. The activity of the...; Region:
                     deoxycytidylate_deaminase; cd01286"
                     /db_xref="CDD:238613"
     misc_feature    order(397439..397441,397538..397540,397544..397546,
                     397619..397624,397631..397633)
                     /locus_tag="DehaBAV1_0392"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238613"
     misc_feature    order(397538..397540,397544..397546,397622..397624,
                     397631..397633)
                     /locus_tag="DehaBAV1_0392"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238613"
     gene            397868..398773
                     /locus_tag="DehaBAV1_0393"
                     /db_xref="GeneID:5131064"
     CDS             397868..398773
                     /locus_tag="DehaBAV1_0393"
                     /note="PFAM: diacylglycerol kinase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase catalytic subunit"
                     /protein_id="YP_001213856.1"
                     /db_xref="GI:147669038"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR005218"
                     /db_xref="GeneID:5131064"
                     /translation="MVAKVIVNPVAGARSTEQKWPHISRLMRDMGFSYDFQYTESQGH
                     AIEIARTAALNGYPYLVAVGGDGTINEVVNGILTASQDQKTLMGVVDTGTGNDFVRSL
                     GLDGNYLHSCQHLLSSKHTQVDAGLVTFQKDGRKVSRFFVNGAGVGFDAEVAAATEHM
                     PKALGGTIPFVMALAKTLVGYRNKTIDIRLDTDDYTRRVLSVIVANGSYFGGGMKIAP
                     SALITDSRFDVITLGDVNKLEILQTFPKIYKGTHITHPKVKTEHAHFVSISSGEGLYL
                     QADGELLGKTPATFEVLPQALTMVF"
     misc_feature    397868..398767
                     /locus_tag="DehaBAV1_0393"
                     /note="Sphingosine kinase and enzymes related to
                     eukaryotic diacylglycerol kinase [Lipid metabolism /
                     General function prediction only]; Region: LCB5; COG1597"
                     /db_xref="CDD:224513"
     misc_feature    397874..398191
                     /locus_tag="DehaBAV1_0393"
                     /note="Diacylglycerol kinase catalytic domain; Region:
                     DAGK_cat; pfam00781"
                     /db_xref="CDD:250128"
     gene            complement(398844..399356)
                     /locus_tag="DehaBAV1_0394"
                     /db_xref="GeneID:5131040"
     CDS             complement(398844..399356)
                     /locus_tag="DehaBAV1_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="YP_001213857.1"
                     /db_xref="GI:147669039"
                     /db_xref="InterPro:IPR003232"
                     /db_xref="GeneID:5131040"
                     /translation="MSALAKEEILRLIKSAKPLLEDYPDLENQLQPNGFDLSLKQVRS
                     LEGEGVLPTDNARRRLPVNNPLEFDHNNQIKLMPGIYSVVYNEVVNIPKDVMALATPR
                     SSLLRSGCTVNTAVWDAGYSGRSESLLVVYNPAGLILERNTRLIQLVFFKLNAETGGY
                     CGIYQNENKN"
     misc_feature    complement(398907..399143)
                     /locus_tag="DehaBAV1_0394"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cd07557"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(398916..398918,398928..398930,
                     398937..398951,398961..398963,398967..398969,
                     398973..398975,398979..398981,399000..399002,
                     399009..399011,399021..399029,399042..399059,
                     399063..399065,399111..399113,399117..399119,
                     399132..399134))
                     /locus_tag="DehaBAV1_0394"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(398979..398984,398994..398996,
                     399003..399011,399045..399053))
                     /locus_tag="DehaBAV1_0394"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            399507..399857
                     /locus_tag="DehaBAV1_0395"
                     /db_xref="GeneID:5131037"
     CDS             399507..399857
                     /locus_tag="DehaBAV1_0395"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213858.1"
                     /db_xref="GI:147669040"
                     /db_xref="GeneID:5131037"
                     /translation="MGVCVHKLRWKQSNLYQGGAVMAQDKTLVCRDCGNEFIFTAGEQ
                     EFYASRGLKNEPKRCPTCRSARRSENRAEGGERRTYEVVCAACGVQTTVPFEPTEGRP
                     VYCKDCYAKTKESE"
     misc_feature    399576..399719
                     /locus_tag="DehaBAV1_0395"
                     /note="Probable zinc-binding domain; Region: zf-trcl;
                     pfam13451"
                     /db_xref="CDD:257776"
     misc_feature    399735..399845
                     /locus_tag="DehaBAV1_0395"
                     /note="CxxC-x17-CxxC domain; Region: cxxc_cxxc_Mbark;
                     TIGR04272"
                     /db_xref="CDD:211995"
     gene            complement(399945..400706)
                     /locus_tag="DehaBAV1_0396"
                     /db_xref="GeneID:5131118"
     CDS             complement(399945..400706)
                     /locus_tag="DehaBAV1_0396"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_001213859.1"
                     /db_xref="GI:147669041"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5131118"
                     /translation="MNKKQTSAEQPIIKIENIQKHFGRVQALRGVSLEVKKGEVVVII
                     GPSGSGKSTLLRCINRLEEYDSGKITVDGITLDTTENINHVRREVGMVFQSFNLFSHL
                     KVIDNITLAQCQVRKRTKEEAAENAADLLKKVGIPDKAHAFPLQLSGGQQQRVAIARA
                     LAMNPQIMLFDEPTSALDPEMIKEVLDVMTTLAKEGMTMVVVSHEMGFARAAADRVIF
                     MDEGLIVESAPPNEFFTNPKHERTKLFLSKILHNS"
     misc_feature    complement(399957..400676)
                     /locus_tag="DehaBAV1_0396"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(400035..400670)
                     /locus_tag="DehaBAV1_0396"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(400551..400574)
                     /locus_tag="DehaBAV1_0396"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(400095..400097,400191..400196,
                     400425..400427,400548..400556,400560..400565))
                     /locus_tag="DehaBAV1_0396"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(400425..400436)
                     /locus_tag="DehaBAV1_0396"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(400239..400268)
                     /locus_tag="DehaBAV1_0396"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(400191..400208)
                     /locus_tag="DehaBAV1_0396"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(400173..400184)
                     /locus_tag="DehaBAV1_0396"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(400089..400109)
                     /locus_tag="DehaBAV1_0396"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(400706..401527)
                     /locus_tag="DehaBAV1_0397"
                     /db_xref="GeneID:5131031"
     CDS             complement(400706..401527)
                     /locus_tag="DehaBAV1_0397"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_001213860.1"
                     /db_xref="GI:147669042"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:5131031"
                     /translation="MAENKIKPPEKIALIPGAEPSNRMDPWWWLVAGVFALAGGLMLF
                     QPDPFLDIFKYVWVGIGITVLVAVVSYFLMLILGLFGGLGRLSQNTLIRGIATFYVEI
                     VRGIPLLVQLIWWYFAFPVIIQTIGQALNFGPMLNYQANPIVMAIWGMTFCYGAYMSE
                     IYRAGIQSIPKGQMEAARSLGMSHTQAMRFIILPQALRVILPPMGNEFISLLKDTSLV
                     STVAVADMVRLGREFTATNFNPIEVWSMIALLYLILTLLSSRLINYIEKKTAFSR"
     misc_feature    complement(400709..401407)
                     /locus_tag="DehaBAV1_0397"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(400838..401350)
                     /locus_tag="DehaBAV1_0397"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(400868..400873,400880..400891,
                     400910..400912,400919..400924,400964..400966,
                     401015..401017,401024..401029,401039..401041,
                     401045..401050,401057..401059,401063..401065,
                     401084..401089,401180..401182,401186..401191,
                     401198..401227,401231..401242,401270..401272,
                     401285..401290,401297..401302))
                     /locus_tag="DehaBAV1_0397"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(400874..400891,401180..401224))
                     /locus_tag="DehaBAV1_0397"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(400871..400873,401120..401122,
                     401180..401182))
                     /locus_tag="DehaBAV1_0397"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(400943..400945,400955..400960,
                     400976..401014))
                     /locus_tag="DehaBAV1_0397"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(401580..402353)
                     /locus_tag="DehaBAV1_0398"
                     /db_xref="GeneID:5131021"
     CDS             complement(401580..402353)
                     /locus_tag="DehaBAV1_0398"
                     /note="PFAM: extracellular solute-binding protein, family
                     3;
                     SMART: ionotropic glutamate receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_001213861.1"
                     /db_xref="GI:147669043"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR001320"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:5131021"
                     /translation="MKRLSTILMTLLLSSALLFSGCQSSTDDTDDSTATLQITVVTDA
                     TWAPFEYVNEQTHAIEGFDIDLMKAIAEKANLEVTFQNVAWDALLAGMATGQYKVAIS
                     SITILPDRLEKWLFSEPYFNAGQMVCVQKTNTTILSHDDLTGKRVAAQTGTTGFFEAQ
                     KIANATVKSYDEIGLAFQDLINGQIDAVICDNPVAIDYVNANPDKLKKVGTAFTDEYY
                     GISVAKGQTEILSRINLGLAAVIADGTLDQLIAKWNLNP"
     sig_peptide     complement(402273..402353)
                     /locus_tag="DehaBAV1_0398"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.386 at
                     residue 27"
     misc_feature    complement(401595..402242)
                     /locus_tag="DehaBAV1_0398"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(401595..402242)
                     /locus_tag="DehaBAV1_0398"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(401781..401783,401892..401894,
                     402024..402026,402099..402101,402216..402218))
                     /locus_tag="DehaBAV1_0398"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(401802..401804,401820..401822,
                     401832..401834))
                     /locus_tag="DehaBAV1_0398"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(401697..401705,401706..401708))
                     /locus_tag="DehaBAV1_0398"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(402553..403392)
                     /locus_tag="DehaBAV1_0399"
                     /db_xref="GeneID:5131121"
     CDS             complement(402553..403392)
                     /locus_tag="DehaBAV1_0399"
                     /note="TIGRFAM: degV family protein;
                     PFAM: DegV family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="degV family protein"
                     /protein_id="YP_001213862.1"
                     /db_xref="GI:147669044"
                     /db_xref="InterPro:IPR003797"
                     /db_xref="GeneID:5131121"
                     /translation="MNIKIVTDSTADIPPQLAKSLGITIVPLYVRFGEKALKDGVEIT
                     QDQFFERLQTESVHPNTSQPSPQDFIDVYRELAPTCDGIVSIHISSKLSGTYDSAIQA
                     KKLLGKDAPPIEVIDSRSVSMGLGLLGLLGAEVASSGKNLKEVADTVRSSVEKIQMMG
                     FFDTLKYLALGGRIGKSKALLGSLLSVKPVLVVGNGELLPAGQVRSRSKGMEKLTEFT
                     AGVKNIAGLSVIYTTTPDEAVALADRLAEFFPRKQIVISRLGAALGVHAGPGTLFVAT
                     RSN"
     misc_feature    complement(402568..403386)
                     /locus_tag="DehaBAV1_0399"
                     /note="EDD domain protein, DegV family; Region: DegV;
                     TIGR00762"
                     /db_xref="CDD:213558"
     gene            complement(403848..403922)
                     /locus_tag="DehaBAV1_R0008"
                     /note="tRNA-Met3"
                     /db_xref="GeneID:5131128"
     tRNA            complement(403848..403922)
                     /locus_tag="DehaBAV1_R0008"
                     /product="tRNA-Met"
                     /db_xref="GeneID:5131128"
     gene            404163..405113
                     /locus_tag="DehaBAV1_0400"
                     /db_xref="GeneID:5132026"
     CDS             404163..405113
                     /locus_tag="DehaBAV1_0400"
                     /note="PFAM: Mg2+ transporter protein, CorA family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg2+ transporter protein, CorA family protein"
                     /protein_id="YP_001213863.1"
                     /db_xref="GI:147669045"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="GeneID:5132026"
                     /translation="MALTQVKNNTSNIESITYGNLTWINIENPQEVDTEYLAANYPFH
                     PLDLDDVLSRRQRPKVDEYNEYLFFVLHFPFYNKELRTTVPAQLSVFIGGNYLITLHT
                     GNLKPLVKLYREMELDESSRPEYFDHGSGFLMYRIVDRLVDYCLPITVKLLDNLEEVE
                     DDIFAGSNSDLNIVKDIALLRRDIIATRRIIWPMRAVIGCLENKLRKFINQDMSVYFG
                     DMTDHMDKIWDTLDETKEVIEGLSSTFDSMSSHRTNRAMRILTIVATILLPFTMVASI
                     FGMNIPLPFQNSENAIYFVAVITAIIVSLMLYMFRRVRLI"
     misc_feature    404217..405098
                     /locus_tag="DehaBAV1_0400"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    404229..405098
                     /locus_tag="DehaBAV1_0400"
                     /note="Thermotoga maritima CorA-like family; Region:
                     TmCorA-like; cd12822"
                     /db_xref="CDD:213356"
     misc_feature    order(404298..404300,404307..404312,404337..404339,
                     404343..404345,404490..404492,404502..404504,
                     404556..404558,404565..404567,404589..404591,
                     404598..404600,404610..404612,404628..404633,
                     404640..404642,404682..404687,404694..404696,
                     404703..404708,404715..404717,404727..404729,
                     404805..404810,404814..404819,404826..404831,
                     404835..404840,404847..404852,404856..404861,
                     404865..404873,404880..404903,404907..404945,
                     404949..404957,404961..404978,404982..405005,
                     405033..405038,405045..405050,405057..405059,
                     405090..405092)
                     /locus_tag="DehaBAV1_0400"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213356"
     misc_feature    order(404307..404309,404577..404579,404817..404819)
                     /locus_tag="DehaBAV1_0400"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213356"
     misc_feature    order(404310..404312,404817..404819)
                     /locus_tag="DehaBAV1_0400"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213356"
     misc_feature    order(404502..404504,404556..404558)
                     /locus_tag="DehaBAV1_0400"
                     /note="putative Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213356"
     misc_feature    404889..404891
                     /locus_tag="DehaBAV1_0400"
                     /note="aspartate ring; other site"
                     /db_xref="CDD:213356"
     misc_feature    order(404916..404918,404934..404936,405093..405098)
                     /locus_tag="DehaBAV1_0400"
                     /note="basic sphincter; other site"
                     /db_xref="CDD:213356"
     misc_feature    order(404931..404933,404940..404942)
                     /locus_tag="DehaBAV1_0400"
                     /note="hydrophobic gate; other site"
                     /db_xref="CDD:213356"
     misc_feature    order(404985..404987,404991..404996)
                     /locus_tag="DehaBAV1_0400"
                     /note="periplasmic entrance; other site"
                     /db_xref="CDD:213356"
     gene            405135..405794
                     /locus_tag="DehaBAV1_0401"
                     /db_xref="GeneID:5131106"
     CDS             405135..405794
                     /locus_tag="DehaBAV1_0401"
                     /note="TIGRFAM: conserved hypothetical integral membrane
                     protein;
                     PFAM: protein of unknown function DUF165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213864.1"
                     /db_xref="GI:147669046"
                     /db_xref="InterPro:IPR003744"
                     /db_xref="GeneID:5131106"
                     /translation="MNVSSRLLIVSGLYITCLITANLIAVKIIALGDVFLPAAVIVFP
                     FSYIFGDVLTEVYGFHWARRIIWLGFICNLIFVVFVALGQVLPGAPFWEGQAAYETIL
                     GYTPRILLASFLGYLVGEFVNSFIMAKLKLRTKGRYLWLRTIGSTLAGQGLDTSIFIM
                     VAFLGTPVFVPMMILYHWGSKVLIEAAATPLTYRLVNYLKKAENSDHFDTATNFSPFK
                     L"
     misc_feature    405243..405677
                     /locus_tag="DehaBAV1_0401"
                     /note="Uncharacterized ACR, YhhQ family COG1738; Region:
                     DUF165; pfam02592"
                     /db_xref="CDD:251400"
     gene            405815..406591
                     /locus_tag="DehaBAV1_0402"
                     /db_xref="GeneID:5131126"
     CDS             405815..406591
                     /locus_tag="DehaBAV1_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213865.1"
                     /db_xref="GI:147669047"
                     /db_xref="InterPro:IPR011563"
                     /db_xref="GeneID:5131126"
                     /translation="MEIVFLGAHNCETKTTRPSCLMLSGGVVLDAGAITGSLTLDELY
                     SLKAVILSHAHYDHIKDVPLLAMNLAYGLKSVDIYGSQAVEEVVTKPPFSGGFYPDFF
                     TRPPSAPALRFNKITPGLEFDCQGYRILPVSVPHSRDTTGFWVKDLNGHSFFYTSDTG
                     SGLGAVWEQVNPELLIIELTMPNKLTELALTSKHLSPELLETELLLFREMKGYLPQIV
                     TLHTTPLFEEEIKTEIQAVADRLAADIFMASEGLKLRLGE"
     misc_feature    405893..406405
                     /locus_tag="DehaBAV1_0402"
                     /note="Beta-lactamase superfamily domain; Region:
                     Lactamase_B_2; pfam12706"
                     /db_xref="CDD:257238"
     gene            406594..407097
                     /locus_tag="DehaBAV1_0403"
                     /db_xref="GeneID:5131179"
     CDS             406594..407097
                     /locus_tag="DehaBAV1_0403"
                     /note="PFAM: protein of unknown function DUF82"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213866.1"
                     /db_xref="GI:147669048"
                     /db_xref="InterPro:IPR002782"
                     /db_xref="GeneID:5131179"
                     /translation="MFAVSEPPRFLVDQNVGKLAVYLRMLGFDARRFGNGSDRQLLSE
                     ALAEGRVILTRDHLLRERRLVKKGNLKVMLFEIEVAEDQLRQLLSDMALHSFILPFSR
                     CIECNYPLYPVMKETLSEKVPPYVYQNQTEFKECHHCGRVFWKGSHWQAMQEVLNRLG
                     VDNNPSC"
     misc_feature    406615..407061
                     /locus_tag="DehaBAV1_0403"
                     /note="Mut7-C RNAse domain; Region: Mut7-C; pfam01927"
                     /db_xref="CDD:250974"
     gene            407134..408672
                     /locus_tag="DehaBAV1_0404"
                     /db_xref="GeneID:5131178"
     CDS             407134..408672
                     /locus_tag="DehaBAV1_0404"
                     /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
                     PFAM: protein of unknown function UPF0031; YjeF-family
                     N-terminal domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="YP_001213867.1"
                     /db_xref="GI:147669049"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="GeneID:5131178"
                     /translation="MEIISSVQMRQIEDACLKQGISTETLMENAGRAVAVFARHLLEE
                     QNGCRVLILAGAGNNGGDGLVAGRYLRSWGEKVSIFVPFIDTPKGKTVQGCLEASGDI
                     FAGLAELEEHLADADLVIDALLGTGVNRPLEGIYKEALQMTANVRNTRPEMQVLAVDL
                     PSGLNADTGQADDACLKADFTLSLGIAKQGLFTHRGLELSGAVSVADIGIPPELTTDI
                     QAVLIEKDWAKSVLPVRSPHANKGNFGRVMIVAGSDRYIGAAILAGSAAMRVGAGLVT
                     LALPESLTGAVASRIPEATYLPLPEVSSGTADNSAARFVLSELGKYDVLLIGPGLGQT
                     GYSARLVTEVLSNLPVGLKVIIDADALNILSAITDWWLEYKFDAVLTPHPGEMARLAK
                     TTTEAVQSDRFGLCQKFACKWGKTLILKGAGTIVTSPQGETLCNPAANPVLASAGTGD
                     VLAGIIGGLLGQGVSLFEAAGLGVYLHSLAAEALRSEIGDAGVLASDLLLKLPVIIKG
                     LKQG"
     misc_feature    407158..408651
                     /locus_tag="DehaBAV1_0404"
                     /note="putative carbohydrate kinase; Provisional; Region:
                     PRK10565"
                     /db_xref="CDD:182554"
     misc_feature    407203..407703
                     /locus_tag="DehaBAV1_0404"
                     /note="YjeF-related protein N-terminus; Region: YjeF_N;
                     pfam03853"
                     /db_xref="CDD:252206"
     misc_feature    407842..408642
                     /locus_tag="DehaBAV1_0404"
                     /note="B.subtilis YXKO protein of unknown function and
                     related proteins. Based on the conservation of the ATP
                     binding site, the substrate binding site and the
                     Mg2+binding site and structural homology this group is a
                     member of the ribokinase-like superfamily; Region:
                     YXKO-related; cd01171"
                     /db_xref="CDD:238576"
     misc_feature    order(407917..407919,408472..408474,408481..408483)
                     /locus_tag="DehaBAV1_0404"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238576"
     misc_feature    order(408280..408282,408391..408393,408475..408480,
                     408487..408489,408565..408567)
                     /locus_tag="DehaBAV1_0404"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238576"
     gene            408676..409467
                     /locus_tag="DehaBAV1_0405"
                     /db_xref="GeneID:5131158"
     CDS             408676..409467
                     /locus_tag="DehaBAV1_0405"
                     /EC_number="2.7.1.33"
                     /note="type III; catalyzes the formation of
                     (R)-4'-phosphopantothenate from (R)-pantothenate in
                     coenzyme A biosynthesis; type III pantothenate kinases are
                     not subject to feedback inhibition from coenzyme A and
                     have a high Km for ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_001213868.1"
                     /db_xref="GI:147669050"
                     /db_xref="InterPro:IPR004619"
                     /db_xref="GeneID:5131158"
                     /translation="MNKQAATEKLVAVDIGNTSVNIGIFEGEQLLANWHLGSVAQRMA
                     DEYASLLLGLLQHAGIQAGELNRVIMCSVVPPLTTTFEEVFKTYFKATPLVVGAGIKS
                     GVKIRMDNPREVGADRIVNAAAARVLYPGACIIVDMGTATTFDTLSESGEYIGGAIAP
                     GIATSAQAIVEKTSKLPKIEIIHPAKAIGSNTVSAMQSGVYFGYIGLVEELVRRIQAE
                     LGQKARVVATGGYASLIAEGSRIFDIVRSDLTLQGLRFIYQMNKV"
     misc_feature    408700..409461
                     /locus_tag="DehaBAV1_0405"
                     /note="pantothenate kinase; Reviewed; Region: PRK13321"
                     /db_xref="CDD:237349"
     gene            409570..410751
                     /locus_tag="DehaBAV1_0406"
                     /db_xref="GeneID:5131151"
     CDS             409570..410751
                     /locus_tag="DehaBAV1_0406"
                     /EC_number="6.3.2.5"
                     /EC_number="4.1.1.36"
                     /note="TIGRFAM: phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase;
                     PFAM: flavoprotein; DNA/pantothenate metabolism
                     flavoprotein domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase"
                     /protein_id="YP_001213869.1"
                     /db_xref="GI:147669051"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="GeneID:5131151"
                     /translation="MNKEQTVVLGITGSISAYKAGDIASKLLAEGYTVKAVMTEDACR
                     FISPLTIRTLSHQPVVTSMWDINSEYSVEHVSLAEEADVILVAPATANIIAKLACGLA
                     NDMLSATILACKSPVIIAPAMNDNMYSNPVTQQNISKLKERGFIFVEPEYGRLASGKT
                     GQGRLASLDKILGSVTQVLAKNGPLAGKKLVISAGGTREPVDPVRYVGNRSSGKMGYA
                     LAEEAVRRGASVRLVSGVTDRPVSFGVDIMYTETALEMFAALREAVKGADALIMTAAV
                     ADYRPERLAADKIKKGAEGLDLHLVANPDILASLQGDFVKVGFAAESRDLMINALKKM
                     TDKNLDIIAANDISQPDSTFGSDTTRLTLFFKNGRVEELPLLKKQEAAARLLDEISGL
                     L"
     misc_feature    409585..410748
                     /locus_tag="DehaBAV1_0406"
                     /note="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Validated;
                     Region: PRK05579"
                     /db_xref="CDD:235513"
     misc_feature    409585..410118
                     /locus_tag="DehaBAV1_0406"
                     /note="Flavoprotein; Region: Flavoprotein; cl19190"
                     /db_xref="CDD:267543"
     misc_feature    410122..410661
                     /locus_tag="DehaBAV1_0406"
                     /note="DNA / pantothenate metabolizm flavoprotein; Region:
                     DFP; pfam04127"
                     /db_xref="CDD:252395"
     gene            410839..413481
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /db_xref="GeneID:5131139"
     CDS             410839..413481
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /EC_number="6.1.1.9"
                     /note="valine--tRNA ligase; ValRS; converts valine ATP and
                     tRNA(Val) to AMP PPi and valyl-tRNA(Val); class-I
                     aminoacyl-tRNA synthetase type 1 subfamily; has a
                     posttransfer editing process to hydrolyze mischarged
                     Thr-tRNA(Val) which is done by the editing domain"
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="YP_001213870.1"
                     /db_xref="GI:147669052"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="GeneID:5131139"
                     /translation="MAQCSDLPEMAKAYEAAEVEKKWYQYWMEKGYFKPNPNSDKKPF
                     VIIMPPPNVTGELHLGHALTATLEDIMIRWHRMQGEPTLWLPGVDHAGIAAQVVVERE
                     LAKQGKTRQQLGRELFLEKMWEWVNPCREKIRHQHMRLGASCDWDRETFTLDAGPVKA
                     VREIFTNLYEKGLIYKGERIINWCPRCGTAVSDLEVDHKDLAGHIWHLRYPLEDGSGF
                     VTVATTRPETMLGDTAVAIHPDDTRYAGMVGKNVVLPIMNRRIPVIADEAVDMAFGTG
                     AVKVTPAHDPNDFEMGLRHNLPMITIQNRDTTMNENAGPCSGMTAKACREYVVSEMKS
                     LGLLLKIEDYTHSVGHCQRCSAVIEPMVSKQWFVKMEPLAKPALEAVNSGRIQILPER
                     FNKVYQNWMENIRDWCISRQLWWGHRIPVWYCPCGEMIVAKVDPTVCPKCGGTELEQD
                     PDVLDTWFSSGLWPHSTLGWPDQTEDLKRFYPGTVMETAYDIIFFWVARMIVMGMEDM
                     NEVPFRTVYLHGLIRDDKGEKMSKTKGNVIDPLKVIDQYGTDALRFAVTFGTSPGNDS
                     KLGQTKLEAARNFANKLWNASRFVIMNLGEAKELTPEAELPLEDRWIISRMNRVTADV
                     TRLMEEFQFGEAQRVLQDFIWGEFCDWYIELAKVRLRDEASVSPRPVLVRVLSSILRL
                     LHPYMPFITEELWSYLRPYLPESLRETDIIVAPYPAADKTCFDEQAESVMGSLVEIVR
                     SLRNLRAEHNVEISRYIQANIYAGDKASVLGNYLGAVETLSRARPVNILPGHYSGAST
                     ATEVVLVLNGIEVVVPMSTMVDLEVEAKRVKAEISELEIQIERLSTRLSDEQFLAKAP
                     QAVVDKERIKLEGYIEKVSRLKSA"
     misc_feature    410860..413478
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="valyl-tRNA synthetase; Reviewed; Region: valS;
                     PRK05729"
                     /db_xref="CDD:235582"
     misc_feature    410962..412542
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="catalytic core domain of valyl-tRNA synthetases;
                     Region: ValRS_core; cd00817"
                     /db_xref="CDD:185677"
     misc_feature    order(410983..410994,411010..411012,411016..411021,
                     411028..411030,411103..411105,412207..412209,
                     412216..412218,412300..412305,412309..412314,
                     412324..412326,412393..412404,412426..412428)
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="active site"
                     /db_xref="CDD:185677"
     misc_feature    411010..411021
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:185677"
     misc_feature    411460..411834
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:257918"
     misc_feature    412423..412437
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:185677"
     misc_feature    412552..412932
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="Anticodon-binding domain of valyl tRNA synthetases;
                     Region: Anticodon_Ia_Val; cd07962"
                     /db_xref="CDD:153416"
     misc_feature    order(412552..412554,412561..412563,412567..412572,
                     412579..412584,412591..412596,412600..412605,
                     412741..412743,412750..412752,412771..412773,
                     412795..412800,412807..412809)
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153416"
     misc_feature    order(412582..412584,412591..412596,412600..412605,
                     412783..412785,412795..412800,412807..412809)
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153416"
     misc_feature    413296..413478
                     /gene="valS"
                     /locus_tag="DehaBAV1_0407"
                     /note="Valyl tRNA synthetase tRNA binding arm; Region:
                     Val_tRNA-synt_C; pfam10458"
                     /db_xref="CDD:151031"
     gene            complement(413478..414551)
                     /locus_tag="DehaBAV1_0408"
                     /db_xref="GeneID:5131135"
     CDS             complement(413478..414551)
                     /locus_tag="DehaBAV1_0408"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region, ATPase domain protein; histidine
                     kinase, dimerisation and phosphoacceptor region; PAS
                     fold-3 domain protein; PAS fold-4 domain protein; PAS fold
                     domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_001213871.1"
                     /db_xref="GI:147669053"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011712"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5131135"
                     /translation="MTETRFKPPALCHRCLFENASDAIWFYDRKGHIVYANRASAELT
                     GYTRTELKQKNLKDLLTTASEYDQIMDMNSRIAVGEEVKMPYEQKIRRHDGSVAVLRM
                     ATTLVKSADEVLGFQNIARDITEELRRQQNMKSFVQDVIRAQEAERKRISRELHDEVA
                     PLLLLLMQKIDNLSKQSERDIADCKPQLDALRTQSEEALESLRRIAQDLRPRILDDLG
                     LIPALEWLTEKLAQDGQIHTESNVKGREVELTAEIQLLIFRIAQEAFNNIRKHSLATW
                     VRLELEFKPKAILLTIQDNGKGFNLSEQTDNLAQNGKLGLAGMHERAQLIGGHIHILT
                     HPGQGTTVIAEVPTTNPDTKPAS"
     misc_feature    complement(414156..414515)
                     /locus_tag="DehaBAV1_0408"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(414183..414494)
                     /locus_tag="DehaBAV1_0408"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(414267..414269,414282..414284,
                     414354..414359,414372..414377,414414..414416,
                     414432..414434,414444..414446))
                     /locus_tag="DehaBAV1_0408"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(414240..414242,414246..414248,
                     414324..414329,414336..414338,414372..414374,
                     414384..414386))
                     /locus_tag="DehaBAV1_0408"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(413511..>414179)
                     /locus_tag="DehaBAV1_0408"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    complement(413910..414113)
                     /locus_tag="DehaBAV1_0408"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    complement(413523..413783)
                     /locus_tag="DehaBAV1_0408"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(413526..413528,413532..413537,
                     413550..413552,413556..413558,413604..413612,
                     413616..413618,413658..413660,413664..413666,
                     413670..413672,413676..413678,413742..413744,
                     413751..413753,413763..413765))
                     /locus_tag="DehaBAV1_0408"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(413751..413753)
                     /locus_tag="DehaBAV1_0408"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(413607..413609,413616..413618,
                     413658..413660,413664..413666))
                     /locus_tag="DehaBAV1_0408"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(414532..415230)
                     /locus_tag="DehaBAV1_0409"
                     /db_xref="GeneID:5131129"
     CDS             complement(414532..415230)
                     /locus_tag="DehaBAV1_0409"
                     /note="PFAM: regulatory protein, LuxR; response regulator
                     receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="two component LuxR family transcriptional
                     regulator"
                     /protein_id="YP_001213872.1"
                     /db_xref="GI:147669054"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:5131129"
                     /translation="MAKTKVLIADDHAVLREGMSRLLSQEKDIEVIGEAGDGQEAVDM
                     VAQLKPDVVLMDIVMPRLTGVEATKLIKKNNPSTCILILTAYSDIRYILGLLEAGASG
                     YLLKSAKSDEIVGAIRAIKAGESVLDSVATRKLLERVVNVSKESDEDKVRGQLSPREI
                     EILQLASKGLSNREIADKLTLSMRTVKAHLSNIFNKMRCSCRTEAIVKGFREGYVMLE
                     DVPQGIDGYDRNTL"
     misc_feature    complement(414580..415218)
                     /locus_tag="DehaBAV1_0409"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(414871..415212)
                     /locus_tag="DehaBAV1_0409"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(414910..414915,414922..414924,
                     414979..414981,415039..415041,415063..415065,
                     415198..415203))
                     /locus_tag="DehaBAV1_0409"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(415063..415065)
                     /locus_tag="DehaBAV1_0409"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(415039..415047,415051..415056))
                     /locus_tag="DehaBAV1_0409"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(414907..414915)
                     /locus_tag="DehaBAV1_0409"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(414598..414768)
                     /locus_tag="DehaBAV1_0409"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(414625..414627,414658..414672,
                     414676..414681,414685..414690,414712..414720,
                     414757..414765))
                     /locus_tag="DehaBAV1_0409"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(414598..414603,414610..414612,
                     414619..414627,414718..414720,414724..414726,
                     414730..414732))
                     /locus_tag="DehaBAV1_0409"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(415333..416016)
                     /locus_tag="DehaBAV1_0410"
                     /db_xref="GeneID:5131124"
     CDS             complement(415333..416016)
                     /locus_tag="DehaBAV1_0410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213873.1"
                     /db_xref="GI:147669055"
                     /db_xref="GeneID:5131124"
                     /translation="MTEILNGQTPELVIARLRAAIEKGQAWYPALLEAVAVWPLDSEE
                     YDGRHYQYLIGGEALDLILLFERFSRELEDLIPAQERDNLLFKGIAPQELTADELLAF
                     LGEVRYRQYLNYFYGITVEEALLVVTQSEVRKEHRSLGVRREGTVIDEAFVQLYERTH
                     DEMLDQFRREKRYSKTGTIKIHQLKEFTYWLFKYRLLHSEKARVASDTNKSLNYLKKY
                     ARRLQQKSN"
     gene            complement(416041..418899)
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /db_xref="GeneID:5131113"
     CDS             complement(416041..418899)
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="functions in protein export; can interact with
                     acidic membrane phospholipids and the SecYEG protein
                     complex; binds to preproteins; binds to ATP and undergoes
                     a conformational change to promote membrane insertion of
                     SecA/bound preprotein; ATP hydrolysis appears to drive
                     release of the preprotein from SecA and deinsertion of
                     SecA from the membrane; additional proteins SecD/F/YajC
                     aid SecA recycling; exists in an equilibrium between
                     monomers and dimers; may possibly form higher order
                     oligomers; proteins in this cluster correspond SecA1;
                     SecA2 is not essential and seems to play a role in
                     secretion of a subset of proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="YP_001213874.1"
                     /db_xref="GI:147669056"
                     /db_xref="InterPro:IPR000185"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004027"
                     /db_xref="InterPro:IPR011115"
                     /db_xref="InterPro:IPR011116"
                     /db_xref="InterPro:IPR011130"
                     /db_xref="InterPro:IPR014018"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5131113"
                     /translation="MFKFFSSFGDSNEKEIRALEPLVDKINQLENSFTTLSDEALKAK
                     TIEFRARLKDTFETTTAGIQEDITSTTAELAEAQKIADNSKQSRLKAKLESLNKDLSA
                     KETTALNGILPEAFAAVREASRRTIGLRHYDVQLIGGMVLHHGKIAEMRTGEGKTLVA
                     TLPLYLNSLLGKGVHLVTVNDYLARRDAYWMGPVYHALGVSVSSIYPMQTPTEELPSR
                     LFDPDYTSEIPGDPWTHFRPISRQEAYKADITYGTSTEFGFDYLRDNLRPDLAQCVQR
                     DMNYAIVDEIDNLLIDEARTPLIISAPDTEAGKLYDVFARLSPRLVAVKDYEINEKDR
                     NAELTEDGWANVEKLLSREGVMKGNSLYDPQNAPLIRHLRNALSAKEFYKKDHQYVVK
                     EGEIIIIDEFTGRMMLGRRYSEGLHQAIEAKEHVKVQQESKTYATVTIQNLFRMYRKL
                     CGMTGTAATEAEEFSKIYKLEVVIIPTNKPAVREDYGDQIYKDQSAKFKAVVNEIDEM
                     RKLGRPVLVGTVSIENSEMLSNMLKRQGIEHKVLNAKQHEKEAQVVAEAGKPGAVTVA
                     TNMAGRGVDILLGGKEPTKDDAKVYNEWQAHHQQVLEAGGLHVIGTERHESRRIDNQL
                     RGRSGRQGDPGSSRFYVALDDDIMRRFGSERIQGIMEWAGMDENTPIENGLVSRTLEN
                     AQKRVEGYHFDVRKHLVEYDDVVNKHREVIYAERRKILSGADLKSNILDMIREEIITQ
                     TAEHTRGYDSSEWNLDGLVTHLNGIFTLPAEINAEALAKLSQEEITDLLTRTAEELYQ
                     KKEDETGAGSMRLLERIIMLHTLDSLWVEHLTIMENLRREIGLQAFAQRDPLIAYKNE
                     GHVRFQELLETIKHDVVHNIYRIGIQIQHQTESATAKAASSPVQQQKPLPAAPAAAIP
                     GVSAKAATQSTTPAAKEIGRNDPCPCGSGKKYKKCCGK"
     misc_feature    complement(416263..418899)
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="preprotein translocase subunit SecA; Reviewed;
                     Region: PRK12904"
                     /db_xref="CDD:237259"
     misc_feature    complement(417637..417993)
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="SecA preprotein cross-linking domain; Region:
                     SecA_PP_bind; pfam01043"
                     /db_xref="CDD:250319"
     misc_feature    complement(416980..417432)
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(417193..417201,417268..417273,
                     417331..417342))
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(417010..417012,417019..417021,
                     417031..417033,417175..417177))
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(416257..416892)
                     /gene="secA"
                     /locus_tag="DehaBAV1_0411"
                     /gene_synonym="azi; div"
                     /note="SecA Wing and Scaffold domain; Region: SecA_SW;
                     pfam07516"
                     /db_xref="CDD:254253"
     gene            complement(418903..419877)
                     /locus_tag="DehaBAV1_0412"
                     /db_xref="GeneID:5131105"
     CDS             complement(418903..419877)
                     /locus_tag="DehaBAV1_0412"
                     /EC_number="2.7.6.1"
                     /note="TIGRFAM: ribose-phosphate pyrophosphokinase;
                     PFAM: phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="YP_001213875.1"
                     /db_xref="GI:147669057"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="GeneID:5131105"
                     /translation="MLVNGNLTEELKIFTGNANPDLAKAVAEYLKVQMGKCEVFQFSN
                     ENIFVRIQESVRQKDVYVIQPTCSPVNQSIMELLIMMDALKRASSERITAVLPYYGYG
                     RTDKKDQPRVPITARLVADLLTTAGASRILTVDLHAPQIQGFFNMPVDELTAENLLAN
                     YFKKKNIKDLVVVATDVGISKKARDFAAKLDAPLAIIEKRRMGNNDITRTINIIGDVE
                     GKNALTFDDEIDTAGSLVGNVNILISKGVKEVYSCATHPVLSGPAIQRIATSPIKELV
                     VTDSIPLTPQKKIDKITVLSIAPLIGEAIYRIHTGNSIGEMYDQMQME"
     misc_feature    complement(418921..419847)
                     /locus_tag="DehaBAV1_0412"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK01259"
                     /db_xref="CDD:234929"
     misc_feature    complement(419497..419847)
                     /locus_tag="DehaBAV1_0412"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:258077"
     misc_feature    complement(419038..419409)
                     /locus_tag="DehaBAV1_0412"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(419104..419106,419176..419190,
                     419194..419202,419344..419346,419350..419352))
                     /locus_tag="DehaBAV1_0412"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(419893..421140)
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /db_xref="GeneID:5131101"
     CDS             complement(419893..421140)
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /EC_number="2.1.2.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate"
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="YP_001213876.1"
                     /db_xref="GI:147669058"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="GeneID:5131101"
                     /translation="MSFLKTSDPAVYNAIMQETTRLKETIDLIASENYTSKAVLEAQG
                     SVFTNKYAEGYPGKRYYAGCEYADAVEELAIDRAKTLFHAEHANVQPHSGAQANMAAY
                     FAMVKPGDTIMGLTLSHGGHLTHGSKVNFTGKLYHVIEYGLNAETERIDYDNLEKLAM
                     EHRPRMIVTGASAYPRILDFERFRAICDKVDAKLMVDIAHIAGLVAAGLHPSPVPYAD
                     VVTSTSHKTLRGPRGGFILCKEQYAKAIDQAVFPVMQGGPLMQVVAAKAVAFQEAMQP
                     GFVTYQKKTLENTQVMAEELRKLGLRLVSGGTDNHLVLVDLSPIGVNGYDAQLALRRA
                     GIVINRNTVPFAENQTANVPAGIRLGCPAATSRGFGPAEIRQTVGWIGKILKNIGNED
                     VEKQVLAEVIHLCRKFPVPGIDI"
     misc_feature    complement(419929..421122)
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /note="Serine-glycine hydroxymethyltransferase (SHMT).
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). SHMT
                     carries out interconversion of serine and glycine; it
                     catalyzes the transfer of hydroxymethyl...; Region: SHMT;
                     cd00378"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(420310..420312,420364..420366,
                     420736..420741,420844..420846,420865..420867,
                     420910..420912,420934..420939,420991..420993,
                     421045..421047,421060..421062,421087..421092,
                     421111..421113,421117..421119))
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    complement(420040..421065)
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /note="Aminotransferase class I and II; Region:
                     Aminotran_1_2; pfam00155"
                     /db_xref="CDD:249636"
     misc_feature    complement(order(420067..420069,420445..420447,
                     420463..420468,420541..420543,420550..420552,
                     420625..420627,420775..420777,420856..420861,
                     420958..420960,420988..420990,421048..421050))
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /note="glycine-pyridoxal phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(420067..420069,420463..420465,
                     420775..420777,421048..421050))
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /note="active site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(420118..420120,420388..420390,
                     420772..420774,420778..420780,420790..420792,
                     420961..420963,420982..420984))
                     /gene="glyA"
                     /locus_tag="DehaBAV1_0413"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:99733"
     gene            421274..421894
                     /locus_tag="DehaBAV1_0414"
                     /db_xref="GeneID:5131098"
     CDS             421274..421894
                     /locus_tag="DehaBAV1_0414"
                     /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
                     PFAM: Uracil-DNA glycosylase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="phage SPO1 DNA polymerase-related protein"
                     /protein_id="YP_001213877.1"
                     /db_xref="GI:147669059"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR005273"
                     /db_xref="GeneID:5131098"
                     /translation="MHDKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFI
                     GEAPGFNEDQQGRPFVGAAGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEI
                     SACCNFLDRQIEIIKPKIIVTLGRFSMARYFTGITISKIHGQPMRRDGIIYYPMYHPA
                     AALHQGGLRKEIEQDMLRIPGLLEELKCAEALLVPKEPPARQVGLF"
     misc_feature    421325..421810
                     /locus_tag="DehaBAV1_0414"
                     /note="Family 4 Uracil-DNA glycosylase (UDG), found
                     exclusively in thermophilic organisms; Region:
                     UDG_F4_TTUDGA_like; cd10030"
                     /db_xref="CDD:198428"
     misc_feature    order(421325..421327,421331..421336,421340..421345,
                     421352..421354,421532..421540,421583..421588,
                     421595..421597)
                     /locus_tag="DehaBAV1_0414"
                     /note="Fe-S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:198428"
     misc_feature    order(421406..421414,421427..421429,421445..421450,
                     421526..421528,421745..421747)
                     /locus_tag="DehaBAV1_0414"
                     /note="active site"
                     /db_xref="CDD:198428"
     gene            421901..423556
                     /locus_tag="DehaBAV1_0415"
                     /db_xref="GeneID:5131088"
     CDS             421901..423556
                     /locus_tag="DehaBAV1_0415"
                     /note="PFAM: beta-lactamase domain protein;
                     RNA-metabolising metallo-beta-lactamase"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_001213878.1"
                     /db_xref="GI:147669060"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR004613"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="GeneID:5131088"
                     /translation="MAKPKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEM
                     LGIDLVIPDISYVLENREKVRGIVITHGHEDHIGALPYILPQINVPIYCTKLTQGLIS
                     VKLKEAKLLHQTKINVIPSDGTFKLGKLKVDFYPVCHSLPDSVGLVIQTPIGAVVHSG
                     DFKLDYTPVDGKPTNLSRLAMLGARGVLLLMSDSTHVELPGYTPSETVVGENIDRIIG
                     AATGRVLVTTFASLISRQQQVIDAAAKYGRKLFFAGRSMTEIHKMATDLGYLKVPEGL
                     VCNIEQLQRVPPEKVVLMTTGSQGEPTSALVRIANRDFRHVHIMKGDTVIISASPIPG
                     NESLVSRTIDSLFRQGAKVFYDRIAKVHVHGHASQEELKLVLNLVKPKYFVPVHGEYR
                     HLTMHAELARTMGVAPENAFVMEDGDILELNTKSGRITGKVPSGNVYVDGLSVGDVGG
                     VVLRNRRMLSQDGIVVAIVAINKQTGMLVGRPDIVSRGFVDPDESKAMLDASRDLIIK
                     LLDHDGKDIPEGAMYNDVKETLNKFYYEQTKRRPMVIPVMVKV"
     misc_feature    421907..423544
                     /locus_tag="DehaBAV1_0415"
                     /note="mRNA degradation ribonucleases J1/J2
                     (metallo-beta-lactamase superfamily) [Translation,
                     ribosomal structure and biogenesis; Replication,
                     recombination and repair]; Region: COG0595"
                     /db_xref="CDD:223668"
     misc_feature    421958..422410
                     /locus_tag="DehaBAV1_0415"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     misc_feature    422969..423076
                     /locus_tag="DehaBAV1_0415"
                     /note="RNA-metabolizing metallo-beta-lactamase; Region:
                     RMMBL; pfam07521"
                     /db_xref="CDD:254257"
     gene            423576..426026
                     /locus_tag="DehaBAV1_0416"
                     /db_xref="GeneID:5131074"
     CDS             423576..426026
                     /locus_tag="DehaBAV1_0416"
                     /note="PFAM: cell divisionFtsK/SpoIIIE;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="YP_001213879.1"
                     /db_xref="GI:147669061"
                     /db_xref="InterPro:IPR002543"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5131074"
                     /translation="MPKKEDPRETLRNARPRAKTPAKITASKRKKPAPVSSKTKKIAS
                     KKAFSSTPAKGGASWLWVMLVASAMAFVVWQWEGVMDFFANFGSGTAGLFGWGLLLVL
                     LGIIIAIVALRFDQMSEWAHRYRLNLWNKWLGGVVLILAAWGMLGMMDAGGDIGLGIL
                     GGKTDVNGFMRVLALIVLGVILIAPGAVWTSLSGLFKGIFRPSRRSNMPEVARLDRTV
                     VSRPVFGGHEDSISPDMGEPVRRLANTKPASKIELPSIKLPSFGKTESRVIEIKNPLA
                     AKTAPQTELPNMPAENTSREPKPADDRSDADRRQVASEVWKKYGEAEGLVEMDGWKLP
                     PIEMLDKTTEIGFSEADNLQRARAIEDALASYGVEGKVIQINAGPTVTQFGVEPGWDR
                     KFKEIKERDKDGETTSRQVEVSKTRVKVDRIASLANDLALALAAPSLRIEAPVPGKSI
                     VGIEVPNTSFGVVSMRSVMETNTFQKILARSPLALALGKGAGGEAVSGDLTKMPHLLI
                     AGATGSGKTVCLNSIICCMLLNNTPASVKFIMIDPKRVELTPFNGLPHLATPVIVDVE
                     KALSALRWLAAEMDRRYQTLAAAGSRNIEGYNKTRVGSDRMAFIVLIIDELADLMMAG
                     FDEVEHILCRLAQMARAVGIHLVVATQRPSVDVITGLIKANFPTRISFAVTSQVDSRT
                     ILDMVGAEKLLGRGDMLYMPTEAAKPKRLQGCYVSDAESERLIYFWTNQKDISPSEAL
                     KVEEITAPPPAQKSRTKDPLFDEAMALISEHNNIISASFLQRKMHIGYPRAARLADEL
                     REAIEGDDGKAEVPKDEY"
     misc_feature    425007..425540
                     /locus_tag="DehaBAV1_0416"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     misc_feature    425079..425585
                     /locus_tag="DehaBAV1_0416"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    425844..>425978
                     /locus_tag="DehaBAV1_0416"
                     /note="This domain directs oriented DNA translocation and
                     forms a winged helix structure; Region: Ftsk_gamma;
                     smart00843"
                     /db_xref="CDD:197911"
     gene            complement(426065..426214)
                     /locus_tag="DehaBAV1_0417"
                     /db_xref="GeneID:5131069"
     CDS             complement(426065..426214)
                     /locus_tag="DehaBAV1_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213880.1"
                     /db_xref="GI:147669062"
                     /db_xref="GeneID:5131069"
                     /translation="MKDPNKTPQTRQEQREQRLLSRRKQMAQHGKGLAQVYKDAVEKK
                     TKQKP"
     gene            complement(426211..428205)
                     /locus_tag="DehaBAV1_0418"
                     /db_xref="GeneID:5131062"
     CDS             complement(426211..428205)
                     /locus_tag="DehaBAV1_0418"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. The beta-hairpin of the
                     Uvr-B subunit is inserted between the strands, where it
                     probes for the presence of a lesion"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="YP_001213881.1"
                     /db_xref="GI:147669063"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR004807"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5131062"
                     /translation="MPSFKIVSDFALTGDQPQAVEKLAEGLVRGLTDQTLLGVTGSGK
                     TFTMANVIARVNRPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYYDYYQPEAYVP
                     QKDMYIEKDSDINEEIDKLRHAATRALFERRDVVIVASVSCIYGLGEPEEYRSFVLPL
                     KKGQSFRRDLILRRLVDMQYERNDLDFSRGKFRLRGDTLEIQPAYEELALRVEFFGDE
                     IERIVSLDPVSGELLADIEEINIYPAKHFVTSAEKMAEAIKSIQAELEDRLKELEAEG
                     KMLEAARLKQRTNYDLEMMEQAGYCSGVENYSRHLAGRKAGSAPWTLLDYFPEDFLLI
                     VDESHMSLPQIRGMYAGDSARKKTLVDYGFRLPSAMDNRPLSFDEFKARVKQAIYVSA
                     TPGPYEKEHSLQVVEQLVRPTGLLEPVMTVKPTVGQIDDLLEEVKKRVAKNERVLITT
                     LTKKMSEKLADYLVEMGVKTHYLHSEVDTLERIEILRDLRLGVYDVIVGINLLREGLD
                     LPEVSLVAILDADKEGYLRSEQALIQTMGRAARHVDGQVIMYADKITGSMQRAMDEII
                     RRRKIQEDYNRLHNITPQGIRKAIKDINERIRSVTAEVSGPEFRPTPTLREDIARLIK
                     ELESQMKKAAKNLEFERAALIRDRVVELRAALEIDPLGRK"
     misc_feature    complement(426238..428205)
                     /locus_tag="DehaBAV1_0418"
                     /note="excinuclease ABC subunit B; Provisional; Region:
                     PRK05298"
                     /db_xref="CDD:235395"
     misc_feature    complement(<427912..428109)
                     /locus_tag="DehaBAV1_0418"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(428071..428085)
                     /locus_tag="DehaBAV1_0418"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(426556..426942)
                     /locus_tag="DehaBAV1_0418"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(426700..426708,426781..426786,
                     426844..426855))
                     /locus_tag="DehaBAV1_0418"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(426583..426585,426592..426594,
                     426604..426606,426682..426684))
                     /locus_tag="DehaBAV1_0418"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(426430..426561)
                     /locus_tag="DehaBAV1_0418"
                     /note="Ultra-violet resistance protein B; Region: UvrB;
                     pfam12344"
                     /db_xref="CDD:256994"
     misc_feature    complement(426244..426345)
                     /locus_tag="DehaBAV1_0418"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     gene            complement(428251..428835)
                     /gene="ruvA"
                     /locus_tag="DehaBAV1_0419"
                     /db_xref="GeneID:5131046"
     CDS             complement(428251..428835)
                     /gene="ruvA"
                     /locus_tag="DehaBAV1_0419"
                     /note="plays an essential role in ATP-dependent branch
                     migration of the Holliday junction"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="YP_001213882.1"
                     /db_xref="GI:147669064"
                     /db_xref="InterPro:IPR000085"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR011114"
                     /db_xref="InterPro:IPR013849"
                     /db_xref="InterPro:IPR013850"
                     /db_xref="GeneID:5131046"
                     /translation="MISSLNGILEASGKDWAVINVSGVGFRCHMPATSSALIGGLGQR
                     VRVFTHLHVREDALSLFGFATTEELSLFETLIDVSGIGPKLGLAMLSVMNAEALASAI
                     ISGNAELLSTIPGIGKKTSSRIILELKDKIAKNWEAGVLSQVTEANSDILATLTALGY
                     SSSEAAKAISSLGDNGDLPLEERIKLALNYFNNK"
     misc_feature    complement(428254..428835)
                     /gene="ruvA"
                     /locus_tag="DehaBAV1_0419"
                     /note="Holliday junction DNA helicase RuvA; Provisional;
                     Region: ruvA; PRK14605"
                     /db_xref="CDD:184761"
     misc_feature    complement(428650..428835)
                     /gene="ruvA"
                     /locus_tag="DehaBAV1_0419"
                     /note="RuvA N terminal domain; Region: RuvA_N; pfam01330"
                     /db_xref="CDD:250538"
     misc_feature    complement(428446..428631)
                     /gene="ruvA"
                     /locus_tag="DehaBAV1_0419"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     misc_feature    complement(428272..428400)
                     /gene="ruvA"
                     /locus_tag="DehaBAV1_0419"
                     /note="RuvA, C-terminal domain; Region: RuvA_C; pfam07499"
                     /db_xref="CDD:254239"
     gene            complement(428832..429335)
                     /locus_tag="DehaBAV1_0420"
                     /db_xref="GeneID:5131018"
     CDS             complement(428832..429335)
                     /locus_tag="DehaBAV1_0420"
                     /EC_number="3.1.22.4"
                     /note="TIGRFAM: crossover junction endodeoxyribonuclease
                     RuvC;
                     PFAM: Crossover junction endodeoxyribonuclease RuvC"
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="YP_001213883.1"
                     /db_xref="GI:147669065"
                     /db_xref="InterPro:IPR002176"
                     /db_xref="GeneID:5131018"
                     /translation="MRILGIDPGTLVVGYGIIETANDELTLVGFSSLTPPACAPIPQR
                     LAYIYKGLVEVIELYQPDEVAVESPFADKNIKSALAIGKAQAVALLAAANHSLPVTEY
                     SPACIKSRVAGSGNASKEQIQEMVRLLLNLAEIPQPNDAADALAVAICHHSQRAFTNI
                     ISQGDLT"
     misc_feature    complement(428883..429332)
                     /locus_tag="DehaBAV1_0420"
                     /note="Holliday junction resolvases (HJRs) are
                     endonucleases that specifically resolve Holliday junction
                     DNA intermediates during homologous recombination.  HJR's
                     occur in archaea, bacteria, and in the mitochondria of
                     certain fungi, however this CD...; Region: RuvC_resolvase;
                     cd00529"
                     /db_xref="CDD:238294"
     misc_feature    complement(order(428907..428909,428916..428918,
                     429135..429137,429315..429317))
                     /locus_tag="DehaBAV1_0420"
                     /note="active site"
                     /db_xref="CDD:238294"
     misc_feature    complement(order(428979..428981,429012..429014,
                     429021..429023,429096..429098,429117..429119,
                     429234..429236,429303..429305))
                     /locus_tag="DehaBAV1_0420"
                     /note="putative DNA-binding cleft [nucleotide binding];
                     other site"
                     /db_xref="CDD:238294"
     misc_feature    complement(order(429054..429059,429069..429071,
                     429078..429083,429087..429092,429099..429104,
                     429111..429113,429126..429128,429189..429191,
                     429198..429200))
                     /locus_tag="DehaBAV1_0420"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238294"
     gene            complement(429339..430094)
                     /locus_tag="DehaBAV1_0421"
                     /db_xref="GeneID:5131145"
     CDS             complement(429339..430094)
                     /locus_tag="DehaBAV1_0421"
                     /note="PFAM: protein of unknown function DUF28"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213884.1"
                     /db_xref="GI:147669066"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="GeneID:5131145"
                     /translation="MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPE
                     GNARLRLAIQKAKDSRMPSDNIERAIKKGSGELEGTTVIEMILEGYGPGGVAVLVNGM
                     SDNRNRTVSDVRHMFSKGGGSLAESGAVSWIFEAKGVIGVETARLDTDELSLKAIDMG
                     AEDVNTDEGYMEIYTAMPDMEKIRQQLETQGVTIDSAEINMVPKNTVKLDEETAMQVL
                     KLLDKLEELDDVQTVSSNADFDPEVVEKYHSQA"
     misc_feature    complement(429357..430094)
                     /locus_tag="DehaBAV1_0421"
                     /note="hypothetical protein; Validated; Region: PRK00110"
                     /db_xref="CDD:234640"
     gene            complement(430211..430570)
                     /locus_tag="DehaBAV1_0422"
                     /db_xref="GeneID:5131170"
     CDS             complement(430211..430570)
                     /locus_tag="DehaBAV1_0422"
                     /EC_number="2.7.8.7"
                     /note="TIGRFAM: holo-acyl-carrier-protein synthase;
                     PFAM: 4'-phosphopantetheinyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="holo-acyl-carrier-protein synthase"
                     /protein_id="YP_001213885.1"
                     /db_xref="GI:147669067"
                     /db_xref="InterPro:IPR002582"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="GeneID:5131170"
                     /translation="MLYTGTDIIEIRRIKAAEARWGEHFLNRIFTPAELSLCKDRFPS
                     LAARFAAKEAVIKVLSLPKNQSYTEIETLNLPEGQPSVNLYGQARDKANILGIKHLSI
                     SLSHCREYAIAMVVAQD"
     misc_feature    complement(430217..430558)
                     /locus_tag="DehaBAV1_0422"
                     /note="4'-phosphopantetheinyl transferase; Provisional;
                     Region: acpS; PRK00070"
                     /db_xref="CDD:234610"
     gene            complement(430612..431076)
                     /locus_tag="DehaBAV1_0423"
                     /db_xref="GeneID:5131157"
     CDS             complement(430612..431076)
                     /locus_tag="DehaBAV1_0423"
                     /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
                     /protein_id="YP_001213886.1"
                     /db_xref="GI:147669068"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="GeneID:5131157"
                     /translation="MDKPVNKTYTPVLSLYEAKKENLIPILLAFQRNFSYLSRDMMQK
                     VAAYVGVPESSVYNIATFYSQFRLEPPGIHRVHVCRGTACHVMGAERLLRNIEKRLGI
                     KAGETTLDNEISLDTINCAGICGLAPTLEVDGKLYTRLNGSSLNRILGKKKR"
     misc_feature    complement(430618..431031)
                     /locus_tag="DehaBAV1_0423"
                     /note="Thioredoxin-like [2Fe-2S] ferredoxin; Region:
                     2Fe-2S_thioredx; pfam01257"
                     /db_xref="CDD:250481"
     misc_feature    complement(430624..430857)
                     /locus_tag="DehaBAV1_0423"
                     /note="TRX-like [2Fe-2S] Ferredoxin (Fd) family,
                     NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily;
                     Nuo, also called respiratory chain Complex 1, is the entry
                     point for electrons into the respiratory chains of
                     bacteria and the mitochondria of eukaryotes; Region:
                     TRX_Fd_NuoE; cd03064"
                     /db_xref="CDD:239362"
     misc_feature    complement(order(430720..430728,430846..430848,
                     430852..430854))
                     /locus_tag="DehaBAV1_0423"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239362"
     misc_feature    complement(order(430705..430707,430717..430719,
                     430825..430827,430840..430842))
                     /locus_tag="DehaBAV1_0423"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239362"
     gene            431313..432863
                     /locus_tag="DehaBAV1_0424"
                     /db_xref="GeneID:5131792"
     CDS             431313..432863
                     /locus_tag="DehaBAV1_0424"
                     /note="PFAM: carboxyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyl transferase"
                     /protein_id="YP_001213887.1"
                     /db_xref="GI:147669069"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000438"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="GeneID:5131792"
                     /translation="MAVQDQLDNLNRLKKQAEMGGGEAKIEAQHKRGKLTARERIELL
                     FDKGTFNELGAFASHRCRDFGLEKQRNAGDAVVTGSGLVNGRLVFTYSQDFTVLGGSI
                     SEVVGQKVAQVIDMAIRAGAPLIAINDSGGARIQEGVASLSGVGDILLRNTIASGVIP
                     QISIVVGPSAGGAVYAPALTDFIFAVKGISQMYITGPDVIKTVTGEDISHEALGGAEI
                     HAKKSGVAHFLCENEKECFEQVRELMGFLPQSNREKPPRGKNKDNEERKTRDLRDIIP
                     DNPKRAYDMKKVITEVADEKEFFEVHKNYAQNIIVGFVRMGGQPAGIVAQQPSHMAGV
                     IDINASLKAARFIRFCDAFEIPLVSFVDVPGFMPGTDQEHSGIIKHGAKLIYAYAEAT
                     VPKITVITRKAYGGAYIVMSSKHLRGDVNYAWPASEVAVMGAEGAVNIVSRKAITESA
                     NPEETRQKLLEEYREHFANPYQAAQLGYIDDVIDPADTRSKIIKALRSLENKILVNPP
                     KKHGNIPL"
     misc_feature    431313..432860
                     /locus_tag="DehaBAV1_0424"
                     /note="Acetyl-CoA carboxylase, carboxyltransferase
                     component (subunits alpha and beta) [Lipid metabolism];
                     Region: COG4799"
                     /db_xref="CDD:227136"
     misc_feature    431412..431933
                     /locus_tag="DehaBAV1_0424"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     misc_feature    <432147..>432533
                     /locus_tag="DehaBAV1_0424"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     misc_feature    <432378..>432773
                     /locus_tag="DehaBAV1_0424"
                     /note="Malonate decarboxylase gamma subunit (MdcE);
                     Region: MdcE; cl17835"
                     /db_xref="CDD:266870"
     gene            432844..434139
                     /locus_tag="DehaBAV1_0425"
                     /db_xref="GeneID:5131781"
     CDS             432844..434139
                     /locus_tag="DehaBAV1_0425"
                     /EC_number="4.2.1.33"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="YP_001213888.1"
                     /db_xref="GI:147669070"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006251"
                     /db_xref="InterPro:IPR011826"
                     /db_xref="GeneID:5131781"
                     /translation="MGIYLCKGRLHKQNMGKTLAEKILSLKSGSDASAGDIVVSMVDL
                     AFVQDTTGPLTVREFWDNGFTKLANPLRTALFLDHAAPSPQRQLSTDHILLRKFARDT
                     GALIFDVGEGVCHQLVAEKLARPGDVIVGADSHTVTAGGLCAFATGMGSSDIAVAFAL
                     GKTWFRVPETIKVVVSGRFKHGLYAKDLILHLIGLIGADGATYKALEFSGNVVNNMTV
                     AERLTIANMAVEAGAKVGLFPSDRQTLEYLRSVGREADYQPLAADADAVYERVIEIDA
                     TALEPTISKPHTVDNTATARELKGTKLDQVFIGTCTGGRLDDLAVAAAIFKNRKRHPQ
                     TRLIVTPASQKIYLEAIRLGYIEILVQAGANIMPPGCGACLGVHQGVLGDGEVCLSTA
                     NRNFKGRMGNPEGFIYLASAATAAASAIKGEISDPREVM"
     misc_feature    432973..434115
                     /locus_tag="DehaBAV1_0425"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    order(432985..432987,432994..432996,433240..433245,
                     433966..433968,434023..434025,434038..434040)
                     /locus_tag="DehaBAV1_0425"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    order(433246..433248,433774..433776,433954..433956,
                     433963..433968,434020..434022)
                     /locus_tag="DehaBAV1_0425"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            434139..434642
                     /gene="leuD"
                     /locus_tag="DehaBAV1_0426"
                     /db_xref="GeneID:5131757"
     CDS             434139..434642
                     /gene="leuD"
                     /locus_tag="DehaBAV1_0426"
                     /EC_number="4.2.1.33"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="YP_001213889.1"
                     /db_xref="GI:147669071"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR011827"
                     /db_xref="GeneID:5131757"
                     /translation="MLKGKAFKFGDSISTDHIAPGRLVHLRSNLPELAKHVLEDADPT
                     FAQRVKPGDFVVAGNNFGLGSSREHAPLIIKMAGVSAVMAKSVARIFFRNAINLGLPI
                     LICDTDKIAEGDELEVDLDGGKIYDRTNGAELTFGKIPPAMLKILDEGGVMPYIKKYG
                     DFKLNEV"
     misc_feature    434145..434630
                     /gene="leuD"
                     /locus_tag="DehaBAV1_0426"
                     /note="3-isopropylmalate dehydratase small subunit;
                     Reviewed; Region: leuD; PRK00439"
                     /db_xref="CDD:234762"
     misc_feature    434331..434339
                     /gene="leuD"
                     /locus_tag="DehaBAV1_0426"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238236"
     gene            434657..435736
                     /locus_tag="DehaBAV1_0427"
                     /db_xref="GeneID:5131226"
     CDS             434657..435736
                     /locus_tag="DehaBAV1_0427"
                     /EC_number="1.1.1.42"
                     /note="PFAM: isocitrate/isopropylmalate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase (NADP)"
                     /protein_id="YP_001213890.1"
                     /db_xref="GI:147669072"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="GeneID:5131226"
                     /translation="MYHNVTLIPGDGIGPEISEATRRVLEATGVKFNWEVVNAGADVV
                     AEYGTPLPDIVLESIRKNKVAIKGPVTTPVGSGFRSVNVGMRKALNLYTCLRPCKTYP
                     GVPSRYDNVDIVIVRENMEDLYAGIEFEKGSAEALRLIEFIKENKKVEIRTDSGISIK
                     PISVFGTERIFRWAFKYAKDNNRKKVTAVHKANIMKYSDGLFLAVGRKVAEEYPEIEF
                     EDRIVDNMTMQLVKTPTQFDILVCPNLYGDILSDLCAGLVGGLGVAPGANIGDEYALF
                     EPTHGSAPKYKGLNKVNPMAMMLSGVLMLRYLKEEKAADKLENAIAAVIAEGKSVTYD
                     MLSPDKQAVAVGTSQVADAIIAKMK"
     misc_feature    434657..435733
                     /locus_tag="DehaBAV1_0427"
                     /note="Isocitrate/isopropylmalate dehydrogenase [Amino
                     acid transport and metabolism]; Region: LeuB; COG0473"
                     /db_xref="CDD:223549"
     gene            435816..436739
                     /locus_tag="DehaBAV1_0428"
                     /db_xref="GeneID:5131156"
     CDS             435816..436739
                     /locus_tag="DehaBAV1_0428"
                     /EC_number="1.1.1.37"
                     /note="Catalyzes the reversible oxidation of malate to
                     oxaloacetate"
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="YP_001213891.1"
                     /db_xref="GI:147669073"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR011275"
                     /db_xref="GeneID:5131156"
                     /translation="MPKISVIGAGNVGATLAQRLIEKDFADVVMLDVVEGIPQGKALD
                     ISQSASVLGFRHAITGSNDYAETAGSEIVVITAGIARKPGMTREELLAINQKIMTDVV
                     SNCLKYSPEATLVVVSNPVDTMTYLAWKLSGLPRKRVVGLSGVLDGGRLATFVARELG
                     VNPSAVSPCVMGEHGGSMVVMPRFTLVNGKPLSELVSPEKADELAKRAVNGGAEIVAF
                     LKTGSAFYAPSASVAAMVEAIFLGSGKVMNCAAVLDGEYGLRNIVLGVPVKLGKGGIK
                     EIITLPLDGQENARLQVSAEMVKAQIASLSL"
     misc_feature    435816..436733
                     /locus_tag="DehaBAV1_0428"
                     /note="malate dehydrogenase; Reviewed; Region: PRK06223"
                     /db_xref="CDD:180477"
     misc_feature    435825..436724
                     /locus_tag="DehaBAV1_0428"
                     /note="L-lactate dehydrogenase-like malate dehydrogenase
                     proteins; Region: LDH-like_MDH; cd01339"
                     /db_xref="CDD:133424"
     misc_feature    order(435843..435851,435909..435914,436041..436052,
                     436104..436106,436164..436166,436170..436172,
                     436239..436241,436251..436253,436335..436337)
                     /locus_tag="DehaBAV1_0428"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133424"
     misc_feature    order(435855..435857,435870..435872,435879..435881,
                     435921..435926,435933..435935,435942..435947,
                     435951..435956,435966..435968,435972..435980,
                     436260..436265,436269..436271,436275..436277,
                     436467..436469,436488..436496,436503..436508,
                     436515..436517)
                     /locus_tag="DehaBAV1_0428"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133424"
     misc_feature    order(435972..435974,435978..435980,436293..436295,
                     436308..436310,436314..436316,436320..436322,
                     436371..436373,436377..436385,436536..436538,
                     436542..436553,436629..436631,436656..436658)
                     /locus_tag="DehaBAV1_0428"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133424"
     misc_feature    order(436074..436076,436170..436172,436263..436265,
                     436335..436337,436449..436451,436485..436487)
                     /locus_tag="DehaBAV1_0428"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133424"
     gene            436762..437133
                     /locus_tag="DehaBAV1_0429"
                     /db_xref="GeneID:5131185"
     CDS             436762..437133
                     /locus_tag="DehaBAV1_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213892.1"
                     /db_xref="GI:147669074"
                     /db_xref="GeneID:5131185"
                     /translation="MSKDKEFLDAFLKLKTELDDTVYKLEDVVINGNLEEKIAALKEA
                     EESLPPALERFDTLPEPEAENVKNARDSYKKAMHLYQQACSHYVKLLTEQNREEGKEG
                     AYKMKQAGDLFVKASEYLEGK"
     gene            437134..437976
                     /locus_tag="DehaBAV1_0430"
                     /db_xref="GeneID:5131766"
     CDS             437134..437976
                     /locus_tag="DehaBAV1_0430"
                     /EC_number="4.2.1.2"
                     /note="Catalyzes the reversible hydration of fumaric acid
                     to yield I-malic acid"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="YP_001213893.1"
                     /db_xref="GI:147669075"
                     /db_xref="InterPro:IPR004646"
                     /db_xref="GeneID:5131766"
                     /translation="MREIAASRISAVLAELIVKISTELGEDILTALHKAYEAEESPAG
                     RDILQSLLENARIAKEKKIPLCQDTGTAIVFAEVGQEVHVTGNFTDAINLGVRQGYEQ
                     AYLRKSIVSHPFSKRINTNDNTPAVIHTEIVPGDRLKISFMAKGSGAENMSRLFMLKP
                     GVGREGVIEAVLETVEKAGGSPCPPIIIGLGVGATAEKAMFMAKKALLRPLGITHTDP
                     EAAALETEVLKQVNKLGIGPLGLGGRVTALGVMAETAPTHIASLPVAVNLQCHSARHG
                     EAVL"
     misc_feature    437134..437973
                     /locus_tag="DehaBAV1_0430"
                     /note="fumarate hydratase; Provisional; Region: PRK06246"
                     /db_xref="CDD:180486"
     gene            437976..438545
                     /locus_tag="DehaBAV1_0431"
                     /db_xref="GeneID:5131186"
     CDS             437976..438545
                     /locus_tag="DehaBAV1_0431"
                     /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
                     subfamily, beta subunit;
                     PFAM: Fe-S type hydro-lyase tartrate/fumarate beta region"
                     /codon_start=1
                     /transl_table=11
                     /product="tartrate/fumarate subfamily Fe-S type
                     hydro-lyase subunit beta"
                     /protein_id="YP_001213894.1"
                     /db_xref="GI:147669076"
                     /db_xref="InterPro:IPR004647"
                     /db_xref="GeneID:5131186"
                     /translation="MSSIKLNSPFDPSELEKLQAGDSVLISGVIYTARDAAHKRLVET
                     LKQGKKLPFDLKGQTIYYMGPSPAKPGEVIGSAGPTTSSRMDPYTPELLDAGLRAIIG
                     KGNRSAEVSRAIVNKKVVYFISIGGAGALLSQCIKESRMVAYPELGAEAILALTVENF
                     PAIVAIDSQGNNAFTLGQSLYRVVGTKEA"
     misc_feature    437985..438518
                     /locus_tag="DehaBAV1_0431"
                     /note="Fumarase C-terminus; Region: Fumerase_C; cl00795"
                     /db_xref="CDD:260626"
     gene            438547..438888
                     /locus_tag="DehaBAV1_0432"
                     /db_xref="GeneID:5131209"
     CDS             438547..438888
                     /locus_tag="DehaBAV1_0432"
                     /note="PFAM: histidine triad (HIT) protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="YP_001213895.1"
                     /db_xref="GI:147669077"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="GeneID:5131209"
                     /translation="MGCLFCAIAKGEIPAQIVYKDEDLVAFKDINPQSPVHILIIPRR
                     HIANLTDLDEADTELAGKMILLAGKLAREMDIAESGYRLVINSGREGGQVVQHLHLHL
                     LGGRQLGGQLG"
     misc_feature    438553..438843
                     /locus_tag="DehaBAV1_0432"
                     /note="Protein Kinase C Interacting protein related
                     (PKCI): PKCI and related proteins belong to the ubiquitous
                     HIT family of hydrolases that act on alpha-phosphates of
                     ribonucleotides. The members of this subgroup have a
                     conserved HxHxHxx motif (x is a...; Region: PKCI_related;
                     cd01276"
                     /db_xref="CDD:238607"
     misc_feature    order(438625..438627,438631..438636,438655..438657,
                     438661..438663,438802..438804,438823..438825,
                     438829..438831,438841..438843)
                     /locus_tag="DehaBAV1_0432"
                     /note="nucleotide binding site/active site [active]"
                     /db_xref="CDD:238607"
     misc_feature    438841..438843
                     /locus_tag="DehaBAV1_0432"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238607"
     gene            complement(438885..439415)
                     /locus_tag="DehaBAV1_0433"
                     /db_xref="GeneID:5131780"
     CDS             complement(438885..439415)
                     /locus_tag="DehaBAV1_0433"
                     /note="PFAM: NUDIX hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_001213896.1"
                     /db_xref="GI:147669078"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="GeneID:5131780"
                     /translation="MVEKILSSHYIYCGNLVKLRKVTVELPSGKTAPRELVEHNPCVV
                     VVALDTDGKLLMVKQYRLAAAQDMLELVAGSMDSGETPEESTRRELREEAGYKPNTLR
                     RLGGFYSSPGFLTEYLYVLVATDLEYAPLTAEDTEDIEVFRYTPAEVKAMIANQQITD
                     SKTLAGLMLYFSQTPG"
     misc_feature    complement(438903..439301)
                     /locus_tag="DehaBAV1_0433"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(438909..438911,438918..438920,
                     438930..438932,438954..438959,438996..438998,
                     439002..439007,439065..439079,439083..439085,
                     439089..439100,439215..439217,439230..439232,
                     439236..439238,439242..439244,439293..439295,
                     439299..439301))
                     /locus_tag="DehaBAV1_0433"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(439068..439070,439137..439139,
                     439149..439151,439191..439193,439233..439235,
                     439290..439292))
                     /locus_tag="DehaBAV1_0433"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(439005..439007,439068..439070,
                     439137..439139,439149..439151,439191..439199,
                     439233..439235))
                     /locus_tag="DehaBAV1_0433"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(439128..439181,439185..439196))
                     /locus_tag="DehaBAV1_0433"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(439005..439007,439137..439139,
                     439149..439151))
                     /locus_tag="DehaBAV1_0433"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            complement(439432..439908)
                     /locus_tag="DehaBAV1_0434"
                     /db_xref="GeneID:5131154"
     CDS             complement(439432..439908)
                     /locus_tag="DehaBAV1_0434"
                     /EC_number="2.3.1.1"
                     /note="catalyzes the formation of N-acetyl-L-glutamate
                     from acetyl-CoA and L-glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_001213897.1"
                     /db_xref="GI:147669079"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:5131154"
                     /translation="MYTIDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFY
                     VIRGDNGEVIACAALHISWADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKALRIPT
                     VFCLTYKPAFFLKCGFHEVEKNALPHKIWGECYRCPKFPNCDETAMMLSLAEVNSV"
     misc_feature    complement(439594..439782)
                     /locus_tag="DehaBAV1_0434"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(439654..439659,439687..439695))
                     /locus_tag="DehaBAV1_0434"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(439892..440746)
                     /locus_tag="DehaBAV1_0435"
                     /db_xref="GeneID:5131830"
     CDS             complement(439892..440746)
                     /locus_tag="DehaBAV1_0435"
                     /note="PFAM: ATP-NAD/AcoX kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-NAD/AcoX kinase"
                     /protein_id="YP_001213898.1"
                     /db_xref="GI:147669080"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="GeneID:5131830"
                     /translation="MYKKIGIIYHPLNPAACDLAIKLAAKLDSLGIENWSDSAWQADK
                     LTPKMQNTQLILTTGGDGTILRTAHAILPLEIPILSVNLGKVGFMTELSPEDAISGLE
                     KVLAGDGWIDERSLLEAEYLPHDSAQSRQFFVMNDAVVARGQVARVICVSVDINSQPF
                     TTYKADGAIVSTATGSTGYSYAAGGPVLQPNSADIILTPILPHLGRGYSLVLPSDSIV
                     DLKVNTWHEATLSIDGFINMQVSSGDTLRLRQSSKKIQFIRLRPENYFYKGLDTKLKG
                     NNESVYDR"
     misc_feature    complement(439913..440740)
                     /locus_tag="DehaBAV1_0435"
                     /note="NAD kinase [Coenzyme metabolism]; Region: nadF;
                     COG0061"
                     /db_xref="CDD:223139"
     gene            complement(440818..441141)
                     /locus_tag="DehaBAV1_0436"
                     /db_xref="GeneID:5131763"
     CDS             complement(440818..441141)
                     /locus_tag="DehaBAV1_0436"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001213899.1"
                     /db_xref="GI:147669081"
                     /db_xref="GeneID:5131763"
                     /translation="MRIGPIEILLIGGLIAIVWAVSKFGKLGKKSDTTEDAKSKPARV
                     APKAPPRSHTSYRLQYLGIIVLFGGLLLGGISFLLVKQLAYGIVWGVAIAGIGLLLLF
                     FSRRK"
     gene            complement(441231..442097)
                     /locus_tag="DehaBAV1_0437"
                     /db_xref="GeneID:5131773"
     CDS             complement(441231..442097)
                     /locus_tag="DehaBAV1_0437"
                     /EC_number="1.3.1.12"
                     /note="catalyzes the formation of 4-hydroxyphenylpyruvate
                     from prephenate"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="YP_001213900.1"
                     /db_xref="GI:147669082"
                     /db_xref="InterPro:IPR003099"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="GeneID:5131773"
                     /translation="MKIGILGGSGKMGQWFGRFLTENGHQVWLWGRNPSKLAPIATRL
                     GAQAATQPDMLGDMDCLIISVPIDAFEDTLRELAPFTKPDQLVFDLCSVKERPVELMH
                     QYLPHCRTLGTHPVFGPGAESLKGYNFILTPTTAPETDLAQGVKTWLEKQGGNVSLIS
                     PEEHDRLMSVVLGLAHFIAIVSADTLLGQNLPGISSAGGTTFRLLDTLTKSVLTEDPG
                     LYASLQVNMPKLPKLEADFIKRATEWAELVKNGDKAEFARRMQTLKDNLARTEPGFEK
                     AYQAMYHLNQPR"
     misc_feature    complement(441306..442097)
                     /locus_tag="DehaBAV1_0437"
                     /note="Prephenate dehydrogenase [Amino acid transport and
                     metabolism]; Region: TyrA; COG0287"
                     /db_xref="CDD:223364"
     misc_feature    complement(<441600..442097)
                     /locus_tag="DehaBAV1_0437"
                     /note="arogenate dehydrogenase; Region: PLN02256"
                     /db_xref="CDD:215144"
     misc_feature    complement(441243..>441500)
                     /locus_tag="DehaBAV1_0437"
                     /note="PD-(D/E)XK nuclease family transposase; Region:
                     PDDEXK_2; pfam12784"
                     /db_xref="CDD:257294"
     gene            complement(442094..443170)
                     /locus_tag="DehaBAV1_0438"
                     /db_xref="GeneID:5131793"
     CDS             complement(442094..443170)
                     /locus_tag="DehaBAV1_0438"
                     /EC_number="5.4.99.5"
                     /EC_number="4.2.1.51"
                     /note="PFAM: prephenate dehydratase; Chorismate mutase;
                     amino acid-binding ACT domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase / chorismate mutase"
                     /protein_id="YP_001213901.1"
                     /db_xref="GI:147669083"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002701"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="GeneID:5131793"
                     /translation="MNLSDLRKQIDNLDTELVKLMAKRLEVSDQIGKIKEETNSPVQD
                     LSRESEVLNRVQSLAQSLGLDPQDIESLYQEILFISKKQQRFTVSFQGAAGAYSEETA
                     LKIFGPNTLTLPCEQLDATFEAVEKGMARFAVVPVENSLEGSISRTYDLLLDSNLMVA
                     AEHELRVSHCLIANPATNLEAVKTIYSHPQALGQCQSFLKHLRAELIPTYDTAGSVKM
                     IKEKGLLNGAAIASERAAVIYNMKVLEREIEDNINNYTRFFVLAKQDSAPTGSDKTSV
                     VFAVKHQAGALYDFIKELASRGINMTKLESRPTRLKPWEYNFYLDIEGHRQDENVKQA
                     LAKADDHVIFMKVLGSYPKMKKHI"
     misc_feature    complement(442916..443152)
                     /locus_tag="DehaBAV1_0438"
                     /note="Chorismate mutase type II; Region: CM_2;
                     smart00830"
                     /db_xref="CDD:214841"
     misc_feature    complement(442112..442912)
                     /locus_tag="DehaBAV1_0438"
                     /note="Prephenate dehydratase [Amino acid transport and
                     metabolism]; Region: PheA; COG0077"
                     /db_xref="CDD:223155"
     misc_feature    complement(442373..442909)
                     /locus_tag="DehaBAV1_0438"
                     /note="Prephenate dehydratase; Region: PDT; pfam00800"
                     /db_xref="CDD:250142"
     misc_feature    complement(442115..442354)
                     /locus_tag="DehaBAV1_0438"
                     /note="C-terminal ACT domain of the bifunctional
                     chorismate mutase-prephenate dehydratase (CM-PDT) enzyme
                     and the prephenate dehydratase (PDT) enzyme; Region:
                     ACT_CM-PDT; cd04905"
                     /db_xref="CDD:153177"
     misc_feature    complement(order(442247..442258,442307..442318))
                     /locus_tag="DehaBAV1_0438"
                     /note="putative L-Phe binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153177"
     gene            complement(443167..444261)
                     /locus_tag="DehaBAV1_0439"
                     /db_xref="GeneID:5131122"
     CDS             complement(443167..444261)
                     /locus_tag="DehaBAV1_0439"
                     /EC_number="4.2.3.5"
                     /note="catalyzes the formation of chorismate from
                     5-O-(1-carboxyvinyl)-3-phosphoshikimate in aromatic amino
                     acid biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="YP_001213902.1"
                     /db_xref="GI:147669084"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="GeneID:5131122"
                     /translation="MSNSLGKLFQITSFGESHGDCVGVVIDGVPAGLAINVDEIQIEV
                     DKRKSGAKAHTTPRREDDRIEIFSGIFNNFTTGAPICLVIWNKNIDSSEYERTRSKIR
                     PGHADFTGFMKYGGFNDYRGGGRFSGRITAGHVMAGAIARKLISTIGIEVIGYTAELG
                     GITAKLPKHKDIRQNISQSDVNCPDLAASKQMVALIQQAAEEGDSLGGVVECIGLNLP
                     VGLGEPVFDTLEGELAKAIFAIPAVKGVEFGAGFGASRLRGSKNNDPFNIQSDQIRTT
                     SNNCGGILGGISDGMPLHIRVAVKPTPSISLSQPTVNLDTMTNTSLEIRGRHDTCIVP
                     RAVSVVEAMTCIVLADLALRAGIIPRVIKQ"
     misc_feature    complement(443209..444237)
                     /locus_tag="DehaBAV1_0439"
                     /note="Chorismase synthase, the enzyme catalyzing the
                     final step of the shikimate pathway; Region:
                     Chorismate_synthase; cd07304"
                     /db_xref="CDD:143612"
     misc_feature    complement(order(443233..443235,443350..443352,
                     443359..443370,443374..443376,443395..443403,
                     443407..443415,443422..443424,443482..443487,
                     443497..443502,443506..443511,443518..443532,
                     443539..443541,443545..443550,443554..443562,
                     443569..443574,443578..443580,443590..443598,
                     443602..443604,443635..443652,443665..443667,
                     443860..443862,443884..443889,443920..443934,
                     444013..444015,444019..444021,444025..444027,
                     444031..444036,444055..444060,444064..444069,
                     444166..444171,444181..444183,444187..444189,
                     444193..444195,444214..444234))
                     /locus_tag="DehaBAV1_0439"
                     /note="Tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143612"
     misc_feature    complement(order(443254..443256,443266..443268,
                     443350..443358,443362..443367,443536..443541,
                     443866..443868,443875..443886,443947..443952,
                     444121..444123,444208..444210))
                     /locus_tag="DehaBAV1_0439"
                     /note="active site"
                     /db_xref="CDD:143612"
     misc_feature    complement(order(443257..443259,443266..443268,
                     443275..443277,443350..443358,443362..443364,
                     443536..443544,443881..443883,443887..443889,
                     443944..443952))
                     /locus_tag="DehaBAV1_0439"
                     /note="FMN-binding site [chemical binding]; other site"
                     /db_xref="CDD:143612"
     gene            complement(444254..445516)
                     /locus_tag="DehaBAV1_0440"
                     /db_xref="GeneID:5131115"
     CDS             complement(444254..445516)
                     /locus_tag="DehaBAV1_0440"
                     /EC_number="2.5.1.19"
                     /note="TIGRFAM: 3-phosphoshikimate
                     1-carboxyvinyltransferase;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase)"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="YP_001213903.1"
                     /db_xref="GI:147669085"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="GeneID:5131115"
                     /translation="MKIHLDKSLPGGNIAVPSSKSYTIRGLIAAAQANGQSHIISPLI
                     ADDTLATRQVLSGLGININTDTGSESWEITGNTFKAPSGNLFCRESAATLRFMSAVCA
                     RLPFECHLLAGHSLMRRPMLPLIQALHQLGIEIETRGNTTVINGQVITRSKVSLPGNI
                     SSQYVSALMLMAPACTHGLEIHLATPPASLPYLKMTKQTLGSFGIKVHSSIDWQEISI
                     PPQPYLPARYRVEGDWSSASSFLALGAIAAPVFISNLDTDSFQADRIMIKFLAEMGAE
                     IESGQNWVKVNPKPLSGINADLTHSIDLLPALAVAAACAKGQSILSGVRQARIKESNR
                     IRAVSQGLSAMGINIIEEDDRLIIEGGQPKGAEIDSFGDHRIAMAFGILGSVVGETHI
                     SDAECVTKTYPDFWKNLESLGGKVTQDV"
     misc_feature    complement(444269..445483)
                     /locus_tag="DehaBAV1_0440"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase;
                     Provisional; Region: PRK02427"
                     /db_xref="CDD:235037"
     misc_feature    complement(444281..445483)
                     /locus_tag="DehaBAV1_0440"
                     /note="EPSP synthase domain. 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EC
                     2.5.1.19) catalyses the reaction between
                     shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP)
                     to form...; Region: EPSP_synthase; cd01556"
                     /db_xref="CDD:238797"
     misc_feature    complement(order(444818..444829,445460..445471))
                     /locus_tag="DehaBAV1_0440"
                     /note="hinge; other site"
                     /db_xref="CDD:238797"
     misc_feature    complement(order(444317..444319,444392..444397,
                     444515..444517,444524..444529,444539..444541,
                     444608..444610,444941..444943,444950..444952,
                     445028..445036,445160..445162,445241..445246,
                     445250..445252,445442..445444,445454..445459))
                     /locus_tag="DehaBAV1_0440"
                     /note="active site"
                     /db_xref="CDD:238797"
     gene            complement(445497..446027)
                     /locus_tag="DehaBAV1_0441"
                     /db_xref="GeneID:5131150"
     CDS             complement(445497..446027)
                     /locus_tag="DehaBAV1_0441"
                     /EC_number="2.7.1.71"
                     /note="PFAM: shikimate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="YP_001213904.1"
                     /db_xref="GI:147669086"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="GeneID:5131150"
                     /translation="MKTKNNIALIGFMGAGKSSISKLLSEKLGKPLVSTDACIETREG
                     LSISHIFKENGEDYFRQMESKVLEDICQNPNQIIDCGGGIVTRPHNLSIMRLNCLVVY
                     LESRPEDLENRLKNHTNRPLFNAERSDKMLKLLESRLPLYRDAADITVSTHNKSCHEV
                     CEEIEDSLRKYENTSG"
     misc_feature    complement(445506..446021)
                     /locus_tag="DehaBAV1_0441"
                     /note="Shikimate kinase [Amino acid transport and
                     metabolism]; Region: AroK; COG0703"
                     /db_xref="CDD:223775"
     misc_feature    complement(445557..446012)
                     /locus_tag="DehaBAV1_0441"
                     /note="Shikimate kinase (SK) is the fifth enzyme in the
                     shikimate pathway, a seven-step biosynthetic pathway which
                     converts erythrose-4-phosphate to chorismic acid, found in
                     bacteria, fungi and plants. Chorismic acid is a important
                     intermediate in the synthesis...; Region: SK; cd00464"
                     /db_xref="CDD:238260"
     misc_feature    complement(order(445557..445559,445668..445670,
                     445689..445691,445971..445988))
                     /locus_tag="DehaBAV1_0441"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    complement(order(445920..445922,445926..445928,
                     445974..445976))
                     /locus_tag="DehaBAV1_0441"
                     /note="magnesium binding site [ion binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    complement(order(445614..445616,445779..445787,
                     445839..445841,445848..445850,445920..445922))
                     /locus_tag="DehaBAV1_0441"
                     /note="putative shikimate binding site; other site"
                     /db_xref="CDD:238260"
     gene            complement(446011..446871)
                     /gene="aroE"
                     /locus_tag="DehaBAV1_0442"
                     /db_xref="GeneID:5131197"
     CDS             complement(446011..446871)
                     /gene="aroE"
                     /locus_tag="DehaBAV1_0442"
                     /EC_number="1.1.1.25"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_001213905.1"
                     /db_xref="GI:147669087"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR011342"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="GeneID:5131197"
                     /translation="MQTIPDALFGIIGYPVSHSVSPAMQNAAFKHCKLNYLYLTIAAK
                     PEDLQNVIASMRPLNIRGLNVTIPHKIEVIKYIDTLDPAAKKIGAVNTIVNENGQMKG
                     YNTDFGGFVRLLEHNRIAPAKHRFALLGAGGSAHAISLAICTLGGHLTVLARQEEKAK
                     DLAAKMCLRFKGKAQGLELNEANLEETLAESDIIVNCTPIGMGNLAGQSLISPRLLRP
                     DLTVIDAIYNPCKTRLLEDAEKKGAKIINGLEMLVWQGAMSFEIWTSQKAPFRVMMKE
                     AEMALDENEK"
     misc_feature    complement(446023..446850)
                     /gene="aroE"
                     /locus_tag="DehaBAV1_0442"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
                     PRK00258"
                     /db_xref="CDD:234703"
     misc_feature    complement(446593..446841)
                     /gene="aroE"
                     /locus_tag="DehaBAV1_0442"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    complement(446080..446559)
                     /gene="aroE"
                     /locus_tag="DehaBAV1_0442"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(446107..446109,446116..446118,
                     446191..446193,446554..446556))
                     /gene="aroE"
                     /locus_tag="DehaBAV1_0442"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(446116..446121,446128..446130,
                     446197..446199,446275..446283,446410..446415,
                     446470..446472,446479..446481))
                     /gene="aroE"
                     /locus_tag="DehaBAV1