GenomeNet

Database: RefSeq
Entry: NC_009455
LinkDB: NC_009455
Original site: NC_009455 
LOCUS       NC_009455            1341892 bp    DNA     circular CON 08-FEB-2015
DEFINITION  Dehalococcoides sp. BAV1, complete genome.
ACCESSION   NC_009455 NZ_AAOM01000000-NZ_AAOM01000033
VERSION     NC_009455.1  GI:147668652
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02598353
            Assembly: GCF_000016705.1
KEYWORDS    RefSeq.
SOURCE      Dehalococcoides mccartyi BAV1
  ORGANISM  Dehalococcoides mccartyi BAV1
            Bacteria; Chloroflexi; Dehalococcoidia; Dehalococcoidales;
            Dehalococcoidaceae; Dehalococcoides.
REFERENCE   1  (bases 1 to 1341892)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Lowry,S., Clum,A.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E.,
            Ritalahti,K.M., Loeffler,F. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Dehalococcoides sp. BAV1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1341892)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Lowry,S., Clum,A.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E.,
            Ritalahti,K.M., Loeffler,F. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4000264
            Source DNA and bacteria available from Frank Loeffler
            (frank.loeffler@ce.gatech.edu)
            Contacts: Frank Loeffler (frank.loeffler@ce.gatech.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-PGF
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 02/07/2015 16:14:33
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 458543)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 1,448
            CDS                          :: 1,389
            Pseudo Genes                 :: 8
            rRNAs                        :: 3 ( 5S, 16S, 23S )
            tRNAs                        :: 46
            ncRNA                        :: 2
            Frameshifted Genes           :: 8
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1341892
                     /organism="Dehalococcoides mccartyi BAV1"
                     /mol_type="genomic DNA"
                     /strain="BAV1"
                     /db_xref="taxon:216389"
     gene            245..1579
                     /locus_tag="DEHABAV1_RS00005"
                     /old_locus_tag="DehaBAV1_0001"
     CDS             245..1579
                     /locus_tag="DEHABAV1_RS00005"
                     /old_locus_tag="DehaBAV1_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_011928546.1"
                     /db_xref="GI:500352503"
                     /translation="MSVRPAQELWEAALGEIELQVNKPNFRTWFAKTVGLKYDGSEFV
                     IGVPNTFVAEYLELNQRSLIEKTLINTTHSPVELCFQLIQSGQVPAAVPQTNKQKQES
                     PFNPRYTFESFIVGSCNRMAHAASLAAAQNPGKSYNPLYIYAEAGLGKTHLLQAIGHL
                     ANLNRRKALYVSGEQFTTDFISSIRNGQTEEFRSRYRDVDLLLLDDVQFIGGKEQTEE
                     CLFHTFNDLHNSNRQIVISADSPPKSLPQLAERLRSRFEWGLTIEIEPPDEKTRLELL
                     QLKAEQSGTELNMDTLEYLAQAVKHNIRELEGSLNRVLAYARLLRAAITPDLAARALS
                     DIGSRPVRENSPLRPGNIISAVSQVFQIPTTELLGAARDKDTALARQFAMFILKQQNS
                     ASLVEIGQSLGGRSASTVSHACDKIQLELENSTFLRLKMTEVQNHLSQQRLP"
     gene            1910..3184
                     /locus_tag="DEHABAV1_RS00010"
                     /old_locus_tag="DehaBAV1_0002"
     CDS             1910..3184
                     /locus_tag="DEHABAV1_RS00010"
                     /old_locus_tag="DehaBAV1_0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZAJ2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Obg"
                     /protein_id="WP_011308640.1"
                     /db_xref="GI:499627906"
                     /translation="MFDRVEINIKAGDGGSGKVSFRREKFVPYGGPDGGDGGDGGNVY
                     LEADSGLYSLLNFKHKRVHKASNGEGGMGSRCTGHNGADLVIKVPVGTVATILEENGQ
                     KRVLADLAADGDRTLVAHGGQGGLGNTHFVSSTNQAPMLAQKGQPGGEYDLILELKLI
                     ADVAIIGYPNVGKSSLLSLLTAAKPKVANYPFTTLSPVMGVIERPEGVFVMAEVPGLI
                     ENAHLGKGLGHDFLRHISRTRMVIHLLDGTSENPIDDMIKVNSELYLYDASLSERPQV
                     VAINKIDDELVQLRREELKETFKEAGLEVFFISALTGEGVDVLLAKVAEKLDILKAAD
                     ISETAPDHEVKIFRPAPKGKMGFRITRLEDGWQVEAPEIERIIEHSDIEDPEVRRQVM
                     VLLKHRSVQQSLIKSGAVIGQKIITGRMEWYL"
     gene            3172..3786
                     /locus_tag="DEHABAV1_RS00015"
                     /old_locus_tag="DehaBAV1_0003"
     CDS             3172..3786
                     /locus_tag="DEHABAV1_RS00015"
                     /old_locus_tag="DehaBAV1_0003"
                     /EC_number="2.7.7.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FP50.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="WP_011928547.1"
                     /db_xref="GI:500352604"
                     /translation="MVSLKTGILGGTFDPIHTGHLILADEVKNRLGLDEVIFIPTGQP
                     YYKADKTISPAEDRLNMVKLAISDKPYFRVMDIEIKRSGPTYTADTLNDLKTILPEKT
                     ELYFMLGWDNLEALPRWHKASEIIRLCRLVAAPRIGQVKPDVDELDDKLPGLQQSLIL
                     LSKPEVDISSSLVRERVENGQGVEHLVPAAVASYIKKHNLYCRK"
     gene            complement(3868..5796)
                     /gene="gyrB"
                     /locus_tag="DEHABAV1_RS00020"
                     /old_locus_tag="DehaBAV1_0004"
     CDS             complement(3868..5796)
                     /gene="gyrB"
                     /locus_tag="DEHABAV1_RS00020"
                     /old_locus_tag="DehaBAV1_0004"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308642.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_011308642.1"
                     /db_xref="GI:499627908"
                     /translation="MLDANKAKPGANSETYTASDIQVLEGLAAVRKRPGMYIGSTDQR
                     GLHHLVYEIVYNSVDEAMAGVCDRIKVIMFKDGSVSVEDNGRGIPVDIHSTTKISALE
                     TVMTVLHAGAKFGGKTYQVSGGLHGVGASVVNALSEWTTVKVRRNGKIYQQSYLRGKP
                     STPLEEVGVSEGSGTTTIFMADSQIFSTTEYDFETLTDRLREIAYLNKGLEVYIYDEK
                     SDQERTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSDSTILEVAIQYNDGYSDSTL
                     TFANCVNTVDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSV
                     KLPEPQFEGQTKGKLGNIEIKSFVESAVAEQLSLYLEEHPDDTKRILEKCITAAKARE
                     AARKARDLIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQ
                     AILPLRGKILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPSKLRYNRLVLMTDAD
                     VDGSHIRTLLLTFFFRHMPRLITESHLFIAQPPLYKIKIGSTEHWVYNDAEKEAILAQ
                     TKSTKVDIQRYKGLGEMSAEQLWRTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVA
                     PRKAFIQSHSRTVKNLDI"
     gene            complement(6001..8187)
                     /locus_tag="DEHABAV1_RS00025"
                     /old_locus_tag="DehaBAV1_0005"
     CDS             complement(6001..8187)
                     /locus_tag="DEHABAV1_RS00025"
                     /old_locus_tag="DehaBAV1_0005"
                     /EC_number="2.7.6.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="WP_011928548.1"
                     /db_xref="GI:500352661"
                     /translation="MEFADLKEKASKYLPPEKLTLLEEAYNYAAAAHAGQMRKSGEPF
                     IEHPLNVAMTLADLQLDAATLSAALLHDVPEDANISLEQIDKKFGADVAKLVDGVTKL
                     SKLALGPAIEDARRPGGNASLRQAENLRKMLVAMAEDLRVVFIKLADRFHNMRTLQAL
                     SPEKRRSIAKETMEIYAPLAHRLGIWELKWQLEDLAFRYLDPRHYRQVANLVDSKLAQ
                     RQNYLEHVSAILQGEFEKNGLNVEVSGRPKHLYSIYQKMEKYASQGKQFEDIYDVLAL
                     RVLVNDIPDCYHAVGIVHSLWHPIPGAFDDYIANPKPNGYQSLHTAVMSLGTTPLEVQ
                     VRTYQMHHIAEYGVAAHWRYKTAGKEDVNFEDRIGWLRQLIEWHRDMRGAEEFLESVK
                     TDIFNDQVFVFTPKGEIKDLAKGATPIDFAYRIHTELGNRCIGAKANGRLVPLDYQLK
                     NGEVVEIVTTKKDRGPSRDWLNGNMGYIKTHHAREKILAWFKKQERTENLDRGRELLE
                     KELKHIGIKTVDRDALAKTFKYENADEFLMAIGYGAVSVHQVSMKLLSQQEQPRVVTP
                     PTQTTKPTSQSSVSVMGTGSLLTNIAKCCNPVPGDDIIGYVTRNRGVTVHRQDCHNIL
                     HEEERERLVSVDWGMPKEELYPASIRIQAWDRVGLVRDVSTVVAEEKISILSMTVTEN
                     DDKTTTLAMTTQIKSLSQLTRLMAKLEGIRGIISINRVGADGSRSG"
     gene            8315..9571
                     /locus_tag="DEHABAV1_RS00030"
                     /old_locus_tag="DehaBAV1_0006"
     CDS             8315..9571
                     /locus_tag="DEHABAV1_RS00030"
                     /old_locus_tag="DehaBAV1_0006"
                     /EC_number="6.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_011308644.1"
                     /db_xref="GI:499627910"
                     /translation="MYQSPRGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFE
                     DAGLFVRSVGEGTDIVSKEMYTFEDRGGDKLTLRPEGTAPVCRAYLEHGMQTRTKPVK
                     LYYLSSIFRYDRPQAGRYRQHHQFGFEAIGEADASLDAEIIEMAWSFYNLLGITDLSL
                     ELNSIGCRQCRPNYISALKDYYQQHAGKLCPDCNTRLDKNTLRLLDCKRAECQAVAGN
                     APRSADYLCPDCLAHYSRLKECLTILDLPFHENFRLVRGLDYYSRTVFEIQPMAEGAQ
                     STIGGGGRYDGLIEQLGGEATPAMGFATGIERIILNLKRQGIVPSPLPSPAVFLAYMG
                     ETASLASFALASDLRKAGIGIYQTYAQKSIKAQLRQANSLGVDWVVILGEEELKQGCA
                     VLRNMKEAGQANIPLDQLICEIKKQI"
     gene            9568..10731
                     /locus_tag="DEHABAV1_RS00035"
                     /old_locus_tag="DehaBAV1_0007"
     CDS             9568..10731
                     /locus_tag="DEHABAV1_RS00035"
                     /old_locus_tag="DehaBAV1_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="saccharopine dehydrogenase"
                     /protein_id="WP_011928549.1"
                     /db_xref="GI:500352671"
                     /translation="MTKNILIIGGYGNAGSCIAMLLMQETDARIFLGGRSLEKAKYVA
                     EGLNRLENIQRVEGVRLNVEDPQSLKEAFSGMDIVVVASNTPEYARQIAVAALEAKVD
                     YIDIQYSDRKLHQLKLLSQKINNANLCFITEAGSLPGLPSALVHLVHQDFTTLERVSV
                     GAIICQNWESAISEERTNEVMRQLSDYQPYVYKNYHWKRLGWFHPGTSRTFNFGSFGR
                     LSCGPMTLEEMRPLPGMYTTLKELGFYMGGFNWFTNWISIPLLNLGLRFFGKEAKRSL
                     GKLLVWGLRNFDNQPYGMAIKVSARGERGGIRERQDILLSHKDAYMFTAIPLVACLKQ
                     YLDGSARRSGLYYMGHLVDSKRLVGDMEKMGMTIRFQTQLVDKPPVARPRIED"
     gene            complement(10728..11330)
                     /locus_tag="DEHABAV1_RS00040"
                     /old_locus_tag="DehaBAV1_0008"
     CDS             complement(10728..11330)
                     /locus_tag="DEHABAV1_RS00040"
                     /old_locus_tag="DehaBAV1_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011928550.1"
                     /db_xref="GI:500352841"
                     /translation="MLGSIPSAYLVTRRLIGRDIRQMGGGNVGGLNTFREVGTGAGIS
                     VAFIDLVKGALAVSVSYYLLTQNAQWVILTGFMAVIGHNWSVWLDFKGGKGLGPAFGA
                     MLFLLPVYGLPQQLGILALLVFIPLALTRNIALATGIALFSLPFLVWYGSHSEFATLI
                     SVLLFLMIGGKFVLDNRKSLRDPANRRNLIVDHWKRPDKG"
     gene            complement(11384..12304)
                     /locus_tag="DEHABAV1_RS00045"
                     /old_locus_tag="DehaBAV1_0009"
     CDS             complement(11384..12304)
                     /locus_tag="DEHABAV1_RS00045"
                     /old_locus_tag="DehaBAV1_0009"
                     /EC_number="2.6.1.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="WP_011308647.1"
                     /db_xref="GI:499627913"
                     /translation="MGTSYAYFKKQIIPLEDAKIGVMTHALHYGTGVFEGIRGNWNDE
                     KKQMYVFRLKEHYTRLLSGAKVLKMDLPYTVDELCKITIELVRKCGFKEDIYIRPLAY
                     KSSESFGVRLHNLECDLLIVAIPWGRYIDKDTCHCCVSTWRRPDDNVMPPQLKSTGIY
                     LNNAFTKTEAVENGFDEGIMLTPDGHVSEGSGENLFLVRKGKLITPPICDSILDGITR
                     NSVMELAEKELGLQVVERSIDRVELYMAEECFLTGTAAHLTPVSEIDHRKVGNGEIGP
                     LTAKLKDLYFEAIKGNITKYENWCTPVYNL"
     gene            complement(12458..13630)
                     /locus_tag="DEHABAV1_RS00050"
                     /old_locus_tag="DehaBAV1_0010"
     CDS             complement(12458..13630)
                     /locus_tag="DEHABAV1_RS00050"
                     /old_locus_tag="DehaBAV1_0010"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_011928552.1"
                     /db_xref="GI:500352870"
                     /translation="MSIRRVMHVDLDAFFVSVEQAVRPEFKDKPVIVGGKPERRGVVA
                     AASYEARKFGIHSGMPLITAKHLCPQAIFIEGNHQLYREYSEKFMLILSDFSPFLEPM
                     GLDEAYLEVTGFESLHGSIAQMASKIRRRITAELGINASIGIANSKVAAKIATEQAKP
                     NGQCEVPAGEEASFLAPLDIAVMPGIGKKTEQHLKSLGIDTLGKLAALPASFLKSCLG
                     TYAPYLSNAAMGIDNRPVEMPSEAKSISRETTFETDTRNQTFLEAKLSYLSEKITATL
                     RKRGKQTRVVQIKIRFADFTTLTRQKHLGQPASGNREIFQTALSLMNGILDSDRQAVR
                     LLGVGISDFCGPEKQLEIDPAKARLEKLDASLDKIRQKYGFSSVQTGRTYRLKDMF"
     gene            complement(13630..13818)
                     /locus_tag="DEHABAV1_RS00055"
                     /old_locus_tag="DehaBAV1_0011"
     CDS             complement(13630..13818)
                     /locus_tag="DEHABAV1_RS00055"
                     /old_locus_tag="DehaBAV1_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928553.1"
                     /db_xref="GI:500353627"
                     /translation="MPEINPGDVYKLRKPHPCGGTDWKVDFAGSDIGITCLRCGHHLL
                     LSRPLFEKKVKCLIKPGE"
     gene            complement(13889..14701)
                     /gene="pyrF"
                     /locus_tag="DEHABAV1_RS00060"
                     /old_locus_tag="DehaBAV1_0012"
     CDS             complement(13889..14701)
                     /gene="pyrF"
                     /locus_tag="DEHABAV1_RS00060"
                     /old_locus_tag="DehaBAV1_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZAI1.1"
                     /note="type 2 subfamily; involved in last step of
                     pyrimidine biosynthesis; converts orotidine 5'-phosphate
                     to UMP and carbon dioxide; OMP decarboxylase; OMPDCase;
                     OMPdecase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="WP_011928554.1"
                     /db_xref="GI:500353628"
                     /translation="MKFLEKLKQAGNRNKSLLCVGLDPDPKLMPVGMSALEFNREIIE
                     ATAPFVCGYKINLAFYEALGKQGWEILSETCEFIPRELITIADAKRGDIGNTSKAYAR
                     AILDELDCDGVTVSPYLGYDSLEPFIEYQDKGIFILCLTSNQGSTDFQMLKTEYLGQK
                     RFLYEVVADKASLWNRYENIGLVVGATQQEELKKLRLIYPKLPFLIPGIGAQGGDLKA
                     TIENGTNPNGELAIICASRGILYARSGSEFAQGAAEAAEQMRDAINHYRKRF"
     gene            14849..15544
                     /locus_tag="DEHABAV1_RS00065"
                     /old_locus_tag="DehaBAV1_0013"
     CDS             14849..15544
                     /locus_tag="DEHABAV1_RS00065"
                     /old_locus_tag="DehaBAV1_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928555.1"
                     /db_xref="GI:500353629"
                     /translation="MKKEFPNKNFQRIEAGHGFEISLIRSDSFEVTVDASEDGFRNIE
                     IKQEGDKLWLMYSPSIFSLKNLLPGWYLPRATVKMPRLGGLYINGATRAKLEGFDSNG
                     KLEIKLSGASQLEGEVKAGEAEIKAEAASEVRLKGVFKKLKLELESGSKVQMEGWTEE
                     LEAEAKGVSQIALDKMVCKQAKVKLENASQAELRVEEVLNVKLNGASELKYAGSPCFN
                     EVEIKGSSSLSKS"
     gene            15583..16377
                     /locus_tag="DEHABAV1_RS00070"
                     /old_locus_tag="DehaBAV1_0014"
     CDS             15583..16377
                     /locus_tag="DEHABAV1_RS00070"
                     /old_locus_tag="DehaBAV1_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928556.1"
                     /db_xref="GI:500353630"
                     /translation="MKKAALLCLSICFTGILALLGGGCIPGVGGFITGSGEVESQPFD
                     YADFNRVEISNVITADISRADSFEVSVSTNENIFEYLELEKSGQTLKIGLKDNYSFTN
                     VKIEASIRLPELVGLDISGASKATVSGFNSVNDFTALVSGASRITLFNMRVGQTRLYI
                     SGASFASGDLICGNASLEVSGASRLELSGQGVDIDVLTEGASTVNLEKFLAASAEVTA
                     TGVSNIRVYTNGDLYITASGVSSVKYFGNPIIKDINISDISSAGKG"
     gene            16423..17739
                     /locus_tag="DEHABAV1_RS00075"
                     /old_locus_tag="DehaBAV1_0015"
     CDS             16423..17739
                     /locus_tag="DEHABAV1_RS00075"
                     /old_locus_tag="DehaBAV1_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folylpolyglutamate synthase"
                     /protein_id="WP_011928557.1"
                     /db_xref="GI:500353631"
                     /translation="MGLTDYESATSRAAANYDLRRVVELLMRLRNPHMGIPAVHLAGT
                     KGKGSTASLIASVMSVAGYRTGLYTSPHLLDFRERICLDGKMISKDHLVRLMASIRPL
                     VDEMNAHAYLGKITSFEVMTALAFEFFHRQQATFQVIETGLGGRLDATNVITPNLSVL
                     TPISLDHTEVLGDSLDKIAAEKAGIIKQSVPVVSAAQRLEAMAVIRERCLKTQSRLIE
                     VSDGYKAEFLGYLGNGQLVKLTGRLGEYCLCLSLLGHYQRQNALTALASLEVLIEAGF
                     KISPEDICEGFRQARWPGRFEVIKGNPLLVIDGAHNEEAVAELVLSLEEYPATAKIEK
                     GERVLVFGTSFDKDAQAMAALLGGYFGTVVLTRSAHPRAMKMDLLKQAFEGRGLQVLE
                     ADGVPKALELAGEISPADGLICATGSLFVAAEALKGKSQPRSGTGS"
     gene            complement(17722..17937)
                     /locus_tag="DEHABAV1_RS00080"
                     /old_locus_tag="DehaBAV1_0016"
     CDS             complement(17722..17937)
                     /locus_tag="DEHABAV1_RS00080"
                     /old_locus_tag="DehaBAV1_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928558.1"
                     /db_xref="GI:500353632"
                     /translation="MSCYFRHMGDIFLAAGVDPQGEKRRELDKIIHRFLGIEYKSCPE
                     TWKKLKEEVIPYPDKKNKLIELLRASS"
     gene            complement(17951..18214)
                     /locus_tag="DEHABAV1_RS00085"
                     /old_locus_tag="DehaBAV1_0017"
     CDS             complement(17951..18214)
                     /locus_tag="DEHABAV1_RS00085"
                     /old_locus_tag="DehaBAV1_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308655.1"
                     /db_xref="GI:499627921"
                     /translation="MQSSLIGKIEKAKRYAQEKDRIRFNQLSVQFRGENDIHTTEYIN
                     SKWHCTCNFFAAWGMCSHTMAMEKVLENMLPDEALSNVFAELP"
     gene            18517..18978
                     /locus_tag="DEHABAV1_RS00090"
                     /old_locus_tag="DehaBAV1_0018"
     CDS             18517..18978
                     /locus_tag="DEHABAV1_RS00090"
                     /old_locus_tag="DehaBAV1_0018"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWA4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminoacyl-tRNA deacylase"
                     /protein_id="WP_011308656.1"
                     /db_xref="GI:499627922"
                     /translation="MKAVVQRVSRASVRVSGETVGEIGPGLAVLLGVAEGDTEEDAEY
                     LASKIINLRIFSDAEGKFNLSLKDLCREMLVVSQFTLIADTRKGRRPSFIEAAQPQEA
                     DGLYNVFIRLCREEGTQVATGQFGAMMMLEIYNDGPVTIILDSRDRLNPRL"
     gene            19030..19458
                     /locus_tag="DEHABAV1_RS00095"
                     /old_locus_tag="DehaBAV1_0019"
     CDS             19030..19458
                     /locus_tag="DEHABAV1_RS00095"
                     /old_locus_tag="DehaBAV1_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_011928559.1"
                     /db_xref="GI:500353633"
                     /translation="MHKQNSIAGELASDGFRLTPQRVLILEALDMAEGHISAEDIYAE
                     VGQEYPNINISTVYRTLELLKGQGLVLETDMGDGRLRYHSVNKGSHHYLVCRKCGQVT
                     DLSEDMVKQLEQSIFKTYGFAADFKNLVIYGQCQKCSASA"
     gene            complement(19536..19844)
                     /locus_tag="DEHABAV1_RS00100"
     CDS             complement(19536..19844)
                     /locus_tag="DEHABAV1_RS00100"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041223222.1"
                     /db_xref="GI:752551979"
                     /translation="MKIKAFIEGATTPSTSRWGIFTSLLATAALFFAISDIDINICVI
                     TGIVFTIMAIALMFYWIITGSRDITATKYDISNLEQKIDKLDDKIIKLLRENSDKRTE
                     "
     gene            complement(19849..20601)
                     /locus_tag="DEHABAV1_RS00105"
                     /old_locus_tag="DehaBAV1_0020"
     CDS             complement(19849..20601)
                     /locus_tag="DEHABAV1_RS00105"
                     /old_locus_tag="DehaBAV1_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928560.1"
                     /db_xref="GI:500353634"
                     /translation="MESRKLSRFIIIVAIISLAASALLYLLHYYIFQDSHHIFIYMLG
                     DLAFIPLEVFLVVVVIERILTSREKHAISQKMNMVVGSFYSELGNALLGKILGSFDDP
                     EQIDSHMGVNKNWSSPEFKQALVYSSHFNHTPNPGKLDLQHLKNLLAAKRSFMLTLLE
                     NPNLLEKDDFTDLLWASFHLGEELDARPSLENLPETDKAHLANDVKRMYALLLNQWIK
                     YLIHLKSQYPHLYSLVLRTHPFQPSPNPVIHE"
     gene            20704..21090
                     /locus_tag="DEHABAV1_RS00110"
                     /old_locus_tag="DehaBAV1_0021"
     CDS             20704..21090
                     /locus_tag="DEHABAV1_RS00110"
                     /old_locus_tag="DehaBAV1_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928561.1"
                     /db_xref="GI:500353635"
                     /translation="MVKYAPDMVADKKDQLEQIEGICLPDELIHAVFDLKGQGTGFIG
                     LTNKRIIFYDKEFAKKAKAIVSIPYNRVATVGSEDKGGLIFRKGFMVSDKLYVGVSGQ
                     AVKEFEFRGGDKAHQAHDIIMTYVLN"
     gene            complement(21369..23759)
                     /locus_tag="DEHABAV1_RS00115"
                     /old_locus_tag="DehaBAV1_0023"
     CDS             complement(21369..23759)
                     /locus_tag="DEHABAV1_RS00115"
                     /old_locus_tag="DehaBAV1_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComEC"
                     /protein_id="WP_011928562.1"
                     /db_xref="GI:500353636"
                     /translation="MIISLCSLGLIAGVALSRLGLPVLPFIILALALGVFWFIFRKKT
                     RLLLGLSLGFLALSGGLWLANSQITINSDPSRLDYYNDSGKLELQGIITENPDKRDRT
                     SLILLEASGIATSSGWQEVSGNVLLTLPSYPEYSYGDQIRISGYLKTPENFDGFDYKS
                     YLENQQIYSVMVYPETTLLSEDNGNPVMTAIFSFRQSLSESLSRAMPEPEASLAKGIL
                     LGERSGIPEDIQTEFSISGTTHLLAISGANLSILSGILLAALGWILGKRGYIYIYLTL
                     ILIWGYSLLSGFDPPVVRAVIMASIFLSAELLGRQKNAMPALCLAAAVMVAFSPSILW
                     SVSFQLSFMSMLGLILVYPMLKELNIRLLDRLGLAEGIFRATLGLVLDGLAVSLAAIA
                     GIWPVLLYYFENISLIGPVATLLAMPAMPFIIVLSFLTALLGLVFPAGAIFMGYLTWL
                     PCRYMLVVVSLTASVPGVLMSGLRPGAMLMGIYYFLLGMLYWLYKHMLKMPPSRPNTN
                     PASTLNLRWLLAGIAVPVLFFSFNLSPSTDQKLHVYFLNVGQGDAILIQYQNQDILID
                     GGPSPQTLCSELDKHLPFFDRSIEMVILTHPDSDHLNGLLEVLERYRVKEVILPQTRS
                     QDSLYQSYQNLIAEKAIPARIAETGMQITMANGAVLEVISPFGGLSSKAADTDNNHST
                     VLNLSCGQINYLFCADIETTVEYQLITQRLLADTTVLKVSHHGSKYSSSAWFLDVTSP
                     EFGLISVGADNRYGHPHPETLSRLISVMAENCIYRTDIWGSLDFATDGQSLYILQS"
     gene            complement(23756..24256)
                     /locus_tag="DEHABAV1_RS00120"
                     /old_locus_tag="DehaBAV1_0024"
     CDS             complement(23756..24256)
                     /locus_tag="DEHABAV1_RS00120"
                     /old_locus_tag="DehaBAV1_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComEA"
                     /protein_id="WP_011928563.1"
                     /db_xref="GI:500353637"
                     /translation="MKVSKRFGLLLGLALSVITAQGCSETTPLAVYTPPQITEKPLEI
                     YISGNINLPGIYPAGTQDTLQSLLESSGGLKDNSELTTIYLSFNPPPLASSAQKIDLN
                     RAEIWLLVALPGIGEARASDIVSYRNQNGGFKNTLELMLIPGFSQSLYDQIKDMICVS
                     ETADIS"
     gene            complement(24434..25099)
                     /locus_tag="DEHABAV1_RS00125"
                     /old_locus_tag="DehaBAV1_0025"
     CDS             complement(24434..25099)
                     /locus_tag="DEHABAV1_RS00125"
                     /old_locus_tag="DehaBAV1_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="portal protein"
                     /protein_id="WP_011308663.1"
                     /db_xref="GI:499627929"
                     /translation="MYVVVIGGGRLGYYLLKALLNDGHEVLLIEKNSSLCDGINKEMG
                     SVCLHGDGCETAVLTEAGTSRADLLIAVTGDDEDNLVACQVAKYKFNVPRTIARVRNP
                     KNESVFRQLGVDSTVNSTNIILEHIEHEVPSHAMTHLLTLHGKDLEIIDIRIPENALT
                     VGKQIHELVLPPQTIISLIVRKDGKPILPRPETTVQVGDQFMIVTSAAKEAEIRDILT
                     ATA"
     gene            complement(25104..25508)
                     /locus_tag="DEHABAV1_RS00130"
                     /old_locus_tag="DehaBAV1_0026"
     CDS             complement(25104..25508)
                     /locus_tag="DEHABAV1_RS00130"
                     /old_locus_tag="DehaBAV1_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_011308664.1"
                     /db_xref="GI:499627930"
                     /translation="MKVVIMGCGRVGAQLATMLDKEGNEVISLDIDAYSFRRLPADFK
                     GTALLCNGMDEESLKKAGIETADAFVAVTQGDNRNIMAAQIAKKIFNVPKVVCRIYDP
                     LRRDLYTLLGLDAISPTTIFAQMLKDKIESKE"
     gene            complement(25512..25940)
                     /locus_tag="DEHABAV1_RS00135"
                     /old_locus_tag="DehaBAV1_0027"
     CDS             complement(25512..25940)
                     /locus_tag="DEHABAV1_RS00135"
                     /old_locus_tag="DehaBAV1_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_011308665.1"
                     /db_xref="GI:499627931"
                     /translation="MEFERILVPVDGTETDEEAISLACTISKVSGKTRVFAVHIIPVE
                     RALPLDAELSSAINKSEGILAKAEEIAEKQGVKLETDLLQAREVANAIIDEAVEKEID
                     LILIGLSYKTRFGEFCMGGVLPYILQNAPCRVIVYHQRKV"
     gene            complement(26017..27462)
                     /locus_tag="DEHABAV1_RS00140"
                     /old_locus_tag="DehaBAV1_0028"
     CDS             complement(26017..27462)
                     /locus_tag="DEHABAV1_RS00140"
                     /old_locus_tag="DehaBAV1_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_011928564.1"
                     /db_xref="GI:500353638"
                     /translation="MKINNVLHYLGLVIAIVGGFMLIPFIFSLINAEPDQMAFGISIV
                     ITLSAGFLLWRFTPITERRISLRESLAIVAGSWIMAALFGSLPFIISGVLPSVIDCIF
                     EAMSGLTTTGASVFSSVENLPHGILVWRSLTQWIGGLGIIMLFVTILPMLGIGASQLM
                     EAETPGQQERLTSRIRDTARTLWLLYLGFTVAGFIALVIAGLPGFDAFNVILATTPTG
                     GFAPVSSIGVYNNLAVELILIFFMVASGVNFGLYYYLLWKGRPAKFFGNPEFKLYIGI
                     LAGCILLINWDLVANAGIGIFEGLRQASFQTASVMTTTGFATADFATWPHFSQAILLV
                     LMVVGASAGSTGGGLKVIRLLVLFKYTYRRILLTFNPNAVIPIKIGGNVISDKLISRS
                     VGLTILYFAALWAGFLIMSAIGLDFVTALSSITSCLGNIGPALGTVGPMSSYADIPGI
                     GKLVLLIAMLVGRIELFTLLVLFVPAFWRWR"
     gene            complement(27466..28830)
                     /locus_tag="DEHABAV1_RS00145"
                     /old_locus_tag="DehaBAV1_0029"
     CDS             complement(27466..28830)
                     /locus_tag="DEHABAV1_RS00145"
                     /old_locus_tag="DehaBAV1_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_011928565.1"
                     /db_xref="GI:500353639"
                     /translation="MYIVIAGGGTVGYNIASMLVVEDHEVVVVEQSEKAVEYLNQQLD
                     IKTIFGNAAIPRILRDAEVQRADLVLAVTDRDETNMVICFIAKEMGAATTAARIRNSE
                     YTGYFIPPAKSTLSARRIIRPKSLGIDVFINPEVEMAREILGILSSFYSTPVEQLANG
                     LVQIRSFTIEGSPMAGKTLSELNFAKPCVVAAIARKEELLVPRPDLVLENEDALYLVA
                     ERDNMDYLGRMFSAIQRPARSVFILGGTQIGMLVAEGLADHDVVVKLIEPDEEKSQKA
                     AVRLEKAVVLKGDPTDRDFLTEQGVPSADAFVATTENDEFNILSCLVAKNLGVDRSLT
                     VINKPSYIPLAEAVDIDVAGSPAIITARKIAHFVLSGGAIAATLLESGQLEAVEFVVS
                     PQAGIINQKVSQIEIPKEATIGAVVQNNQVIIPPDEAVIHAGDHVIVVSQLNVLHDVE
                     KLFK"
     gene            29308..29937
                     /locus_tag="DEHABAV1_RS00150"
                     /old_locus_tag="DehaBAV1_0030"
     CDS             29308..29937
                     /locus_tag="DEHABAV1_RS00150"
                     /old_locus_tag="DehaBAV1_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport regulator"
                     /protein_id="WP_011308670.1"
                     /db_xref="GI:499627936"
                     /translation="MPRISIIPREEKFFDLLEMSAKNMVITAQELDKLVNNWVNVDDQ
                     VARIADLEHEGDSIAHQIINLLHRTFVTPFDREDIALLAHTMDDVTDFIHSAADFMFI
                     YKTGRPGERAKELAAIIVLAAKEVSLAVPHLRHKSEMKQVISHCVEINRLENLADVAF
                     RAALGELFTDSKDMANIIKWREIFEHMETATDRCEDVANVLEGVALKNA"
     gene            29930..30931
                     /locus_tag="DEHABAV1_RS00155"
                     /old_locus_tag="DehaBAV1_0031"
     CDS             29930..30931
                     /locus_tag="DEHABAV1_RS00155"
                     /old_locus_tag="DehaBAV1_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic phosphate transporter"
                     /protein_id="WP_011928566.1"
                     /db_xref="GI:500353640"
                     /translation="MPDASFLPYLLIILLAIGFAFVNGTNDTANAIATVVGTRVLSPR
                     KAIIMAAVANLAGVFTGTAVARTIGKGILGPESLTYETVIAGLIAAVIWSVVATRKGL
                     PVSLTHCLVAGLAMAGVAMAGFGSVDWGILLKIIAAVGIAPIMGMAGGYLLMVALLWI
                     FRRSVPSKTNGLFSHLQIFSAAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIP
                     FWIIVLSALSISAGTAIGGWKVIQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIP
                     VSSTHAISSAIMGVGATRRLSAVRWGVAGNIVGAWLLTFPICGVLGFLVAGLFKLIF"
     gene            complement(30928..31545)
                     /gene="gmk"
                     /locus_tag="DEHABAV1_RS00160"
                     /old_locus_tag="DehaBAV1_0032"
     CDS             complement(30928..31545)
                     /gene="gmk"
                     /locus_tag="DEHABAV1_RS00160"
                     /old_locus_tag="DehaBAV1_0032"
                     /EC_number="2.7.4.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406708.1"
                     /note="Essential for recycling GMP and indirectly, cGMP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_011928567.1"
                     /db_xref="GI:500353641"
                     /translation="MTNWNFNKAEKPLLLIVSGPSGVGKDAVLARMKERKLPLTYIVT
                     TTTRPKRETETEGVDYNFIRPAEFQELISQNELLEWANVYGNFYGVPKAPIRQALSRG
                     SDVIVKVDVQGAASIKKIVPNAVFIFLMPPDMDELTRRLEHRLTESPESLRRRLATAP
                     LEIEKLPDFDYVVVNPEGEIDNAVREIMSIIAAEHCRIQPRLIEL"
     gene            complement(31526..31816)
                     /locus_tag="DEHABAV1_RS00165"
                     /old_locus_tag="DehaBAV1_0033"
     CDS             complement(31526..31816)
                     /locus_tag="DEHABAV1_RS00165"
                     /old_locus_tag="DehaBAV1_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZAF8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010935846.1"
                     /db_xref="GI:499238306"
                     /translation="MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLI
                     DMTNGRKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL"
     gene            32025..32873
                     /locus_tag="DEHABAV1_RS00170"
                     /old_locus_tag="DehaBAV1_0034"
     CDS             32025..32873
                     /locus_tag="DEHABAV1_RS00170"
                     /old_locus_tag="DehaBAV1_0034"
                     /EC_number="1.18.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP(+) reductase subunit alpha"
                     /protein_id="WP_011308673.1"
                     /db_xref="GI:499627939"
                     /translation="MYTIIERQDLLPKVHLLKIQAPKVAAAAAAGQFVILRVDTEGER
                     FPLTIADWDAQAGTVTVIYMEIGVSTRKLAKLGKGDAILDFAGPLGKPTEIENFGTVV
                     CVSGGFAMATIVPIARAMKEAGNRVISIVGARSKDLFFWHDRLTKYSDEMIVCTDDGS
                     AGIKGLVTEPLRDLLSSDTKLDRVIVIGPSVMMKFCSKTTQPFGVKTIVSLNPIMIDG
                     TGMCGCCRVSLDGQTRFACVDGPEFDGHKVDWDGLLVRQKSYVAEEAVASERCRCKEE
                     GCGNHG"
     gene            32866..34263
                     /locus_tag="DEHABAV1_RS00175"
                     /old_locus_tag="DehaBAV1_0035"
     CDS             32866..34263
                     /locus_tag="DEHABAV1_RS00175"
                     /old_locus_tag="DehaBAV1_0035"
                     /EC_number="1.97.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308674.1"
                     /note="NADH-dependent; catalyzes the conversion of
                     pyrimidines to 5,6-dihydro compounds in pyrimidine
                     degradation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase subunit A"
                     /protein_id="WP_011928568.1"
                     /db_xref="GI:500353642"
                     /translation="MAKAGLNRIDMPKQAVAKRIQNFSEVATGYTPSDAHIEAARCLQ
                     CKKRYCVEGCPVNIDIPEFILALREGDMPEAARILKKTNSLPGVCGRVCPQETQCEQA
                     CILNKKEVPIAIGRLERFVADWEREHSAEVNLPKSLKPKSGKKAAVVGAGPAGLTASA
                     ELARLGHDVTLFESLHTAGGVLMYGIPEFRLPKDIVQGEVEYVKSLGVKIELNSVAGR
                     LFSLDDLFKQGFQAVFLATGAGLPLFLNVQGENLNGVYSANEFLTRINLMKAHSFPEY
                     DTPVKKGKKVAVIGGGNVAMDAARCALRLGAEEVSIIYRRSEVELPARKEEVENAREE
                     GIKFHFLTSPVRFLANEQGKVRAMDCQKMELGEPDASGRRRPIPVDGSEFEMDIDLAI
                     IALGTRPNPLVMQSAPDLQVNPNGTVAAGISGQTSHRAVWAGGDIVTGSDTVISAMGA
                     AKRSALVMDEYLRSL"
     gene            complement(34260..34472)
                     /locus_tag="DEHABAV1_RS00180"
                     /old_locus_tag="DehaBAV1_0036"
     CDS             complement(34260..34472)
                     /locus_tag="DEHABAV1_RS00180"
                     /old_locus_tag="DehaBAV1_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377409.1"
                     /db_xref="GI:755024455"
                     /translation="MNVFRSALLFYVFAMLALCFIPAWHSFISQVTGSLDQNLSLVIK
                     LIADPLEYVWKWVLAIFIILLLNRRN"
     gene            complement(34582..35115)
                     /locus_tag="DEHABAV1_RS00185"
                     /old_locus_tag="DehaBAV1_0037"
     CDS             complement(34582..35115)
                     /locus_tag="DEHABAV1_RS00185"
                     /old_locus_tag="DehaBAV1_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928570.1"
                     /db_xref="GI:500353644"
                     /translation="MKIEPEVRKEINQVLDAMKEAVEAKNIEALVALVDSEPNILTVG
                     PCPDNVGLGQNGFRRWMQALLDKATPVKFKLGFTTIKGNGPVVWLDTHVTYTCKNGEN
                     QKDFDFYLSGVMEKVTNEWRWSQMHLSAPSELEFPEGPPPSPEAEKPAEKPKDTTENK
                     APNPEQGEDAPPEWNYM"
     gene            complement(35186..35794)
                     /locus_tag="DEHABAV1_RS00190"
                     /old_locus_tag="DehaBAV1_0038"
     CDS             complement(35186..35794)
                     /locus_tag="DEHABAV1_RS00190"
                     /old_locus_tag="DehaBAV1_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011928571.1"
                     /db_xref="GI:500353645"
                     /translation="MLEINYSTAIDPFLRNIRSFIPDFGGIKPGERVLDVCSGSGAQV
                     GEYRKRGILGFGLDLSPDMLSLSRRLYDPALPSDSYFTEADARHLPFADASFDYTSTT
                     LALHDKPSQTCLEILAEMKRVVKPEGYILIADYTCPLPASFPGWIIRTIERLAGGEHY
                     RNFRQYLKHGGVPALFEELGIKPEGTQTTSYGLITVTKAKVS"
     gene            complement(35805..35999)
                     /locus_tag="DEHABAV1_RS00195"
                     /old_locus_tag="DehaBAV1_0039"
     CDS             complement(35805..35999)
                     /locus_tag="DEHABAV1_RS00195"
                     /old_locus_tag="DehaBAV1_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308678.1"
                     /db_xref="GI:499627944"
                     /translation="MFDFFFGGILGLISFAISLAFYFLPTIIALAKHRRNTLAIFLLN
                     FFLGWTFIGWVVALVWSVKK"
     gene            36141..36512
                     /locus_tag="DEHABAV1_RS00200"
                     /old_locus_tag="DehaBAV1_0040"
     CDS             36141..36512
                     /locus_tag="DEHABAV1_RS00200"
                     /old_locus_tag="DehaBAV1_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308679.1"
                     /db_xref="GI:499627945"
                     /translation="MDIEQFKQLVGEAVDSLPEEFLALLDNVEILVADRPSRVQRRNL
                     DMQAGEELLGLYEGVPLTERHASYGMVTPDRITIFRLAILDTVKSEDDIKDEVRRVVK
                     HEVAHHFGISDERLEEMGGPV"
     gene            36648..37094
                     /locus_tag="DEHABAV1_RS00205"
                     /old_locus_tag="DehaBAV1_0041"
     CDS             36648..37094
                     /locus_tag="DEHABAV1_RS00205"
                     /old_locus_tag="DehaBAV1_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928572.1"
                     /db_xref="GI:500353646"
                     /translation="MSDIAVSAQILHEKGFNCAQSLLAAFAPSLGIETGTALKLASAF
                     GGGMAARGDTCGVISGGLMVIGLKFGQASVEDKAAREKCNRLGREFLKQFEAEFGATA
                     CRDLIKCNIGTPEGAKMVKEKGLREGLCSKLVYRGAEILSALIEQI"
     gene            complement(37091..38194)
                     /locus_tag="DEHABAV1_RS00210"
                     /old_locus_tag="DehaBAV1_0042"
     CDS             complement(37091..38194)
                     /locus_tag="DEHABAV1_RS00210"
                     /old_locus_tag="DehaBAV1_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein YchF"
                     /protein_id="WP_011308681.1"
                     /db_xref="GI:499627947"
                     /translation="MAVTIGIIGLAKSGRTTIFNAATRSNAATGSYSQSSSANVGIVK
                     VPDARLSPLEEMFHPKKLTPAEIKYFDVGASLKGGTKDSSFSGELLTQLQNVDALLNV
                     IRAFEDTAIPLPAGGINAERDLTTMNAELIFSDLTIIEKRLNRIGSQMKSAKPPERAA
                     LEREKELMARIKEAMEKDIPVRDMEVDEEEAKILSGYQFLSNKPVLMVINIGEDDLPK
                     AAEMEAELNTRYGGKNYRVIVMCGKLEAELINMDEAEATEFRSSYGLKETGLDRTIRA
                     SYDLLDLISFFTVGPDEVRAWTITRGTISQKAAGKIHSDIERGYIRAEIVHVGDLLTA
                     GSLAEVRKRGQLRLEGKTYIVQDGDTANFLFNV"
     gene            complement(38216..38458)
                     /locus_tag="DEHABAV1_RS00215"
                     /old_locus_tag="DehaBAV1_0043"
     CDS             complement(38216..38458)
                     /locus_tag="DEHABAV1_RS00215"
                     /old_locus_tag="DehaBAV1_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308682.1"
                     /db_xref="GI:499627948"
                     /translation="MPEEVVMPYELRKHIAIANDMEIAPEIREKTIKHIARFGSYEAL
                     CALLDIACNTKANYGERDLALKVSRDVLKNSRKNDI"
     gene            38586..39614
                     /locus_tag="DEHABAV1_RS00220"
                     /old_locus_tag="DehaBAV1_0044"
     CDS             38586..39614
                     /locus_tag="DEHABAV1_RS00220"
                     /old_locus_tag="DehaBAV1_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta"
                     /protein_id="WP_011928573.1"
                     /db_xref="GI:500353647"
                     /translation="MLYIFTGSDDFSLKERLKQIKQALGDESLASANTTLLEAKNLTA
                     AELLNYVQTIPFLAPARLVIVNGLLERFEGAKGKTAAKDTANKNSPDEFARALDNLPP
                     TTLAVLLDYTTAKDGDYREKEKVSALATNPLFKIIGSRAEVKHFAPLSAQNLPGWVMQ
                     RAKQSSIQMSVPAARLLGRLAGPDLWALSTEIEKLGLYAQGRVIEEADVQAMVGYAQE
                     VNIFSLVDAILDCKVKEAQQSLAAFTSAGGSPGFLLFMLVRQLRLMVRYTALKKRGLK
                     EAEVFKVMGGSEYALRKTASQAVCQNMDSLKNIYTKLLETDLYIKTGRFEPELALSLL
                     VAELCGRK"
     gene            39616..40227
                     /locus_tag="DEHABAV1_RS00225"
                     /old_locus_tag="DehaBAV1_0045"
     CDS             39616..40227
                     /locus_tag="DEHABAV1_RS00225"
                     /old_locus_tag="DehaBAV1_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308684.1"
                     /db_xref="GI:499627950"
                     /translation="MEEKQKQSLREQLKTVKWGSLLLTFGALIALSFLLAWGLNSLVD
                     SLDIPLDEYAWLTYLLVFVMSILANATVIAPVPFAISIMVAAATNFNPVLVALFGALG
                     GSLGEMSGYFAGRLGKKLAIPEGLVGYNRVEIWIQKYGAWAIAFLAAQPIVPFDVGGL
                     IAGLARMPVHKFLPALFLGKFPKYIILIYAGIGLMDWLPFLKA"
     gene            40262..41269
                     /locus_tag="DEHABAV1_RS00230"
                     /old_locus_tag="DehaBAV1_0046"
     CDS             40262..41269
                     /locus_tag="DEHABAV1_RS00230"
                     /old_locus_tag="DehaBAV1_0046"
                     /EC_number="2.7.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family transcriptional regulator"
                     /protein_id="WP_011928574.1"
                     /db_xref="GI:500353648"
                     /translation="MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCA
                     LNGVTGVFESICLVLDRLLERNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRD
                     VPLRDMLTERYLKTFIINDASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNEL
                     YLGQSGCAGEIGHMCLDINGKEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSVLVE
                     RFKADYSALTAEDIGRAASEGDRLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGV
                     SKLGEIFIEPARQVLYKRAFRLAGDDVRLIVSVLGDNAGVIGAALYAYACLDSANNQP
                     Q"
     gene            41385..44000
                     /locus_tag="DEHABAV1_RS00235"
                     /old_locus_tag="DehaBAV1_0047"
     CDS             41385..44000
                     /locus_tag="DEHABAV1_RS00235"
                     /old_locus_tag="DehaBAV1_0047"
                     /EC_number="6.1.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWC3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--tRNA ligase"
                     /protein_id="WP_011928575.1"
                     /db_xref="GI:500353649"
                     /translation="MFSSDELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTTAGMV
                     QFKPYYLGVAKPENPRMASCQKCFRTTDIESVGDASHLTMFEMLGNFSIGNYFKKEAI
                     AWAWEYVTQRLNIPAERLWITVYLDDDEAIALWKEQGVPENRIVRLGAADNFWGPAGD
                     SGPCGPCSEIHYDFGQETGCGKADCNPSCKCGRFCEIWNLVFVQFNQDKSGKRQNLPA
                     PSIDTGMGLERLTILMQSKKNVYETDIFAPIVEKACLLSGRKYGCDAATDRALRIVSE
                     HSRGITFLIADGVIPDKAGRGYVLRRLLRRAVLFGRRLGLERPFLVDMAGAVINRMSG
                     IYPELKKRQTYVLEMIASEEARFSETLATGLELLEEIVRQTKGGRISGQDAFKLYDTY
                     GFPVEMTTEIAAEKGLSVDLDGFESEMEIQRTKARSSRKFSFDAAATAEAVKNMRHAE
                     KTCFVGYELAIQKSTIKDILTEGGTVDSIEEGDEASIVLDESPFYAEMGGQVGDTGEI
                     ITDAGRFEVKNTLHLPNGVFLHQGRVINGCLKISEAATAHINEERRRDIARNHTATHI
                     LQTALREVLGEQVQQRGSVVTPDRLRFDFSHLKPMSKDEMRRVEEFVNDKIRRNLPVY
                     AEEMPYRHALEEGVTALFGEKYGDRVRVLRVGRPAVSAELCGGTHVTASGEIALFKIM
                     SESSVGAGLRRIEAVTGREAEAFINLQQDSLSELSGMLESTAEESPRKLAELKEEIDT
                     LKKAVQNLERQMSRGEAEELLSKAEDYKGVKLLVSRMTSVNADTLRETADFLRDKLGS
                     GVIVLGTVTEDKPFFLCMVTPDLIAKGYHAGNIVKKLSQIAGGGGGGKPNMAQGGGRD
                     KSKLDEALQAVKGMI"
     gene            44047..44448
                     /locus_tag="DEHABAV1_RS00240"
                     /old_locus_tag="DehaBAV1_0048"
     CDS             44047..44448
                     /locus_tag="DEHABAV1_RS00240"
                     /old_locus_tag="DehaBAV1_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWC2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase"
                     /protein_id="WP_011308687.1"
                     /db_xref="GI:499627953"
                     /translation="MGDKWIGAALSDPLRILASPLVILRRDDDTKTLENIESLVKTHQ
                     PDLLIIGLPISLNGTIGPQAEKVKSFSELLSRHLNIEIIYRDERFSTDEARRKMNDSG
                     KNNKTVRDDAAAAAVILQDYLDETNPPCCQP"
     gene            44470..45648
                     /gene="tgt"
                     /locus_tag="DEHABAV1_RS00245"
                     /old_locus_tag="DehaBAV1_0049"
     CDS             44470..45648
                     /gene="tgt"
                     /locus_tag="DEHABAV1_RS00245"
                     /old_locus_tag="DehaBAV1_0049"
                     /EC_number="2.4.2.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWC1.1"
                     /note="Exchanges the guanine residue with
                     7-aminomethyl-7-deazaguanine in tRNAs with GU(N)
                     anticodons (tRNA-Asp, -Asn, -His and -Tyr); Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="WP_011928576.1"
                     /db_xref="GI:500353650"
                     /translation="MDKSFILNKTSSRSLARRGQLFTAHGKVETPVFCPVGSQATVKT
                     LTPEDLKSVNINMILSNTYHLYLRPGIPIIKEMGGLHKFMNWDGVILTDSGGYQIFSL
                     ANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVL
                     AAMERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPELRRQSAEYLASLDFPGYALGGLS
                     LGEPKDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARN
                     GAFFSRLGRLNIRNAAFATQKGPIDPDCNCYTCRNYSAAYLHHLFRCEEILAYRLATI
                     HNIAFLSNLMQEIRTSIEKDCFEEFKADFLSRYQPTNEAIRIEQKQKWLFGRNGEPPS
                     "
     gene            45743..46885
                     /locus_tag="DEHABAV1_RS00250"
                     /old_locus_tag="DehaBAV1_0050"
     CDS             45743..46885
                     /locus_tag="DEHABAV1_RS00250"
                     /old_locus_tag="DehaBAV1_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_011928577.1"
                     /db_xref="GI:500353651"
                     /translation="MITTFDLSTRIIFGVGSISSLNHEASLLGRHALLVTGKGAVRRL
                     GILERALFLLKEACIQTTLFDHVEPNPRSSTVDEGIKLARAKGVDLIIALGGGSAMDA
                     AKAIAFGLACNGPVWDYIQQEEYPEGDLLPLIMIPTVAASGSEANGNAVISNWEKHEK
                     RVISDNRLQPKVSLVDPLLTLSLPPRQTAQGGVDIFCHIAEPYLTAADTSPLRDGMAE
                     LAMRLVVEYLPKAVQTPHDLQSRTQLSWLSTIACSQFMSLGGKSGNMTMHGLEHALSG
                     YYDIAHADGLAALLPAYMRNLYPVRRHRIEMLGEKVFGQTDGILAVENWLKKNNINFS
                     LKDLGVAEAKIEEIAAAAIVMSPWVKNHPGVLDKRVATSLYSTAFN"
     gene            47149..50100
                     /locus_tag="DEHABAV1_RS00255"
                     /old_locus_tag="DehaBAV1_R0001"
     rRNA            47149..50100
                     /locus_tag="DEHABAV1_RS00255"
                     /old_locus_tag="DehaBAV1_R0001"
                     /product="23S ribosomal RNA"
     gene            50201..50318
                     /locus_tag="DEHABAV1_RS00260"
                     /old_locus_tag="DehaBAV1_R0002"
     rRNA            50201..50318
                     /locus_tag="DEHABAV1_RS00260"
                     /old_locus_tag="DehaBAV1_R0002"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            50498..52972
                     /locus_tag="DEHABAV1_RS00265"
                     /old_locus_tag="DehaBAV1_0051"
     CDS             50498..52972
                     /locus_tag="DEHABAV1_RS00265"
                     /old_locus_tag="DehaBAV1_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding protein"
                     /protein_id="WP_011928578.1"
                     /db_xref="GI:500353652"
                     /translation="MSSRFDKFSERARRVLTYAQEEAQSLNHNYIGTEHILLGLVREE
                     EGVAARVLVNMDVNLAKVRSAVEFILGRGEHPATSETGLTSRAKKVIELGIDEARNLG
                     HNYIGTEHLLLGLLREGEGAAAGVLESFGVTVEKVRTEVGRILNQGLNKPKASRTTPS
                     RTPQLDQLGFDLTAAAKAGKLDPVIGRSKEIERVVQILSRRTKNNPALIGEPGVGKTS
                     IVEGLAQRIVSGDVPETLEQKHIISLDVASLVAGTKYRGEFEERLKKVIEEIKNAGNI
                     ILFIDEFHTMVGAGAAEGAVDAANILKPSLARGEVQVIGATTLDDFRKYVERDAALER
                     RFQPVLVEEPAIEDTLSILRGIKERYEEHHKLIISDEAIIAAANMAARYIPDRFLPDK
                     AIDLVDEAASRVRIKKRTKPVSLKEMKAIEDSYRRDKEAALATQQYDYASELRERELQ
                     IAEKIRRMEDEWQTEQAMDKPVVGEEDIAQVVSMWTGVPLVQLTGDETERLLHMEDAL
                     HERIIGQEEAIVTISKAVRRARAGLKDPRHPIGNFVFLGPTGVGKTELARALAQFMFG
                     SEDSLVRLDMSEFMEKFAVSRLVGAPPGYVGYDEGGQLTEAVRRKSYCLILLDEIEKA
                     HPDVFNILLQIFDDGHLTDAKGRRVDFRNTIIIMTSNIGAELIRKGSGTIGFATQTDE
                     SKAQQTNFEHMKDKLLGELKKSFRPEFLNRIDSVVVFHSLNKEQIRSIVDLMLKSVVK
                     QMAEKGIGLEVTESAKDLLGKKGYDEVYGARPLRRTIQTMIEDRLSEDLLRAKFKAGD
                     KVIVDTAEDEIIVRLAEPAELSQATP"
     gene            53418..54812
                     /locus_tag="DEHABAV1_RS00270"
                     /old_locus_tag="DehaBAV1_0052"
     CDS             53418..54812
                     /locus_tag="DEHABAV1_RS00270"
                     /old_locus_tag="DehaBAV1_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012983997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_011308691.1"
                     /db_xref="GI:499627957"
                     /translation="MDKSRNVYICSNCGHESLKWLGRCPGCQEWNTLEETTIAAPLGR
                     KNAPARVISPAAELSSLNASDTTRRSLSISEFNRVLGGGIVPGSLMLLGGEPGIGKST
                     LLLQVAASVAQSGGKVVYVSGEENPAQIKMRAQRLGISGEGLFLMAETDLNAILAQLS
                     VLCPSLVVIDSIQTVFLPELEAAPGAINQVRESALRLMQWAKSSGASVFITAHVTKEG
                     NIAGPRILEHIVDVVMYFEGESQSAYRLIRSVKNRFGSTNEVGIFEMKSEGLVEVANP
                     SQIFLSNRQANTVGSAVTAVLEGSRPLLVEVQALTNTTSFGQPRRTANGVDFNRTIMI
                     AAVLSKRLSMRLGTQDIIVNATGGIRLDEPAADLAIALAIASSYRDIGVCPETIALGE
                     IGLSGELRTIPHLERRLSEASRLGFTRALVPAGANCQNININGIQIIAVSTVKEAIKL
                     ALTGVKTETEDVFE"
     gene            54799..55482
                     /locus_tag="DEHABAV1_RS00275"
                     /old_locus_tag="DehaBAV1_0053"
     CDS             54799..55482
                     /locus_tag="DEHABAV1_RS00275"
                     /old_locus_tag="DehaBAV1_0053"
                     /EC_number="2.7.7.60"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="WP_011308692.1"
                     /db_xref="GI:499627958"
                     /translation="MFLNEKVGAVIVAAGQSRRMEGQDKIFALLAGKPVLAHTLSVFQ
                     ESPQVDDIALVMAEHNIEKAKELVKEYNFSKVIAICSGGTLRQDSVRSGLSALCDCGW
                     ILIHDGARPLLEPDSIPEGLEAAKLCGSAIAAVPLKDTIKEISPEGLVEKTLPRERLI
                     SVQTPQVFRADIIQKAYQRVGIIATDDAQLVEKLKLPVRIFSGACANIKITTPEDLLM
                     AEILLKKGR"
     gene            55488..55961
                     /locus_tag="DEHABAV1_RS00280"
                     /old_locus_tag="DehaBAV1_0054"
     CDS             55488..55961
                     /locus_tag="DEHABAV1_RS00280"
                     /old_locus_tag="DehaBAV1_0054"
                     /EC_number="4.6.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_011928579.1"
                     /db_xref="GI:500353653"
                     /translation="MRIGNGYDVHRLAPGQKLVLGGVEIPFECGLIGWSDADVLTHAI
                     MDSLLGAAALGDIGLYFPPGDPKYKGISSLKLLEQVTDLLAKKGFGIINVDSVIVAEE
                     PKLRGHIDTMRKYLAKAMGIDPGRVGIKASTSEQLGFVGRQEGMVAWAVALVDEK"
     gene            55965..57338
                     /locus_tag="DEHABAV1_RS00285"
                     /old_locus_tag="DehaBAV1_0055"
     CDS             55965..57338
                     /locus_tag="DEHABAV1_RS00285"
                     /old_locus_tag="DehaBAV1_0055"
                     /EC_number="6.1.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWG4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine--tRNA ligase"
                     /protein_id="WP_011928580.1"
                     /db_xref="GI:500353654"
                     /translation="MKIYNTLSGKLEEFVPLENDKVKMYVCGITPQSEPHIGHAMSYI
                     NFDVIRRYLTYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAAL
                     NITPADYYPRATQEVPKIIEIVSGLIDKGYAYAVDGSVYLRVQKVDGYGKLSHRTLEQ
                     MMAGARVEIDEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQ
                     IDIHGGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTI
                     KEALSRYSADALRIFVLSSSYRNPLTYSEEALEAAEKGAERLRQTAARKDNPQFKETT
                     VDTKAYRERFTQYMDNDFNTSAALATIFDLSRELNRIEGEAGKSTDGQKLFKELADIL
                     GLSLIVAESKTGTDVAPFIELLIELRKDLRVAKQYQLADKIRTSLDTAGILLEDSAGG
                     TVWKVKK"
     gene            57444..57519
                     /locus_tag="DEHABAV1_RS00290"
                     /old_locus_tag="DehaBAV1_R0003"
     tRNA            57444..57519
                     /locus_tag="DEHABAV1_RS00290"
                     /old_locus_tag="DehaBAV1_R0003"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:57477..57479,aa:Ala,seq:ggc)
     gene            57557..58555
                     /locus_tag="DEHABAV1_RS00295"
                     /old_locus_tag="DehaBAV1_0056"
     CDS             57557..58555
                     /locus_tag="DEHABAV1_RS00295"
                     /old_locus_tag="DehaBAV1_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011928581.1"
                     /db_xref="GI:500353655"
                     /translation="MNDRLTHKNSYDYPIVASDLLTTPDDLRLCLSTYLLMAKVGQLS
                     PATISNYRYMCGKFVDFCQEHGVTKPAQITSIHLGLFLQQLQLTNGPQSVTDYFKQIR
                     PFINWLKDNGQITVDPLKQVRLPKVPRKVIQPFTQEHCQRLLALVSGETFEDKRNKAL
                     ILLLLDTGLRLRECTELKWSDINYDSELVKVMGKGAKERIVRIGPKVQRALLEYQYLK
                     IQSFPGDKTPDVWVSRHKTRYSDKECHPLTKNGIMQTIVVLGKRAGITNIRCSPHTFR
                     HTFATMCLRNGAGEFEVQSLMGHSTLTQTRKYAASLNSEVAVQGHKKFSPVDNLKL"
     gene            complement(58582..59448)
                     /locus_tag="DEHABAV1_RS00300"
                     /old_locus_tag="DehaBAV1_0057"
     CDS             complement(58582..59448)
                     /locus_tag="DEHABAV1_RS00300"
                     /old_locus_tag="DehaBAV1_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage antirepressor"
                     /protein_id="WP_011928582.1"
                     /db_xref="GI:500353656"
                     /translation="MNESNQLEPIPEGEIQISLFKNKEIRRVLHDGEWFFSVVDIIEA
                     ITDSIRPRQYWTDLKSKIIKEGANELYENIVQLKMPASDGKERDTDAADAETVFRIIQ
                     SIPSPKAEPFKRWLAKTAYDRIEEFQNPEIAIKRAILDYQIQGRTDEWIKARIRTLTS
                     RTELTDEWQKRGIAGAEYGILTNVISKETFDIDTTEHKEIKGLAKRHNLRDHMTDMEL
                     ILTMLGETSTAELARSRDAKGFQENEQAAHAGGRIAGDTRRNFEKQLGESVVSKNNFL
                     PKHPDQPKLEEG"
     gene            complement(59840..60544)
                     /locus_tag="DEHABAV1_RS00305"
                     /old_locus_tag="DehaBAV1_0058"
     CDS             complement(59840..60544)
                     /locus_tag="DEHABAV1_RS00305"
                     /old_locus_tag="DehaBAV1_0058"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377412.1"
                     /db_xref="GI:755024458"
                     /translation="MWDSFVGNQIRRCNRNLLVTIILIALIFIAIASFSYTDPAVTWI
                     ILGAGIVILLYPIICYLRQINSFSNHPVMKTLRKYDDLPELLHAIDEEVKSESSIKSS
                     SKLILTPNWAICLTMYGIKIVNLTELVWVYPKKTTHTVNFILPLYSSNSLCICATPIE
                     SRNSNGNMKNSIYPTQIEIDVTKEQCNEYMQSLQSYAPWVLYGYADDIESCWKKQPLA
                     LLQAVLNRKEELSKVE"
     gene            complement(60568..60753)
                     /locus_tag="DEHABAV1_RS00310"
                     /old_locus_tag="DehaBAV1_0059"
     CDS             complement(60568..60753)
                     /locus_tag="DEHABAV1_RS00310"
                     /old_locus_tag="DehaBAV1_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011928584.1"
                     /db_xref="GI:500353658"
                     /translation="MIKTLRDHRLDKFWSQAELAKQAGIGADTVNRLENGKQNPSFIT
                     IRKLAKALNVKPEDIEF"
     gene            60861..61205
                     /locus_tag="DEHABAV1_RS00315"
                     /old_locus_tag="DehaBAV1_0060"
     CDS             60861..61205
                     /locus_tag="DEHABAV1_RS00315"
                     /old_locus_tag="DehaBAV1_0060"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928585.1"
                     /db_xref="GI:500353659"
                     /translation="MVIRTGKEVVLPYAPEDPVKAEYLPYLLEDIGISQTLMQGFAKS
                     PQEWLAANATKDFIYQFYNYIETGNLSPSTTMSELQNIANMFYTGYEVAQHDVSQIFK
                     IPDTSALKDRNR"
     gene            complement(61286..66757)
                     /locus_tag="DEHABAV1_RS00320"
                     /old_locus_tag="DehaBAV1_0061"
     CDS             complement(61286..66757)
                     /locus_tag="DEHABAV1_RS00320"
                     /old_locus_tag="DehaBAV1_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_008126789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_011928586.1"
                     /db_xref="GI:500353660"
                     /translation="MGILGFPSQGSSGKILSYGPPRQPNNQVAINAALQSVDSSDSKK
                     ITTVEMKDGKWTITTDGAVYNIDTNGQTADTVQYITNYLTSRGASADIIKSVTEQIPI
                     ITTRESGNVVKKKTSATITDPNDTTKKYTAEPVNEPANDSTGEGDTQTNTDVSVTVDN
                     STAWTFTTPNGTVYTVPMAGLAWSDPAKMHEYITNSLNSIGAPANVIMEAVSRMPDVM
                     GDTGLREPRTDEFGNLIDNTQEIKDIIAGSDQSLASITALKAFLDAKGFSNLSPEEQF
                     NKAIEYGLIPTDSVYVPPDAGYNVGQNAPPGMPDDVAVSLGLLPSGEQIEYNIPNFNW
                     AYMPKNEADKYFAELKEIVGYDVTSANLKQAIKEAREIITDQILKQSNFEWRLNKGYL
                     IKLPNNEYMETSEFNKLSQSMQAYIKTNGIEAAKARQAWAENVLDKYSSGSGDDKNIN
                     IQSALNSYDKDVYEALQFLFPDVWDGLKRKPEISGATVAELDKIINASWFSESDNQQE
                     IKTLLRRMGYWTGVGGKLSDKWNELSEDDKQKVADNYLKNINDRWLREMGDIQVTFAN
                     AITDIVTAVDGMSQSDKEIANWLVFSPPLNFMKQYLKPEAWEKITDWLKNAGDKVIQS
                     QESFKEWIDKQPDATKIPLSAVRGIYDTLTAIGASIPLALMETATGYDPKNPTPSIKR
                     ILDMGAGLVTWPTTLPYEIAQDPKTGIPYTMGLALSLVIGPKTIIKLGQSLGRKIFIP
                     KGYEIGAIRLDIDLPGGIGPEKMSEVTAHSLQNVLQDMLSKLSDPKNKGAMTDQIITD
                     PVSGATIRVTPLQRAEKALAKDAGNWSYSVDLNYQWLAEQIKKNGKAIADVPNRGDWG
                     AGVYSSDSAWLTRLETAQDKSAGVYKPAIVAIKYNELKKVPKEVQELFEQGKFDEARA
                     LFAEMERAGKIEPGAYEMWKHWVDKNGRLIMEREIYFAKGTEFLPIQPTFWNRTKAVG
                     DLTASNFTWADRDLKRPDVNGKETVVVKKGERVPIIWIAAKGAKRSAPRLAVRQLSSF
                     VYQPYTTLRRMGRVPKGKVSLQLGYGDVQLPELPGIEYKHRNTGYDYLANNEHPSVTS
                     LEIKQIGGKGDWGTTVIGDLHGDYTDLLKDINSGYERPLIRGRDGNITNWKWNGEKQS
                     VVQVGDIVDRGAHYDQIRTTFNRLADEAAQTGGRVERLIGNHELAYLTGEKIHGIDYS
                     NAAAIKKGILEDINAGKLKAAEAINGELYTHAGVSLEKFPEWKGKDAAYIAAEINRRF
                     NKALAQNKWTDRIFDKGSGERGYKGIGGPFWLRTKETSAEALNLGYKQYFGHTPRPSG
                     INEEAPNAINVDIGRQWTESWAGKIGAYQRTPKLETVERGTNLIESLGESPVHGTGFM
                     PVQFSLDIPTIEEGAISQTIKSLSRHDRGQIDWLRPEDIKATMEPPTNLTPNQIGAAN
                     RLIKSVWDQNGMVDMQFKGVIGISKDGMPAYNRQNILWQGEASLLNSNPKNPAYIAMP
                     LVSKSQKLFENQREIDAGLKRLGINANYAEFRPAIILGKFKPKISMKDRMGYMEKVMK
                     NQPRSAVMIRAEKVELLKAKPGKNSKKSNKTNNKIDENYDENRYEGSENSKEYTKLEL
                     GPKPGYKPQDYEDYSKEYPANKLYYPIHESKYASATEESHEPDYTASEQLPTYSSPKY
                     STTGYNPKNYEGKDSPIETIPPPVIPTDDNQITKRQDSKATSKQDRPKLGNGDVAWKQ
                     GELGTGENKRPVWYIQRADGDVDIVFQPPEDAPRLEGTPAETFFTRGKKPPTNLTQKM
                     GVTTAKINLQDNPEIKFIQTKSPKFKQSIPRHIRRSIGM"
     gene            complement(66917..67264)
                     /locus_tag="DEHABAV1_RS00325"
     CDS             complement(66917..67264)
                     /locus_tag="DEHABAV1_RS00325"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377418.1"
                     /db_xref="GI:755024464"
                     /translation="MTTDEGLLAAAQAIANALESLGNTLSAALDTSVTTLMSTALSTG
                     LELFLLSMITVLALWKRHIVLDILAGLGWFGISFTLFSSASLIAVMPFATCLALGIFM
                     FYRIIEDTGRIGR"
     gene            complement(67261..68091)
                     /locus_tag="DEHABAV1_RS00330"
                     /old_locus_tag="DehaBAV1_0062"
     CDS             complement(67261..68091)
                     /locus_tag="DEHABAV1_RS00330"
                     /old_locus_tag="DehaBAV1_0062"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928587.1"
                     /db_xref="GI:500353661"
                     /translation="MIWGYIGHEGAGKSAAMCYFDLLHIAKGGGLFTFPGFEVFNPNI
                     TLDDGNHPRLGKSIDMKEFIFSFSDEQKLRNVFVSMDEIQNFFGSDKYMTMYNSLITK
                     YSMQRRKLNFGINYTVQSWNWIDPRLRQLTHFLTVCKDLSRTPWGKEAGLKRGQLIDL
                     VTYDCKGFITGEEWAPLKHFNLNILPVRDWYDSYSTVDPLESFRKLVIKKPEDILDMR
                     EGMPRFNPLDDSPLENVPDDVREISQENNARILSKLEEQVDPATLIQVSKALRKVNAK
                     "
     gene            complement(68088..68522)
                     /locus_tag="DEHABAV1_RS00335"
                     /old_locus_tag="DehaBAV1_0063"
     CDS             complement(68088..68522)
                     /locus_tag="DEHABAV1_RS00335"
                     /old_locus_tag="DehaBAV1_0063"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928588.1"
                     /db_xref="GI:500353662"
                     /translation="MAGFKRKNGGPATGGTTDTLGIQDTIGAAGGNGFKSGLLDFDAL
                     EKLLGNPQTVSLAKEFTSPGDNVRGLLMRADFKDAKQVLAMIEYLHRCKEIHYKRGED
                     RLLDFIAALPAIQARRINLLAKVLTHGVMEASSRQQKERRPE"
     gene            complement(68535..69005)
                     /locus_tag="DEHABAV1_RS00340"
                     /old_locus_tag="DehaBAV1_0064"
     CDS             complement(68535..69005)
                     /locus_tag="DEHABAV1_RS00340"
                     /old_locus_tag="DehaBAV1_0064"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377421.1"
                     /db_xref="GI:755024467"
                     /translation="MGGLEEMTKASTIEKNQELIAGFKTPEEIISSRMQSDQRAKREP
                     DALVYDMRLGWAPEYIDNPIGHRKSFRNKRLCPIIRRWKQLPTGEWESKIEPVPEPED
                     MEASPQSLYRMLHWEPLVKSAFGGLGDIWQKLKVGLLVVLVGIGIFALYLFTQS"
     gene            complement(68993..69451)
                     /locus_tag="DEHABAV1_RS00345"
                     /old_locus_tag="DehaBAV1_0065"
     CDS             complement(68993..69451)
                     /locus_tag="DEHABAV1_RS00345"
                     /old_locus_tag="DehaBAV1_0065"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928590.1"
                     /db_xref="GI:500353664"
                     /translation="MKILWMQFGRDKTRTQDVHVLTEDGRIVEVSADVLYGCVSVDEW
                     GQAWVLRGADLCPSRDGKGDILLVNERSLAPIAFDGRPARTHEEALKLKDDIGAEACE
                     SVHFNRDREIKKETMANVLQVLIIGLFGTVCVIALIGVYASGNAKLPWVG"
     gene            complement(69466..69708)
                     /locus_tag="DEHABAV1_RS00350"
     CDS             complement(69466..69708)
                     /locus_tag="DEHABAV1_RS00350"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377424.1"
                     /db_xref="GI:755024470"
                     /translation="MKVVGGILGIAISLLFFPIALSGIDAVLNNANLADYTGLETIVK
                     ITPMIVWVGIFLGSGLTLFFGVKGSRGGKKSRSRMA"
     gene            complement(69766..70191)
                     /locus_tag="DEHABAV1_RS00355"
                     /old_locus_tag="DehaBAV1_0066"
     CDS             complement(69766..70191)
                     /locus_tag="DEHABAV1_RS00355"
                     /old_locus_tag="DehaBAV1_0066"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377427.1"
                     /db_xref="GI:755024473"
                     /translation="MLIVGIAVSVLFFPMVLSSMDSIQFASNTGTYAAVTTGVGETTA
                     DVVLSTALYNDDNGHVTSITSTVGTDVPVAGTYVAATKTLTVTGLTASESRTLTVIYD
                     SDNLSDYTGLGTIVSLSPLIIWLVILGALGIGLYSNVKS"
     gene            70367..70630
                     /locus_tag="DEHABAV1_RS00360"
                     /old_locus_tag="DehaBAV1_0067"
     CDS             70367..70630
                     /locus_tag="DEHABAV1_RS00360"
                     /old_locus_tag="DehaBAV1_0067"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928592.1"
                     /db_xref="GI:500353666"
                     /translation="MEEQKIIVPAKIPGLLEALKNEDAFPDNLRYIMQTHGIGATAIS
                     RIYGISRMQVYRYLKGEDLPREPAIYMSVNEWADYLRKSIKAS"
     gene            70591..71598
                     /locus_tag="DEHABAV1_RS00365"
                     /old_locus_tag="DehaBAV1_0068"
     CDS             70591..71598
                     /locus_tag="DEHABAV1_RS00365"
                     /old_locus_tag="DehaBAV1_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928593.1"
                     /db_xref="GI:500353667"
                     /translation="MGRLFTKIYKGVIVACLCLASLPPAAVLAVDPAAPTTFTIDDVQ
                     VAHNIVETGDSLVSFKYTIAYSSGQPTTPANKLFHFRLMDTDGIIQLGAIEPYAYYNA
                     GYDMGYSAFYFAADDAPEWETALILKMVGNPQYWEIPPEVNYTLTTSDYSQLETKKEN
                     QTLMGSWIIEVCRALEINWVQKLLTETDQGTVFNEYGSAYGKGTIPGLQTMCPKIFST
                     QTQGLDMTRRVWVMTKLDEWAHQWDGTIIGDILEGLASIFNNVTSWQMITSLICIVMV
                     IGLFIWGRVKYANNHGAMIASSYILAGGTDMGLFNGVLLAMIVTIYAAYASYVLMGRH
                     A"
     gene            71595..73340
                     /locus_tag="DEHABAV1_RS00370"
                     /old_locus_tag="DehaBAV1_0069"
     CDS             71595..73340
                     /locus_tag="DEHABAV1_RS00370"
                     /old_locus_tag="DehaBAV1_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928594.1"
                     /db_xref="GI:500353668"
                     /translation="MKKLIISVGMLILATIIGPGTILASTITDAIYQANIRATNASYT
                     ATHVAAPFTWATDSLLDGYYIDSEFNNLAMRDSIGNDIPFMPGQGSDPWIMWIDQIAQ
                     NSAINYNLYTGGETAMGGKLAYCPDTAGMTVADAASLELGNSFEIELSGRFNDGYNLS
                     KFGAFWIYTSGTDVSAGNSSSYTETPYNGTASSATSMYGANWIAQTFQFSNDVAVNQF
                     TFRTQRVGNPTGNFNYAIYATSGDVPTGSALVSGSVVASTISTSAVNHTFDFSNIINL
                     TAGTRYAIVLSLPNGDSSNKLTHWYNPTNPYANGRYCTTNNSGSSWSGTATTDINISI
                     TGNANNTIVTAADISSSEHVYKISLSAGTMNIYIDGLLEGSAAFAVSITDNANNLVIG
                     ANGSMPYLYYAKITVGGVLRGSWEWQYAATFTDLSGNGNDATPSFRTTTTDADVSVSV
                     ISYTACNQSAFITGEDDEAVEIVTDDDIGEMPDGWYGDLHPENLPGGQAISDFLENMD
                     FPPAFFWYSLVYLGAAIVTMVSLGLTSELLPCAAAGLIWQIFFCAIIGTSWWVLLPEG
                     IIIIGEMVNRKLASY"
     gene            73340..73684
                     /locus_tag="DEHABAV1_RS00375"
                     /old_locus_tag="DehaBAV1_0070"
     CDS             73340..73684
                     /locus_tag="DEHABAV1_RS00375"
                     /old_locus_tag="DehaBAV1_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928595.1"
                     /db_xref="GI:500353669"
                     /translation="MRQQWLVWLAFTYIVGQFMCLILEGTWLGDPEQSFFNALLGFSV
                     MQYSDSVLGNLFVTVVNIVGGVYGLLTYAIPRLLFWDYSFLAGTASLAKWLFFYPVSA
                     GTVWGLYTSLRR"
     gene            complement(73674..73931)
                     /locus_tag="DEHABAV1_RS00380"
     CDS             complement(73674..73931)
                     /locus_tag="DEHABAV1_RS00380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377429.1"
                     /db_xref="GI:755024475"
                     /translation="MVTETKGILNTDNLFQILSALMDECCDEFGPAGDGCSRCLCRRS
                     CQRLIDSINQDRLTMQKFHFYKREFRKLKSRRQIMMDVIIS"
     gene            complement(74225..74767)
                     /locus_tag="DEHABAV1_RS00385"
                     /old_locus_tag="DehaBAV1_0071"
     CDS             complement(74225..74767)
                     /locus_tag="DEHABAV1_RS00385"
                     /old_locus_tag="DehaBAV1_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928596.1"
                     /db_xref="GI:500353670"
                     /translation="MKTVLTKIKGITPLLMHRFPMAGADDTSKRRTGVPDWKAEAELA
                     LYKDDHGQIYQPASHIEAALKEASKTLKIPGKRGATYSKLIGSAVSVSPDAITHLVQD
                     YEIDSRPVVIQKARIVRYRPVFKDWELEFDINIGDDQIPIEVIKQALDHAGLYVGIGD
                     FRPGRGGKFGKFMVVRFEEK"
     gene            complement(74911..75108)
                     /locus_tag="DEHABAV1_RS00390"
     CDS             complement(74911..75108)
                     /locus_tag="DEHABAV1_RS00390"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377431.1"
                     /db_xref="GI:755024478"
                     /translation="MRHLKAVWQGGLFIEGLRPKNRLHESPGTHHLIVTKASPQFDDQ
                     NLIGKRVAIPVCGPMYWEVME"
     gene            complement(75294..75611)
                     /locus_tag="DEHABAV1_RS00395"
                     /old_locus_tag="DehaBAV1_0072"
     CDS             complement(75294..75611)
                     /locus_tag="DEHABAV1_RS00395"
                     /old_locus_tag="DehaBAV1_0072"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928597.1"
                     /db_xref="GI:500353671"
                     /translation="MKQLKPKCRHKFYQAGSIYYCSRYAIEGTDFCKVHNPESVAAKE
                     KERELANLEHFRQARNELIRQIIITEIFSGITTEEIRKNKAKLKAVFKTVFKTEALLE
                     HFQ"
     gene            complement(75785..76420)
                     /locus_tag="DEHABAV1_RS00400"
                     /old_locus_tag="DehaBAV1_0073"
     CDS             complement(75785..76420)
                     /locus_tag="DEHABAV1_RS00400"
                     /old_locus_tag="DehaBAV1_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="WP_010936057.1"
                     /db_xref="GI:499238517"
                     /translation="MKVALYARVSTRDKNQDPEVQLMELRKYCQENGMEITREYIDHA
                     SANDFVRRTAWKQLLVDASARKFRGLLVWKLDRAFRDITVATSSVKMLRNAGIDFIVT
                     TVPVLSVQGPAGDLMFNIYAAFAQFEKDTIIERVNAGLSRAKAKGKAFGRPRKAIDFN
                     KVLEAHEIACSRVNRITKENQGYSETARILSEQTGLRITAGWVYNRIKAGN"
     gene            complement(76474..76794)
                     /locus_tag="DEHABAV1_RS00405"
     CDS             complement(76474..76794)
                     /locus_tag="DEHABAV1_RS00405"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377436.1"
                     /db_xref="GI:755024483"
                     /translation="MKKCVSPPKISHVLKNGARSARKLFLIVSQKYSEREISCTLRVQ
                     EGARSAIQVQYRCKRSARKYKAKLKIGAREVQENIKAKLKIHTRNCQYFLHLKTNIYH
                     SVLG"
     gene            complement(<78605..79402)
                     /locus_tag="DEHABAV1_RS00410"
     CDS             complement(<78605..79402)
                     /locus_tag="DEHABAV1_RS00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012034012.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377912.1"
                     /db_xref="GI:755024968"
                     /translation="MTIATRKYTIDDILAKLQGVKKNGSGFMACCPAHEDKNPSLSIS
                     EKDGKVLLKCFAGCSYEQIMTALNMPINAAAQDTTATSSKKPKESTKREIKQTYDYTD
                     RSGQLIFQVVRFEPKSFSQRHPGGKTGWVWNMKDIEPVIYHLPDVLEAVKTGQTIWIT
                     EGEKDADNARAMGLVATTSPMGAGKWRDNYTNDLLGASQVVVIADKDAPGRKHASDIA
                     MSCRRQRIPVKIIEVPGDAKDFTEWLEAGGQTSELDDLVATAKSYTPS"
     gene            complement(79846..80181)
                     /locus_tag="DEHABAV1_RS00415"
                     /old_locus_tag="DehaBAV1_0075"
     CDS             complement(79846..80181)
                     /locus_tag="DEHABAV1_RS00415"
                     /old_locus_tag="DehaBAV1_0075"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928599.1"
                     /db_xref="GI:500353673"
                     /translation="MTSGMVILAEIRTETEQGRPAPTPGWEWSPGCTPIKDPSPGKWI
                     VRRSIDSFDVIFHSYLTPEAREGGPEYLIDSFNPTDAGELGAREMALKLRKESYRQEA
                     ERNGHSDIE"
     gene            complement(80178..80378)
                     /locus_tag="DEHABAV1_RS00420"
     CDS             complement(80178..80378)
                     /locus_tag="DEHABAV1_RS00420"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377440.1"
                     /db_xref="GI:755024487"
                     /translation="MKLLAVFKQSHFLLAFGIIFLTAGVGGFGRITEWPELIMCILAT
                     LVALYILYAAYKQACKEAEVKK"
     gene            complement(80375..80614)
                     /locus_tag="DEHABAV1_RS00425"
     CDS             complement(80375..80614)
                     /locus_tag="DEHABAV1_RS00425"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377443.1"
                     /db_xref="GI:755024490"
                     /translation="MPQQQVNYRIKNERTGQWWEGKADSPMDALRKSALEYPVKNPKF
                     SWTAENCWVRQWCSGGYGSWVTLTMAAKKMEMVQA"
     gene            complement(80648..80887)
                     /locus_tag="DEHABAV1_RS00430"
     CDS             complement(80648..80887)
                     /locus_tag="DEHABAV1_RS00430"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377446.1"
                     /db_xref="GI:755024493"
                     /translation="MKLTKRDSGRIGGIQTVLTHGTDHMRNIGKLGGRPHATNWLDLQ
                     VRQIQERKEKEGKATDSLTLTQLKHLVKSVVEGGY"
     gene            complement(80874..81119)
                     /locus_tag="DEHABAV1_RS00435"
     CDS             complement(80874..81119)
                     /locus_tag="DEHABAV1_RS00435"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377449.1"
                     /db_xref="GI:755024496"
                     /translation="MNNITVANNLLSALINLQDDLKLSNTAFAAKLGINRQLWQMTKS
                     GIRPIHLTILKAVIRNFPQLIPEVIVHMSIKDGNETN"
     gene            81304..>81531
                     /locus_tag="DEHABAV1_RS00440"
     CDS             81304..>81531
                     /locus_tag="DEHABAV1_RS00440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014296903.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377915.1"
                     /db_xref="GI:755024971"
                     /translation="MQIGLKVKQLRIARGMTQAKLADASGLTRGYISMLELRKSTMPS
                     YEALSKIARALGVDIKEFKTDPEIVRLESPEE"
     gene            82056..83015
                     /locus_tag="DEHABAV1_RS00445"
                     /old_locus_tag="DehaBAV1_0078"
     CDS             82056..83015
                     /locus_tag="DEHABAV1_RS00445"
                     /old_locus_tag="DehaBAV1_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="WP_011928602.1"
                     /db_xref="GI:500353676"
                     /translation="MLSYHLTTSGSHEQPQAKTYHLTNFKNLSGRLNAFVLTCKVARL
                     SPHTIRYYTYALNSFLGYCQTLGINTVEEIEANHVRLYLVKLQERNNPTSVLDYYKAV
                     KRFFNWLIEEGVLSKSPLATIKPPRTEQKIIRPFTRQQIEDLLATCGDSPIGLRNKAM
                     ILTMLDTGLRVSEMSAIQLKDVDFDKETIIVMGKGAKQRVVRIGHKAQETILRYLLTR
                     QDECPALWMSTTGSGLSTEGIKVVVRELGKRAGLTGVRCSPHTFRHTFATQALINGAG
                     EFEVQSLLGHSTLVMTKRYTASLKSEHAVQEHKKFSPVDNMRL"
     gene            83058..83417
                     /locus_tag="DEHABAV1_RS00450"
     CDS             83058..83417
                     /locus_tag="DEHABAV1_RS00450"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377452.1"
                     /db_xref="GI:755024499"
                     /translation="MLSSYAIHRLINKRRKQIYAPRLRWSFKLYRLAKENSRIMAKMG
                     GMHHSSKSEYSECVCTGPLDMSSRDVFNLWVHNPENWGIIRNPYLVQAAASVARNKKG
                     VYITWICRARANLMLSF"
     gene            complement(83602..84609)
                     /locus_tag="DEHABAV1_RS00455"
                     /old_locus_tag="DehaBAV1_0079"
     CDS             complement(83602..84609)
                     /locus_tag="DEHABAV1_RS00455"
                     /old_locus_tag="DehaBAV1_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase"
                     /protein_id="WP_011928603.1"
                     /db_xref="GI:500353677"
                     /translation="MQIISLFSGAGGLDLGFEKAGFNVVWANEYDKTIWDTYQHNFPN
                     TNLDTRSITEIPSTEIPTSDGIIGGPPCQSWSEAGALRGINDHRGQLFFEYIRILKDK
                     QPSFFLAENVSGILFERHREAFSEIIKQFNEIGYNVSYYLLNAHDYSVPQDRKRVIIV
                     GYHVKTELYFTPPKPIAHKPLLRDAIWDLRETAKPGGKTNKSIGNLEFPNHEYMVGGF
                     STIFMSRNRVRSWEEPSFTIQAGGRHAPIHPQAPKMQLVSKDKMEFKPGDQHLYRRLS
                     IRECARIQTFPDNFVFKYAGLADGYKMVGNAVPVEFAYNIAMKISEDLRSYEKRTDTK
                     R"
     gene            complement(84613..85461)
                     /locus_tag="DEHABAV1_RS00460"
                     /old_locus_tag="DehaBAV1_0080"
     CDS             complement(84613..85461)
                     /locus_tag="DEHABAV1_RS00460"
                     /old_locus_tag="DehaBAV1_0080"
                     /EC_number="3.1.21.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction endonuclease NgoPII"
                     /protein_id="WP_011928604.1"
                     /db_xref="GI:500353678"
                     /translation="MATNILTAIAHLVENPNTQLHQHNKSKTRANAMGDSLEEYIKDL
                     FANSLNENDVVKKNEIYNQKFCYFGNQNNPPDFIIKNGDAVEVKKIETMESSLALNSS
                     YPKDKLYSTSNMITDACRTCEPWSIKDLLYAIGTVKDGNLKALWMVYGDCYAADRSVY
                     ERIQTVISDGVNGIEDIQFSPSKELGRVNKVDPLGITYMRIRGMWGIENPNKVFNYIV
                     NIDKNARISVNSIMLKSKYDSFSTLDKAKIASLANKGLGIKDIRIKSPNNPANLLDAK
                     LISFRM"
     gene            complement(85468..85921)
                     /locus_tag="DEHABAV1_RS00465"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            85925..86209
                     /locus_tag="DEHABAV1_RS00470"
                     /old_locus_tag="DehaBAV1_0082"
     CDS             85925..86209
                     /locus_tag="DEHABAV1_RS00470"
                     /old_locus_tag="DehaBAV1_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011928605.1"
                     /db_xref="GI:500353679"
                     /translation="MEENRRKHSPSFKAKVALEAIKGEETIAQLASRFDVHPSQVHKW
                     KKELAEGAVGIFGDERKHQKPDNQQLVSQLYQQIGQLKVERDFLENALGR"
     gene            86206..>87033
                     /locus_tag="DEHABAV1_RS00475"
     CDS             86206..>87033
                     /locus_tag="DEHABAV1_RS00475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928606.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377917.1"
                     /db_xref="GI:755024973"
                     /translation="MNVERRREAVNRNHSSLSVARQCLLLDLNRSSLYYQAKGLADRD
                     LVVMKLIDRQYLATPFYGARKIALELKKQAGLTVNRKRVRRLMQLMGIRAIYRRPRTS
                     TPATGHKVYPYLLRELEITRPNQVWAADITYIPMSRGFLYLVAIIDWYSRYVISWRLS
                     NTLDADFCVAALEEALSKGTPEIFNTDQGSQFTSEAFTALLKEHNVGISMDGKGSYND
                     NLFIERLWRTVKYEEVYLKAYQDGREARISLCKYFRFYNTNRIHQSLGYLTPVEVYAG
                     "
     gene            complement(87298..88329)
                     /locus_tag="DEHABAV1_RS00480"
                     /old_locus_tag="DehaBAV1_0084"
     CDS             complement(87298..88329)
                     /locus_tag="DEHABAV1_RS00480"
                     /old_locus_tag="DehaBAV1_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010937154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377919.1"
                     /db_xref="GI:755024975"
                     /translation="MFGGNGTGIDWHGKPFVVHARGAKGYEWVLENADVSICIARKPE
                     NGRIYPELYVTFRAEYLWSSNARNVVYDLKHWLSTWAIITGDKVSRCDLCIDLQMDMP
                     QINLANDVVTRARGKTEYYGSLPAEHYVNGKRDTGYRFGQGTIISRIYDKSLEVVISQ
                     KEWFQTLWSANGWDGESAITRVEFQCRRDFLKEMGVDDFWSLTERIGDIWRYCAQDWL
                     TIRTPGNDSHRHRWQMTNWWNVIAESFYFFGELYGVLRYKQKKCKYDHLMRQARGVLL
                     TAAALCCVSTGTIHAFTQVNQETAQWFKSDEFRIEVQNRMVQVGGMNEEKLPRLVEEA
                     INLGGQLLR"
     gene            complement(89033..89578)
                     /locus_tag="DEHABAV1_RS00485"
                     /old_locus_tag="DehaBAV1_0085"
     CDS             complement(89033..89578)
                     /locus_tag="DEHABAV1_RS00485"
                     /old_locus_tag="DehaBAV1_0085"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928608.1"
                     /db_xref="GI:500353682"
                     /translation="METDRLIEGVVKIRGYMRCGKTASMVALAVNEIQQGHYSPDKVI
                     SNVSIPSYGIVQKRNTEIIDFLARMKEDQLRGWLILIDEADQLFSHRGYSSKQQSQVL
                     VNVWQAMKLDNMIIYTMHEGLGVDLIFRDATLMSLLPEIVGNKIVIYTIDGRYGGEPY
                     LLEIAPASEVFKLYNTKEAVY"
     gene            complement(89582..89908)
                     /locus_tag="DEHABAV1_RS00490"
                     /old_locus_tag="DehaBAV1_0086"
     CDS             complement(89582..89908)
                     /locus_tag="DEHABAV1_RS00490"
                     /old_locus_tag="DehaBAV1_0086"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928609.1"
                     /db_xref="GI:500353683"
                     /translation="MSYLEDQEKIEIHPSQLGNKNVSSQMLEYSSTNRNCPVALARTL
                     LLCHMTSEVLGISCFHQIADQCERYAHTADTLVRDQAATVAKYEAVALEEKRKQGFMQ
                     FGIGKV"
     gene            complement(89909..90487)
                     /locus_tag="DEHABAV1_RS00495"
                     /old_locus_tag="DehaBAV1_0087"
     CDS             complement(89909..90487)
                     /locus_tag="DEHABAV1_RS00495"
                     /old_locus_tag="DehaBAV1_0087"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928610.1"
                     /db_xref="GI:500353684"
                     /translation="MRDLEIFRPSNRCYVMVNYMDRRILEKGLVTDVTDKGVHFEYKK
                     NGVNHVYHEHADGYHIPQIWNRPLFAHVYGSAVDYDLVTGQAMFDGNMFNQAVNGKIT
                     SDALKEVKGLNKKSSVNLVTILLVVAIAIGGMFVFQNKDKIFTTGNSEPVPEQTIPNN
                     PVYPENPVDNPSDGTEIPEGDYIPTNPPSGGS"
     gene            complement(90480..90710)
                     /locus_tag="DEHABAV1_RS00500"
     CDS             complement(90480..90710)
                     /locus_tag="DEHABAV1_RS00500"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377457.1"
                     /db_xref="GI:755024504"
                     /translation="MIDIGLIITLVIFAVLFIGAILARGSWLLLSACGFLLMSLLPNE
                     AIPQFARIGIGVGMAWCFVWAMMILIRGNDNA"
     gene            complement(90710..91006)
                     /locus_tag="DEHABAV1_RS00505"
     CDS             complement(90710..91006)
                     /locus_tag="DEHABAV1_RS00505"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377465.1"
                     /db_xref="GI:755024512"
                     /translation="MWSNNALLTLSVILVMLLSLVGAHFGVGGVGSYTGGVPIEQPTG
                     IVDAFSTIGDSVAFLWGAVTFQLEGVPVLFNILIFTPIGYILVYIVLKLLRGTE"
     gene            complement(91006..92598)
                     /locus_tag="DEHABAV1_RS00510"
                     /old_locus_tag="DehaBAV1_0088"
     CDS             complement(91006..92598)
                     /locus_tag="DEHABAV1_RS00510"
                     /old_locus_tag="DehaBAV1_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928611.1"
                     /db_xref="GI:500353685"
                     /translation="MYKTKHLKRIIGVISSLAVMLVTLLPGTVSATETLQTKMFTAGS
                     AYEYYADNLNLTWSDLAVSGDPFQTSIANSIMLADHGGTFNNGYTCATATSIADAQNL
                     SQNGDYQQIYANYKRGQSFTALGTGGCQYVTLKIARVGNPGDLQVILYAYGSPTSLGA
                     VLGSITTPQAQIGTTTADYQLPLGNPSITQGQKYVIMAYCPTGNTSNYYKVFDSNSNP
                     YSGGTLISDDGSQVWESNPYDYYFKITRTSGLMALDDYYRNVMYFNLDGLLDTSKIRS
                     IEIVLHQSGTIYHKTKAVLVWNPANLESQTDGRWFMANAYSSTDYNPLGQTDADKGAN
                     GIHTWDIVPTEWDLANQTQWLNSYLDDDNNLRVGMILENAMIGYPSYDSYGNVLWSSG
                     DAYIDEWLSPGCSDIPVGSETVKVEPYIIVNYVNGAFFVPPPETTDISDIIQIIPNFI
                     NNIGEQDSGVRWLIMLAAVAAAIALCWRVQIMAIVTPLLVVGAFIAMGWIDIWLVLLL
                     AALGAFIIWQTAGGKRLVGGDG"
     gene            complement(92675..93010)
                     /locus_tag="DEHABAV1_RS00515"
                     /old_locus_tag="DehaBAV1_0089"
     CDS             complement(92675..93010)
                     /locus_tag="DEHABAV1_RS00515"
                     /old_locus_tag="DehaBAV1_0089"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928612.1"
                     /db_xref="GI:500353686"
                     /translation="MVKLLKRIKHAMSIEQMVNGIPLKKQAAQWLDNLVTCQTGSMNI
                     GGLVMLFMAALMLMALTPSLVDANAVIQTDTGSGDMVKMIMNLLVWAIPLGGGVGIIM
                     AAINLFKND"
     gene            complement(<93201..93422)
                     /locus_tag="DEHABAV1_RS00520"
     CDS             complement(<93201..93422)
                     /locus_tag="DEHABAV1_RS00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013560636.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041331652.1"
                     /db_xref="GI:752683702"
                     /translation="MKIHRARVTKEPVMTYTPTGKAVTRFSVSYGGYWDKEKKEETVA
                     STWKNIKCWGTLAENTYRELKKGQFVYLEG"
     gene            complement(93499..93825)
                     /locus_tag="DEHABAV1_RS00525"
                     /old_locus_tag="DehaBAV1_0091"
     CDS             complement(93499..93825)
                     /locus_tag="DEHABAV1_RS00525"
                     /old_locus_tag="DehaBAV1_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_851036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928614.1"
                     /db_xref="GI:500353688"
                     /translation="MAVYIVVFETVFGYIIGNSVVFITFGCEMKQKLTNKEIGRLGGL
                     KTVALYGREHMKELGKLGGRPRLPTLQEIRDRKAKASNINNNKGVATGGYSLKELKLM
                     WASRTA"
     gene            93922..>94110
                     /locus_tag="DEHABAV1_RS00530"
     CDS             93922..>94110
                     /locus_tag="DEHABAV1_RS00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002493858.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377924.1"
                     /db_xref="GI:755024981"
                     /translation="MSNLGLIIKELRERRGWPQTELADRAGISRSSLATIEIGRSVPK
                     VETSIKIAKVFGMTVEELY"
     gene            94710..95195
                     /locus_tag="DEHABAV1_RS00535"
                     /old_locus_tag="DehaBAV1_0093"
     CDS             94710..95195
                     /locus_tag="DEHABAV1_RS00535"
                     /old_locus_tag="DehaBAV1_0093"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377471.1"
                     /db_xref="GI:755024518"
                     /translation="MRRLPGNIQRILTKDEEVLDQFNLKGSLGSPRQKVYCTNKRIIV
                     SEHGAVLFGSHLFDADYNHISSIDLKTQPRIALLFIATLLILFSIPFWRNILGYTDGS
                     YMILATMFTASGFIFVLIAFIFRTYRLEIFTTGRNKPIAIKSSRIDLEQILMFTRERR
                     L"
     gene            95226..96302
                     /locus_tag="DEHABAV1_RS00540"
                     /old_locus_tag="DehaBAV1_0094"
     CDS             95226..96302
                     /locus_tag="DEHABAV1_RS00540"
                     /old_locus_tag="DehaBAV1_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011956222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928617.1"
                     /db_xref="GI:500353691"
                     /translation="MKGLPLNVKDSLTKANESALAAVSLYNHPGIPFRSGGYIVLMII
                     AWTSLFHAIFFKDNKKPFYMDTKKSHGKYIRYQKIDGENKAWELTTCLKEYYGNENPS
                     ERDNLRFFLGLRNKIEHRSMPEIDEQIFGECQAMLFNYESTVAKNFGYKYAINESLSM
                     SLQFSAAYNSQKKEALRKLHSKTYKNIIDYMNDFRSSLSSNSLESMDYSYKVFLIPKT
                     ANHSNTADFVSEFINPNKLTNEARAKLKEVLILFKDRNSGDINQNNYRASFIKENVQR
                     KLGQKFSMKDFVTCYKHFKIRPNYGAEIKEPIISKYCAYDLAHGDYVYKPALVEFLVS
                     ELSDEKKYENILGRKPIPISSNIL"
     gene            96364..97416
                     /locus_tag="DEHABAV1_RS00545"
                     /old_locus_tag="DehaBAV1_0095"
     CDS             96364..97416
                     /locus_tag="DEHABAV1_RS00545"
                     /old_locus_tag="DehaBAV1_0095"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928618.1"
                     /db_xref="GI:500353692"
                     /translation="MKLNKELETENIQSAKEWLEQANQDFSVFQKLVHLHFEFDTNIK
                     CNYPANAVSLLQQTIEKSIKAVAAATGEYNEEETIKTYGHNSAALILDILSKMIIQAD
                     FLDLNAIARLNNIDISVKLPELITLKNQVKKGILVSKDNKKVDIRSEVINLSDSQINS
                     VLMMLITIRNYILKIVDVTFESLKKLGINNYKIRIKDQELFLKALSDLIYKEFNQNPL
                     SDKQIKILLDSLSVIEITNSSDNTAKHKNFEIIRKREFTHLFLGVWAIISLVLLGYIT
                     FGHESSSRYPSQKSKGIKTSEVGCNDYNENMGIVRRLSQIGYLTDLLLKELSGYIDTV
                     ALLFAMEKDNFSNKRS"
     gene            97461..97943
                     /locus_tag="DEHABAV1_RS00550"
     CDS             97461..97943
                     /locus_tag="DEHABAV1_RS00550"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377473.1"
                     /db_xref="GI:755024520"
                     /translation="MGFLKSIIDTYLDYCVKNASDIKDKSFDDYKREIIPTGIMTCFI
                     VSWAMYLCIQQGVFDQLKFYLILIGTLVFWGIGELLVLLSVKDFREDSKSIPQIWLLG
                     IFLMLAVIMQAFIAREYYDVLVIIDIATLVLFKLYLDIITYRYLKVKVLEGKLSIPLK
                     "
     gene            complement(97959..98744)
                     /locus_tag="DEHABAV1_RS00555"
                     /old_locus_tag="DehaBAV1_0096"
     CDS             complement(97959..98744)
                     /locus_tag="DEHABAV1_RS00555"
                     /old_locus_tag="DehaBAV1_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_011928619.1"
                     /db_xref="GI:500353693"
                     /translation="MTARQPGNIHPRTIPSQYLLSGLAFCGCGASLTGHSAKSGRHFY
                     YQCNRKFKQGNEVCNGQAIPKSKLESAVITQIKSRILTEENLENLVSLVNKDLELASV
                     QYNERLAVIDTELEDIRQRLNRLYEAIESGKLDYSDLSPRIKDLRSRQSDLEKSRIVA
                     EAELLASGSESIKIEQVKAYAGDLKQLLAEAEISECKAFLKTFVKKIEINGNKATLKY
                     RLPLPGLKNGKEVLPIETLGGAEGIRTLYLLTASYGSSKQPMH"
     gene            complement(98940..99575)
                     /locus_tag="DEHABAV1_RS00560"
                     /old_locus_tag="DehaBAV1_0097"
     CDS             complement(98940..99575)
                     /locus_tag="DEHABAV1_RS00560"
                     /old_locus_tag="DehaBAV1_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="WP_011928620.1"
                     /db_xref="GI:500353694"
                     /translation="MKVALYARVSSEAQDVELSIAAQLRALRDYAAKNEQQIVYEFID
                     EAESGRTASRPEFKKMIALAKSNTSPFEAILVWKYSRFARNRVDSITYKTLLQKKGIK
                     VISINEPLDDTPTGKLMEGIIESLDEFYSANLGQDIKRGMKENALRGFFNGSQPPLGY
                     RIIKVKDGPKQRNRLEPESDTSSGIKTVRHIFSLADKGQGCKEIAVTLNRE"
     gene            complement(99572..100531)
                     /locus_tag="DEHABAV1_RS00565"
                     /old_locus_tag="DehaBAV1_0098"
     CDS             complement(99572..100531)
                     /locus_tag="DEHABAV1_RS00565"
                     /old_locus_tag="DehaBAV1_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928621.1"
                     /db_xref="GI:500353696"
                     /translation="MPRKKAPSIKETREWLDLYESGWSEALLAQRKGRDIRTIRRYLA
                     KAQDERRLDLVESELIKSALAKHQEQLLLTLDNLYSAIALPEPYLSLNSTGNNGRIEL
                     NSGRVVVTQVAESTGVAVHLESEDSVLFSLVEEHLDHDLLFLMLNEWKSKLENYVRAC
                     SYIKESRTERLSRRGADERSYNIKEKSADEQICKSICMSDLSEFIYKNSLNYIIKNDK
                     SVLTKARERLAINKERGELILKPGNTLLSCPGKEAEYLQKTLELLTEESLQEHKGPIQ
                     QAYRKLEDETSKLKKVIEEIKLCNFIPGECRVCRRLKGQGGLR"
     gene            complement(100821..101420)
                     /locus_tag="DEHABAV1_RS00570"
                     /old_locus_tag="DehaBAV1_0100"
     CDS             complement(100821..101420)
                     /locus_tag="DEHABAV1_RS00570"
                     /old_locus_tag="DehaBAV1_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928623.1"
                     /db_xref="GI:500353803"
                     /translation="MEDILVIKFIRSVATGLLIIMAGLALLNWVNSSESDNPISSTVA
                     YIPTKSSILQSPLALDSLKTSAHYADGYVFLDFYDPYRLSNYLNKYDYSETHQPYAEG
                     ERYGMYFSDVFYLVPGDNLKIVIYSDVPLGTDLACEISEYKNNGVSGSTPAYTVERYE
                     NGYRAIISCHATESGEYQFKLWHRDKSQSERCAIVFYFE"
     gene            101503..101718
                     /locus_tag="DEHABAV1_RS00575"
                     /old_locus_tag="DehaBAV1_0101"
     CDS             101503..101718
                     /locus_tag="DEHABAV1_RS00575"
                     /old_locus_tag="DehaBAV1_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011928624.1"
                     /db_xref="GI:500353838"
                     /translation="MTKKTIEQRFGERIRVLRKKAEISQEELAFRAGVHRTYLGGIER
                     GERNPSLKNIEAIAKALEVPISDLFIN"
     gene            102112..102354
                     /locus_tag="DEHABAV1_RS00580"
     CDS             102112..102354
                     /locus_tag="DEHABAV1_RS00580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377485.1"
                     /db_xref="GI:755024532"
                     /translation="MSIEPSEEDKKAIEIARRFNIRLGTLKCTVFDLFEHGYLCHEVK
                     FILNNSIGDPYDKIIYKRETIRMYYSEWESKKQKMH"
     gene            complement(102397..103161)
                     /locus_tag="DEHABAV1_RS00585"
                     /old_locus_tag="DehaBAV1_0102"
     CDS             complement(102397..103161)
                     /locus_tag="DEHABAV1_RS00585"
                     /old_locus_tag="DehaBAV1_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308706.1"
                     /db_xref="GI:499627972"
                     /translation="MLQELKTDTYKELGCFHGVRAGIAYHKALGVSTNTLVIELPEER
                     NILSTRTGLGKAKYILNTHIPPELWDFMHDNSADWQTAYSVVLEEVLKRYDTDLDNVS
                     FLSTGVDQDNIAWAEETYEEFWVLAFATAGVKTNAMRIGCDEASGIERNGKFEKIGTI
                     NVILLTGSSLETPTLASSYITLTEAKNVALQELDIRSAAHPDWQATGTGTDQIITVSG
                     TGGKYTYVGGHTKLGEMMARATTRAVKQAIRNCRGY"
     gene            complement(103248..103544)
                     /locus_tag="DEHABAV1_RS00590"
                     /old_locus_tag="DehaBAV1_0103"
     CDS             complement(103248..103544)
                     /locus_tag="DEHABAV1_RS00590"
                     /old_locus_tag="DehaBAV1_0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011308707.1"
                     /db_xref="GI:499627973"
                     /translation="MWSLYTMIWMLIGIALGVGFTALVNMLNKRGISVRFYEWLIGIT
                     GLVLFLFTIQNFYTAFQEFYTKAAWMFLLVTGIPAVILLAISWQLVSRRVSNKA"
     gene            complement(103582..105129)
                     /locus_tag="DEHABAV1_RS00595"
                     /old_locus_tag="DehaBAV1_0104"
     CDS             complement(103582..105129)
                     /locus_tag="DEHABAV1_RS00595"
                     /old_locus_tag="DehaBAV1_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011308708.1"
                     /db_xref="GI:499627974"
                     /translation="MSAFHSTLSRRDFMKAVGLAGAGIGAASAASPVFHDLDEASQIG
                     GVAEKRPWYVRELEYAKPTVEIDWNMIQRQTHYNNWEDHLDQTEKDNRAHMYYDNTKK
                     MVLENNPGNTMFDVAIRHPAWTAVRRNMDYFFGVEGIMKDTPPGFEMGFDPESGHCMM
                     SPVWATDLFGIITPGNMGVPRWEGTPEQNAALIRMAARWCGGAEVGYLKADEYTKKLV
                     HKTCGILPILADKNGREVVWENVDQPYETDKKLVIPEKCDNIIVVTIREERNPALMAP
                     SYRADATTAKSYARSIAFDIHFRGFLHAIGYTSAGSGWGPWNNVPFGVLSGIGELGRM
                     RGQITPSCGPLIRKVEVFFTDLPLPPTNPIDFGANRFCRDCGLCAKACPASAIPTFRE
                     PTYDITPADDANSNPTKLHPEYFNLSGKKVWPNNDFACHNFWVTSGKHGCAACVASCV
                     FSKDIKSSIHEVVKGVVSQTGMFNGFFANMDHAFGYGIVSDQDMWNNFWFEPDKYWPL
                     EGIDTNL"
     gene            complement(105240..106106)
                     /locus_tag="DEHABAV1_RS00600"
                     /old_locus_tag="DehaBAV1_0105"
     CDS             complement(105240..106106)
                     /locus_tag="DEHABAV1_RS00600"
                     /old_locus_tag="DehaBAV1_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP binding protein"
                     /protein_id="WP_011928625.1"
                     /db_xref="GI:500354069"
                     /translation="MNNFDLSPSRTGILEDNTRFYGNSEASLSLKSPITEYSLSPNAN
                     NLTNLPWQPGAVNQRVLVSWSGGKDCCLSCYLAMLAGLDIRCLLSVIDHTGRLGAHSL
                     APQILHAQAEAIGIPLVTRQVRVSEYDADYCRVVKELKEQEGISGGVFGDVNIGNSEA
                     ELHETWVKRIGNSAGIQAHLPLWNINRENILRMLISYGFEVLMIVTDNSELGKEWLGR
                     RIDMETLAELKSRYESSENGRVGYYHTLVVDGPIFQKKLQIEKTSRIFKEDEWGANWY
                     LDIEKCSLSSKH"
     gene            complement(106418..107101)
                     /locus_tag="DEHABAV1_RS00605"
                     /old_locus_tag="DehaBAV1_0106"
     CDS             complement(106418..107101)
                     /locus_tag="DEHABAV1_RS00605"
                     /old_locus_tag="DehaBAV1_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011928626.1"
                     /db_xref="GI:500354181"
                     /translation="MKIVIIEDEEEIVKILKLTFQIRWPSAEILAANYGSKGIQIVEK
                     ESPDLVILDLGLPDMDGFDVLDQIRAFSSEVPVLILTVTNDEHCIVRALESGADEYII
                     KPFHQLELLSRVKVLLRRRLMDSEEVAINVGPFRLSKYSNTLMVDNRRLILTNTEKII
                     MSHLLSNAGNLVPATLLAEAIWGHNYTNAKDAVRVHIWRLRRKVEPNPQTPCFIITVS
                     HLGFKLALS"
     gene            complement(107082..108308)
                     /locus_tag="DEHABAV1_RS00610"
                     /old_locus_tag="DehaBAV1_0107"
     CDS             complement(107082..108308)
                     /locus_tag="DEHABAV1_RS00610"
                     /old_locus_tag="DehaBAV1_0107"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011928627.1"
                     /db_xref="GI:500354234"
                     /translation="MSDNSKGDSILNSQISQSQVESMLFRCFAEELNDIVWEGSNTIA
                     VTFVNSKVYDIWGYKPEELIGKNFLDFMVPSKREEQKKVIDSMVENKAAVNGIHLYYQ
                     HRNGKTLIFETRAKPILDNNGKCVGHRGIFRDVTNYILQEKRLQKLYKQEKAAFTELE
                     NQMQQRLEFTRALAHELKTPLTVIQAANELMGTQILSPELTNISDSIARGVQSLQKRV
                     NELLDLAKGEVGILTVNRKLIKTLPYITNLINDLKPMVKMRNRNLLTNIPNSLPNICA
                     DEQRLTQIISNLVDNSIKYSTEKAAITISVRQDTNLDNILFQVTDTGFGIPPDKQIEI
                     FNPYARIRKAEEHTTGLGIGLSLSRTLVELHGGQIWFETSEGIGSSFYFTMPKYARKR
                     MITAVKKRQPDENCHN"
     gene            complement(108405..109889)
                     /locus_tag="DEHABAV1_RS00615"
                     /old_locus_tag="DehaBAV1_0108"
     CDS             complement(108405..109889)
                     /locus_tag="DEHABAV1_RS00615"
                     /old_locus_tag="DehaBAV1_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011928628.1"
                     /db_xref="GI:500354262"
                     /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYIASVLERAGHEVRIFD
                     NVVSELTPPDYAKDFAPEVVGFSVLTGPCIGNALVQSKEFKALLPGVKVVWGNVHATC
                     TTEQTLKEEAIDFVVRGDGEYTFLDLIDHLEKGEENYAEIQGLAWKDREGRVTINQPR
                     PFIHNLDELPNPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHHGHRADLSVERI
                     VAQIEHLQKNYKVKFIRFFEDNFTFNRKRMREFCQTVIDRRIKIKWDTESRADMSEED
                     VALMAKAGCTSVGIGVETGSKRMLEYLNKGVDLDEMGRTFWRFVKHGIMPRLYIMLAV
                     PTETVEDFTETQDMLHRMEDPPFMYMRFVPYPGTPLYNQLVQDNRIKPPESLGEWAKF
                     SVYFATKGNLSELSDEVINQAISHWAHSYASRRVMFTLRHNPRYLLSAVKNPAEFFKA
                     VSSLIKNSLPVVFNKNTNIKPLVLEAVPNKMHGKQEPRLISNYE"
     gene            complement(109912..110661)
                     /locus_tag="DEHABAV1_RS00620"
                     /old_locus_tag="DehaBAV1_0109"
     CDS             complement(109912..110661)
                     /locus_tag="DEHABAV1_RS00620"
                     /old_locus_tag="DehaBAV1_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011928629.1"
                     /db_xref="GI:500355048"
                     /translation="MKVYHLIYEPSYKSAVFHHWTECNLDCKGCFCRVEKLDFGLFPD
                     ALERLKDKAPETAPTDFLESPEEALKLLEGCELERAVFIGTEPALDPDLPALAKALHQ
                     KYGSYNVLLTNGVRLCDLSDIDEIIFSLKAVTNAIYQDYTGRSNEKTLDNFKKVHASG
                     KKLQAECLLIPGLIEADEVEKIAKFIATVDKDITLRIDGYFPIPGCPWRGATPKEVTE
                     ASQRAGKHLAKVNYLSADLPRQGEKPLRLFG"
     gene            complement(110658..111404)
                     /locus_tag="DEHABAV1_RS00625"
                     /old_locus_tag="DehaBAV1_0110"
     CDS             complement(110658..111404)
                     /locus_tag="DEHABAV1_RS00625"
                     /old_locus_tag="DehaBAV1_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP binding protein"
                     /protein_id="WP_011928630.1"
                     /db_xref="GI:500355049"
                     /translation="MTEVIVSWSGGKDCTLACYKAIKSGLKVRYLASIITRSTGKLWP
                     HLLTPEVLRMQAEAIGIPLLEWPSATEGYDDNYRRMLGQLKTEGVEGVVFGDVNIGNS
                     FAVKHLNWIKSVCEPTGMDYHLPLWQDNRATLLSELIDLGFEVRILAADSTELGESWL
                     GRKLDKDMLAELKIRHSLSPNGNVGYYHTFVTDGPLFKSRLVIEEWGRVFDEQAQFGG
                     MGVWYMDIKRCRLESKAKPETLVLLSAEAL"
     gene            complement(111488..111757)
                     /locus_tag="DEHABAV1_RS00630"
                     /old_locus_tag="DehaBAV1_0111"
     CDS             complement(111488..111757)
                     /locus_tag="DEHABAV1_RS00630"
                     /old_locus_tag="DehaBAV1_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011308715.1"
                     /db_xref="GI:499627981"
                     /translation="MWFFIGLIIGVALLALVLWLKRKVIRLSWYDWVIGFIAFIFGVL
                     AVQHYMASVSHGELKAGLLGLGIFGVIAIVLALLDWQLIARRKKV"
     gene            complement(111779..113299)
                     /locus_tag="DEHABAV1_RS00635"
                     /old_locus_tag="DehaBAV1_0112"
     CDS             complement(111779..113299)
                     /locus_tag="DEHABAV1_RS00635"
                     /old_locus_tag="DehaBAV1_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928631.1"
                     /db_xref="GI:500355050"
                     /translation="MSQFHSILSRRDFMKSLGLASAGIGAASLGGVNATAPFFHDVDE
                     ITSSPSAITKKPWWVKLQDKPTVPMDLSLLEPGRTKVWCMPPDDPSGPVTLRAPGYSE
                     EETRQKFTDYFKKEWGTWDPGPTMEGFGDFPERTTEHIGPIRDNALLAGLMPFLFGKL
                     PDEIIAAEKGQYLSYLLDKPCGWRYAAPLEQRGGTKWQGTPEENLRTVRAAARFYGAD
                     DVGAIEVDEDFLRVMWGVSRFPFIPVPVQFEWGDVDDFVPTPSATRPTKIIIPRRCKY
                     FVHWTMRQPPSRLKHDSGTQQGPSQGWTYSRNPMVNVNIQEFLWGLGYIALTNWSGYL
                     IPTGYAGVASGAGELSRWSGVLTPKFGNQVRGMYGFLTDLPLAPTKPINFGGYEFCKT
                     CGICADACPMGAIQKGEPSWDASEIWQNPGYLGWRLDLTKCSHCPVCQGVCPFNTTDD
                     SFVHNLVKGTIPNVKLFNGFFANMERDFGYGRKPYEDWWENAADGKEPVFGIDSTQ"
     gene            complement(113374..113946)
                     /locus_tag="DEHABAV1_RS00640"
                     /old_locus_tag="DehaBAV1_0113"
     CDS             complement(113374..113946)
                     /locus_tag="DEHABAV1_RS00640"
                     /old_locus_tag="DehaBAV1_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_042377495.1"
                     /db_xref="GI:755024542"
                     /translation="MSYSEQTYWQLMAAEYEAHVAQIGKQQPNAASTNVSKCIRCGLC
                     CYQYPCIPRPEEIEPIAQYLELTTLDLINKYMVINTADCKVYFLRWAKHGEEDLTGKM
                     IPPARTFDRGYCVFYDQKSRSCCIHPIRPQEARVIKCWEKNNGMDKSLWGITGWNSQD
                     ILRFLPDFSPRIYADNKYLPPKSSMPPRKY"
     gene            114086..114973
                     /locus_tag="DEHABAV1_RS00645"
                     /old_locus_tag="DehaBAV1_0114"
     CDS             114086..114973
                     /locus_tag="DEHABAV1_RS00645"
                     /old_locus_tag="DehaBAV1_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011928633.1"
                     /db_xref="GI:500355052"
                     /translation="MKRPPKVYFKNESINTNKYLVTLFKIHQPQNPNSCDIIQCVRDS
                     RFKSLQPNAKQFTIVNKLLLNDIRDYIFILDMDGKIMFVNEQACKARGYTQEELIGRS
                     ILELDTPETAALAFQKIQEAKEKGFALHNIAHKCKNGAIKISELLTRIVEIEGKEYVF
                     GLAKDISEVQARVAAYVNAQEKEREWVSIEIHDRVIQNLTGISHKIDALSSAKESCVS
                     KQIELKELSKQMQASIAEARNIMRELYPNTLARYGLIKLIQEELARLQDELNCNTSLN
                     NSIVNLIPPYLETTMTCPR"
     gene            complement(114986..115684)
                     /locus_tag="DEHABAV1_RS00650"
                     /old_locus_tag="DehaBAV1_0115"
     CDS             complement(114986..115684)
                     /locus_tag="DEHABAV1_RS00650"
                     /old_locus_tag="DehaBAV1_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_042377497.1"
                     /db_xref="GI:755024544"
                     /translation="MVADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEG
                     LRVPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTR
                     ECLAITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTL
                     FIEPGSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGY
                     RPPAPEAIMAVVTT"
     gene            complement(115822..116100)
                     /locus_tag="DEHABAV1_RS00655"
                     /old_locus_tag="DehaBAV1_0116"
     CDS             complement(115822..116100)
                     /locus_tag="DEHABAV1_RS00655"
                     /old_locus_tag="DehaBAV1_0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010937184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_010937184.1"
                     /db_xref="GI:499239644"
                     /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYR
                     WRQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
     gene            116303..116575
                     /locus_tag="DEHABAV1_RS00660"
                     /old_locus_tag="DehaBAV1_0117"
     CDS             116303..116575
                     /locus_tag="DEHABAV1_RS00660"
                     /old_locus_tag="DehaBAV1_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377505.1"
                     /db_xref="GI:755024552"
                     /translation="MEDEPSEVVKSARFIGWDTDSHKCLTERIVHGCSTCQAICPWSK
                     PDTIIHEIGRTFGQNKALAPFLVKLDDFFYGSKPEGYDVATWAPWR"
     gene            116611..116883
                     /locus_tag="DEHABAV1_RS00665"
                     /old_locus_tag="DehaBAV1_0118"
     CDS             116611..116883
                     /locus_tag="DEHABAV1_RS00665"
                     /old_locus_tag="DehaBAV1_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928636.1"
                     /db_xref="GI:500355055"
                     /translation="MTLILLLVGVAMGIFGTWLWNAKNKKNIKLTFIEYLLLAFAVII
                     FSAGVLFVKTFVEESETNVALMSGLVSSITALILLATTWQLVKRHN"
     gene            complement(117096..118538)
                     /locus_tag="DEHABAV1_RS00670"
                     /old_locus_tag="DehaBAV1_0119"
     CDS             complement(117096..118538)
                     /locus_tag="DEHABAV1_RS00670"
                     /old_locus_tag="DehaBAV1_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928637.1"
                     /db_xref="GI:500355056"
                     /translation="MTKSGFDVIKADAMANIGTNFKDLDELKSDSLAVEKLPWWIKQK
                     EFWDFTTEMDWSAQKPFEYSIRNFNQHLSPKQAKQYNSRYTQVMEWRKTSKVPGFTHR
                     DYAMKCGANTITLLSDLAGIDKNGESALYWTGSPKLMDVTPTPEEMGCPKYEATPEEN
                     LLMIRTFLKVCGASKVGAVPVDVKFKSTQPKFYADKIPLVYENVDKPYITRSKYVIPD
                     RMKWAIVFSTEGGNDLTGRGNNWVGALGASLYSGGPSDYIQIQVQRFLKALGYSSVVS
                     GICYNLQNWPAMGVASGMGELGRMQISVSPFLKWDRAIRCIITDLPVSFTLPIDAGIT
                     RFCIDCGRCASVCPVSAINSSRESSWDIWPKDPKNPNLRPELFNNPGKKTWYFGHHLC
                     GAFGRDANDSKCGICMLNCVFNRGTDTILYPFIKPVGANKSALANFLKDMKKNFSCTG
                     FESSMPLGEEDQYTLAGESLVENFWNQDSS"
     gene            complement(118864..119136)
                     /locus_tag="DEHABAV1_RS00675"
                     /old_locus_tag="DehaBAV1_0120"
     CDS             complement(118864..119136)
                     /locus_tag="DEHABAV1_RS00675"
                     /old_locus_tag="DehaBAV1_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928638.1"
                     /db_xref="GI:500355057"
                     /translation="MWLLLGILIGIIALGIIWWARKSNTSLQWYDWVISLAGLAMLLF
                     TVQNYFASVAEGESKAASMFLLVAGLPALILLAVVWQLVIRRVKKA"
     gene            complement(119160..120704)
                     /locus_tag="DEHABAV1_RS00680"
                     /old_locus_tag="DehaBAV1_0121"
     CDS             complement(119160..120704)
                     /locus_tag="DEHABAV1_RS00680"
                     /old_locus_tag="DehaBAV1_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011308832.1"
                     /db_xref="GI:499628098"
                     /translation="MNKFHSSVSRRDFMKGLGIAGAGLGAAAATVPVFHDLDEAVSAP
                     VAGGFRRPWWVKEREYEDPTCEVDWSQIERSDNSWIMHGVRNGVKGGYLFAGQKYLDW
                     QKEGSDRAFNGVKNNEPGLTLRDMALEGGASPLLMGLNKVVNFVLPEIDQDQVLAQFG
                     FTAAAWPNASSFWVASAPPDFWGVPKWQGTPEENSRMLRSAMRFFGASEVRFAELNEK
                     TKKLIFTHHVHNTPIVFEDVDKAYEVAGQKFVLPDKPLYIVSVAVQMSKEMYRQGNAG
                     IRFAANNMRYRLNNVVQVATQSFLKGIGYQGIGYPSESLFHGMMPSQADAILTGFAEM
                     ARNNNYCISPEFGTVAGYYSILTDLPLAPDKPIDAGYFRFCHTCRKCAEACPSQAISF
                     DSEPTWDIPPSSVDPAKATLYSTPGKKVFHTDSPACYSRWIGLHGCARCMGTCVFNTN
                     SSAMVHDMVRATIGTTGLFNGFLWNADKAFGYGLIPPEKWEEWWDKDYPVLGQDSTIG
                     SYYGGY"
     gene            complement(120715..120942)
                     /locus_tag="DEHABAV1_RS00685"
                     /old_locus_tag="DehaBAV1_0122"
     CDS             complement(120715..120942)
                     /locus_tag="DEHABAV1_RS00685"
                     /old_locus_tag="DehaBAV1_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308831.1"
                     /db_xref="GI:499628097"
                     /translation="MTVTNLYRNFIIYNRKYILLLLGCWYTPLKRLFPATLIIGFIIS
                     GKGVQVNKNGGENGIKDVVPLGKPQIFMVLI"
     gene            120990..122270
                     /locus_tag="DEHABAV1_RS00690"
                     /old_locus_tag="DehaBAV1_0123"
     CDS             120990..122270
                     /locus_tag="DEHABAV1_RS00690"
                     /old_locus_tag="DehaBAV1_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011308830.1"
                     /db_xref="GI:499628096"
                     /translation="MKMPSPERIGTADYCSQIVKIMQHNTLVGITIVDQKMHQIIRVN
                     QALCKMLGYRKKELLGKTMFDITHPDDMEISYKHAMKIWDDEHCYSKIIKRYSKKDGG
                     FIWAESEGFLLKDNADNGILSVTFIKDITKETTLSSSTPLSISSNPASSSQENPDIDV
                     NKLLSDEINKRKLIYNQLMVSYENEKKLRKRIQTEMKSRLEFTRIVVHDLKTPLTSII
                     SSSGVLSNIAADGKYKALASNIYESTMNLNIRLDELLDMAQCEVRDPKLNKSRFNIKE
                     MLEHIISIQQEICNTNHIVFNIVIAPEVTFIIADEDRLKQILDNLIDNAIKYSADSGI
                     ISINISHDQNNVLFSISDSGIGIEPGEIKNIFKPYYRVENRQRKLQGLGLGLSIVRTY
                     VKLHGGRIWVESECGKGTTFLFTIPQPPSKATPA"
     gene            122267..122944
                     /locus_tag="DEHABAV1_RS00695"
                     /old_locus_tag="DehaBAV1_0124"
     CDS             122267..122944
                     /locus_tag="DEHABAV1_RS00695"
                     /old_locus_tag="DehaBAV1_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011308829.1"
                     /db_xref="GI:499628095"
                     /translation="MKLLFIEDDKKIVESIFLLFKSFWPDMETKAVHLGKTGIETAYK
                     EDFDIAIIDLGLPDIDGINVLKQIRAFSSLPILILTARNNEQEIFTAFELGADDYITK
                     PFQPLELIARVKSLLKRLSRASQDLGVKYGHWKFGTSLKEISYNNIRVNLTVTEGQLL
                     HILLTKAGSTVSYADISKSIWGRNEYYAKETIKTHIMRIRQKLSRIDNSKEFIINIPG
                     VGYQIVE"
     gene            123332..123655
                     /locus_tag="DEHABAV1_RS00700"
                     /old_locus_tag="DehaBAV1_0125"
     CDS             123332..123655
                     /locus_tag="DEHABAV1_RS00700"
                     /old_locus_tag="DehaBAV1_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011928640.1"
                     /db_xref="GI:500355059"
                     /translation="MYCSKCGKQVDDSVSFCPACGNQLHTSGTTATEYPERKSRIAAG
                     LLGIFLGSIGVHRFYLGYVGIGIAQIIVSFVTLGIGSIWGFIEGILILTGSFQYDAKG
                     IPLRD"
     gene            123743..124000
                     /locus_tag="DEHABAV1_RS00705"
                     /old_locus_tag="DehaBAV1_0126"
     CDS             123743..124000
                     /locus_tag="DEHABAV1_RS00705"
                     /old_locus_tag="DehaBAV1_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308827.1"
                     /db_xref="GI:499628093"
                     /translation="MPKIGPIEIIIIIILIMIPVGLIWGLIYLFNKLNKKKITGRNMP
                     LDIIEINKGVQYCTRCGQKLEANIQFCPVCGTEKLHAPKIP"
     gene            124013..124354
                     /locus_tag="DEHABAV1_RS00710"
                     /old_locus_tag="DehaBAV1_0127"
     CDS             124013..124354
                     /locus_tag="DEHABAV1_RS00710"
                     /old_locus_tag="DehaBAV1_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308826.1"
                     /db_xref="GI:499628092"
                     /translation="MVRLIIGILLGLWGLPVLVFSIQNLIGSLSETEPQVAGMFFFVT
                     GLPALVMLLGAFLLIRSYLKNPSKPAHPVQSRLSTPDSQNTSGQYCTKCGIGLAADVV
                     FCPNCGQKITP"
     gene            124563..125747
                     /locus_tag="DEHABAV1_RS00715"
                     /old_locus_tag="DehaBAV1_0128"
     CDS             124563..125747
                     /locus_tag="DEHABAV1_RS00715"
                     /old_locus_tag="DehaBAV1_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928641.1"
                     /db_xref="GI:500355060"
                     /translation="MPRKTTLIIGGGAAGMVASISKARRGEPVMILEKTAQLGKKILA
                     SGNGRCNLLNEALDSSSYNPEARPLVNSVFSRFGRDDILNFFSELGLHYYSQDGRIFP
                     FTNQAASVQKVLALEIKRLGVQVEYGFDCVSIQKTQTGFSLGAADGKQQTGHSLILTG
                     GGSTYPSFGSDGSGYKLASSLGHRIIKPVPSTVPLVVKDPLCHLLQGQRIIARAQSRI
                     QGKIGNPVDGELLFTKYGLSGSLILDISQEISLAINRLNIKDVSLETDLIPFMEQKQL
                     ETELTNRHKMGLTPEDMLTGILPGKLCLAFKQLFEKENPSKAAVKLKNWRFEVSGTRG
                     WNEAEFTAGGIDTKEVDPQTLESKLVKGLYLAGEVLDVNGKRGGYNLGFAWASGYVAG
                     LS"
     gene            125873..126727
                     /locus_tag="DEHABAV1_RS00720"
                     /old_locus_tag="DehaBAV1_0129"
     CDS             125873..126727
                     /locus_tag="DEHABAV1_RS00720"
                     /old_locus_tag="DehaBAV1_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928642.1"
                     /db_xref="GI:500355061"
                     /translation="MKSFKVIAPLISLLMLLSLALGGCSSGTADNDSPDTNNLPVSDT
                     TPTGSQLIASILAASPNITSFDTTSVIDMTMQVSGMSIKTVMTANGKEDLSSKKAYLT
                     SSIIMTGDLASTMEMETYLIDSFQYFRITSTDQNTGMQLNTWYKMLMDTQMQTQTWNS
                     QSQQNNYLFSKSSITVDGSETINGTSCWKVTITPDLTELIKYLNEQQAIEDPSAITNP
                     ADSLKNIKLTAWVAKDTSYVIKMNMSMDMLIEAQTLSMVMSTTITNINQPVSITLPPE
                     AVNAIQVG"
     gene            126861..128852
                     /locus_tag="DEHABAV1_RS00725"
                     /old_locus_tag="DehaBAV1_0130"
     CDS             126861..128852
                     /locus_tag="DEHABAV1_RS00725"
                     /old_locus_tag="DehaBAV1_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_042377926.1"
                     /db_xref="GI:755024983"
                     /translation="MLNIQNLSKSFGVRSLYTGVNLNIGARDRLALLGPNGSGKTTLF
                     EMIAGRLEPDEGKIILRRGTTVGYLEQDIKPSSKQPLLKAVSSASDRLRSLSHKISLL
                     QGELAEEKDGSESNRLMNELGELQHSFEALGGYNAEQEAKLILAGLGFKPADFDRPLH
                     EFSGGWLMRAELAKLLFLSPDILILDEPTNHLDLESTRWFESYLKQYSGSVLFTSHDR
                     AFLNSIATKILSLEEQKARLYTGNYDSYLRERELRLIQLESQSRRQQELIDKETKFIE
                     RFRYKATKASQVQSRIKKLDKLSAIVIPRQTKKMHFNFPEPERSGHDVIKLRNLTKSY
                     GDMVIYQGLELVLNRGDKVALVGPNGAGKTTLLKILAGVMLFDSGYRNLGVNVNTAYF
                     AQYYVESLCPSNNLIQELETILPDAPEQQLRGMLGAFLFSGDDVKKRISVLSGGEKTR
                     LAIAKMLLKPANLVLMDEPTNHLDIPAREILADALQAYKGTLCFITHDRTLIREVATK
                     IIEVRNGKIRIFEGDYDAYLEFAAANPFEDEILKNRTAVSSPRPAPVSASLSQKQRKT
                     LEGQIRNQHYKETGALKQEISDTEEEITGLEKSKQELETLLADPDLYRSGQKVADASL
                     EYKTCKERLIILGEKWLKLCQQNDTLKQKLEDTLKELDN"
     gene            complement(128849..129436)
                     /locus_tag="DEHABAV1_RS00730"
                     /old_locus_tag="DehaBAV1_0131"
     CDS             complement(128849..129436)
                     /locus_tag="DEHABAV1_RS00730"
                     /old_locus_tag="DehaBAV1_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_034376802.1"
                     /db_xref="GI:736351005"
                     /translation="MGGVLALIVLVILSWGNWDIMAVSVIYALAVISLFSFSTIYHAL
                     KKKENEINVWRKLDHIAIFIMIAGTYTPMAYIYLDGGWRLGMLIATWVFVLAGVFQKI
                     FFLNAPRWLSPVTYLGMGWMAVVPLREFWLNMPSLVFWLIAAGGLAYSIGAVIYGLKK
                     PNPVPGAFGFHEIFHTLILLGWAFHLAAVILAILG"
     gene            129622..130902
                     /locus_tag="DEHABAV1_RS00735"
                     /old_locus_tag="DehaBAV1_0132"
     CDS             129622..130902
                     /locus_tag="DEHABAV1_RS00735"
                     /old_locus_tag="DehaBAV1_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_011928645.1"
                     /db_xref="GI:500355064"
                     /translation="MKIKHLFSLLAVASLFTLTACSGGVSAEELKSDKDRIANPNISQ
                     QDANIQAEANNDFAFKLYHFLKGTEEGNFFYSPFSISIALAMTYAGADTTTKTEMQNT
                     LNYLLPDANLHAFFNFIDQELNKRESQAEEADAGTFELKLVNAIWGQKNYTFLSDFLD
                     TLAQNYGAGLRVLDFAASSEDARRVINDWVSEATKDKIKDLIPSDGIDSTTRLVLTNA
                     IYFNAAWAAPFEEEDTQNGLFYLQNGSSVSVQMMHQSEGHGYYNGDDFQAVELAYAGN
                     SLSMVIILPDEGKFGQVEDALSGQMLTGILASIKYNQINLSLPKFSFESEFALKDALS
                     ALGMPTAFSGQADFSKMDGGYNLMIGDVFHKSFISVSEAGTEAAAATAVTMNLTSAPA
                     EPVTLSIDRAFIFCIVDMATGTTLFTGRVLNPGA"
     gene            complement(130984..133176)
                     /locus_tag="DEHABAV1_RS00740"
                     /old_locus_tag="DehaBAV1_0133"
     CDS             complement(130984..133176)
                     /locus_tag="DEHABAV1_RS00740"
                     /old_locus_tag="DehaBAV1_0133"
                     /EC_number="5.4.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine 2,3-aminomutase"
                     /protein_id="WP_011928646.1"
                     /db_xref="GI:500355065"
                     /translation="MVLADTKSEMPQYPQTEQDHQVMAHKISSDYHEDEWNNWKWHIS
                     HTIRDLTTVEKLLGVKFSAEKRRSLEDTILKFPMSITPYYFSLIDRKNFENDPVFIQS
                     VPSAAELNFSCYDKEDPLAEDVDSPAPGITHRYPDRVLFHVSNRCAMYCRHCTRKRKV
                     GDIDKNLSRDELKKGLEYIKNTPRVRDVLLSGGDPLLLPDSILEWLLSELKAIPHVQV
                     IRIGTRVPVVLPQRITPHLVKIIRKYHPVWINTHFNHPREITATSSRALGMLADAGIP
                     LGNQTVLLAKVNDCPRVMKALVHKLVENRVRPYYLYQCDPAQGLSHFRTSIGKGIEII
                     ENLIGHTSGFAVPTYVIDAPNGGGKIPIMPNYLISQSSSKVILRNYEGIITAYYQPED
                     YHPPKCGQDCSACNLDLDLNGAAEGALVGIARLLSNYEDTDYLVPTECDRMDRRKSGY
                     DQITTMGTSLIQHGKNSDRIYLMRLAAEEAATLITGMQALATENGYTKLFAKVPDDIK
                     PLFEADGFETEAVIPCFYGGSKTGYFMGKFIDKDRKIEENGELLEDVLKVAHSKAGKV
                     PVVKLPNGYTLRKCTAEDTSAMADVFSTVFASYPFPIFEPDYISRTMAESITYYGIWH
                     GDRLAALSSAEQYPLEGHVELTDFATLPVYRRRKLAGILLRTMEDEMKQKGFGVSYTS
                     AVAESYGMNISFARQGYKFAGRLKNNTQINGSIKSMNVWYKCLKKKTK"
     gene            complement(133630..134124)
                     /locus_tag="DEHABAV1_RS00745"
                     /old_locus_tag="DehaBAV1_0134"
     CDS             complement(133630..134124)
                     /locus_tag="DEHABAV1_RS00745"
                     /old_locus_tag="DehaBAV1_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PBS lyase"
                     /protein_id="WP_011928647.1"
                     /db_xref="GI:500355066"
                     /translation="MADTEFITQQIQLLKDPDGLKRQSARLALEDLGKSSVPYLVAKL
                     DEYQGDALWESVKALSRIGDASSAGALVKLLSHEVSDIRWLASLGLIKIGKEGVKPLL
                     RDLSLSDARSPLLREEAHHVLTGLRDKQLKNSLSGVIKALESNSPRSDAPVAAEEALV
                     KLKF"
     gene            134276..134629
                     /locus_tag="DEHABAV1_RS00750"
                     /old_locus_tag="DehaBAV1_0135"
     CDS             134276..134629
                     /locus_tag="DEHABAV1_RS00750"
                     /old_locus_tag="DehaBAV1_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FSQ2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928648.1"
                     /db_xref="GI:500355067"
                     /translation="MPRPYKCRRISEIPKVAYYKPAGIPLSMLEENQLSTEEAEALRL
                     KDLLGLEQAQAALQMNISRPTFQRMLYSARYKVADALLNGKALRIEGGVFEIDARPCC
                     QRQTPSCQPDPPKQT"
     gene            complement(134626..135600)
                     /locus_tag="DEHABAV1_RS00755"
                     /old_locus_tag="DehaBAV1_0136"
     CDS             complement(134626..135600)
                     /locus_tag="DEHABAV1_RS00755"
                     /old_locus_tag="DehaBAV1_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_011928649.1"
                     /db_xref="GI:500355068"
                     /translation="MNNIIDKKWAYRELGKTGIGLSPIGLGGWQFSRGKGAAIGVWGM
                     LNQTKVNEIVLNSLGGGINWFDTAEAYGMGQSEEALAEALKQAGIQPGECFIATKWQL
                     TLRFASSIKTLLPMREGFLNPYKVDLYQVHFPSLFASIDAQMDNMAALYKEGRIRAIG
                     VSNFNASQMRIAQKRLNEHGLSLASNQVRYNLLDRQIETNGVLETARELGISLLAYSP
                     LGMGILSGKYQRNPEYLQQVPFIRRKSIRRALEKSMPIIATLSEIAGRYSADIAQVAL
                     AWVIYGQGDTVFAIAGASTPVQARENLKALDIKLTTAEIAELNKVSRL"
     gene            complement(135870..136703)
                     /locus_tag="DEHABAV1_RS00760"
                     /old_locus_tag="DehaBAV1_0137"
     CDS             complement(135870..136703)
                     /locus_tag="DEHABAV1_RS00760"
                     /old_locus_tag="DehaBAV1_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE"
                     /protein_id="WP_042377513.1"
                     /db_xref="GI:755024561"
                     /translation="MYLAAIFSKLIQMKLMKKNRARLFISLTVICLAGVSFFLWAMPA
                     VLGQQYIKQLNYLPSPQPGERILIFSPHPDDETIALGGYIDSACQAGAEVEIVLVTDG
                     SKFTNKEIRYQEFESACRLLGVAADHLVFLDFKDGSLRSVPVTLLIDCFGALINSFMP
                     DIVFYPHPQDAHDDHAAVSRAVRQCLKVTPGIRGYEYLVHYRIFFPQPRVFNQNLYLL
                     PPLTLVNEDHNWLKFDLSEEQLERKLAALSAYASQLKNPFLKPLMQSFIRQNELVCLP
                     N"
     gene            136845..138170
                     /locus_tag="DEHABAV1_RS00765"
                     /old_locus_tag="DehaBAV1_0138"
     CDS             136845..138170
                     /locus_tag="DEHABAV1_RS00765"
                     /old_locus_tag="DehaBAV1_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_011928651.1"
                     /db_xref="GI:500355070"
                     /translation="MAYIFNKTRPDAVADMRVTTAKPYQLFGKLRSPLYINAIFLIIG
                     GGAGAALSFVFWILTARFFTPSAVGLAGAVISAISLLGTVSHLGLGFGIIRFLPQNIY
                     PAKSIINSSISLTLIVSILAGGIFLLGLGIWSPELLFLRQSPLLAVSFLAFTAATALN
                     SIADNSLIAHRHSGYSTLRVVAASGLRLILVIILASLFPQNGIFSAWGIALIATLFMA
                     IFGFIPKVSGGFRPGFEICYPYLKSSFGFSLSNNLSQFLGSAPALLLPLLVLGILGAE
                     SNAYFYIGWSTATALTTIPVSISTSLFTEGSHDEKGLSLHIQKSLKLSLGLIIPLVII
                     LFLLADKVLLFFGQEYAVSSSGLLRIMIVGLIPQSLNVIYMGSLRVIKQLKRLMLINC
                     LIAGLSLILSFGLIPVMGINGAGLAWVIAQSVCAVYVGFRLITNRSTSV"
     gene            138170..139456
                     /locus_tag="DEHABAV1_RS00770"
                     /old_locus_tag="DehaBAV1_0139"
     CDS             138170..139456
                     /locus_tag="DEHABAV1_RS00770"
                     /old_locus_tag="DehaBAV1_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FeS-binding protein"
                     /protein_id="WP_011928652.1"
                     /db_xref="GI:500355071"
                     /translation="MNTPKEPKSILLTLRQQLCCGCGICQAICPAGAIKMQIAPDKGI
                     YLPWLNTSLCRSCGKCLKVCPGTGIDLDSYSQAIFGGASPSLIQNSCYTAFSSDHLQR
                     NLSTSGGVATALLNYALETGLIDGALVSGANPSSPLTPASFIARTPEELKQAAGSKYC
                     PVAAASAISEITAKPGRYAVVGLPCHIQAIRKAENQNPLLKERIVLHLGIVCSSTMSF
                     RGTEYILKQQGINKINLISLHYRTGGWPGDMHLEMACGDTQTLPLRNYHPYHGHGFFS
                     PRRCLMCTDQLNELADISLGDAWLRELEYDHEGTSAVIVRGDTGEDFYRNAVQYGCIK
                     SQPLSNKRVMEWRNKRQDYAAKKNILSLLGWKLPEYSHSCPPARKIAYLYTLEQVINY
                     HLGKTNSRLVIEPAKHFWVWLTRIAEKFISKQASRG"
     gene            complement(139431..140723)
                     /locus_tag="DEHABAV1_RS00775"
                     /old_locus_tag="DehaBAV1_0140"
     CDS             complement(139431..140723)
                     /locus_tag="DEHABAV1_RS00775"
                     /old_locus_tag="DehaBAV1_0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928653.1"
                     /db_xref="GI:500355072"
                     /translation="MKENPDNKPPRILVLSNADFESRGFQAIVRGLEHCLGECLPGLT
                     LEYFSFAPKRYRYLESKGLKLISHPWANGNCETLNTFSYLVLIPKSLLRAVYYKLRPA
                     KNPYRHYNALLHINVDCLNETDYGFVCVCLNLLKSWAGLRAFGCPLLTAPVDIGPFNT
                     PVSRFMGRYILSRAKLVALRDELSYEYLLKLGLKPERLYLGADMAFLMPPASREVVKE
                     LFMAEGVENDNRFIIGISPSLFQMELKNIFADSAADKPEVYLMLIAELADFAASTFDA
                     GIYLIPHVHPDDSRVCHEVYARMQHKNRVHVFSGDYPSETVKGLIGECDIFISCRMHA
                     SIAALSQAIPTLTLGYQEKYWKLLGSYLGQSDYLVDIKKPNPRDIQDELKQKLSCMAA
                     NRPAISARIKERLGIINHRASVYGQRVAEVISRGKPVC"
     gene            complement(140704..141405)
                     /locus_tag="DEHABAV1_RS00780"
                     /old_locus_tag="DehaBAV1_0141"
     CDS             complement(140704..141405)
                     /locus_tag="DEHABAV1_RS00780"
                     /old_locus_tag="DehaBAV1_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011928654.1"
                     /db_xref="GI:500355073"
                     /translation="MNRVFVKKLLNLSHRYGGYVPLSRLNTVSCWLEGGGESLLDIGC
                     GGGEAMLFLNRRKSFKTCGVDINPILIAEAKNKSSHHQYFCRDILNLNLADKSYDTVI
                     CLELIEHLPKDEGLNLILRLEKIARKRVILSTPVGFSRVEGNHNEDGSAHQCGYLPFE
                     LKEMGYLVRGNRLRLERVWWPYLLKRSAALASVYWAFWLAAGVVFSPLAYFFPDRIAS
                     GMVCLKEVGYERKSG"
     gene            complement(141402..142616)
                     /locus_tag="DEHABAV1_RS00785"
                     /old_locus_tag="DehaBAV1_0142"
     CDS             complement(141402..142616)
                     /locus_tag="DEHABAV1_RS00785"
                     /old_locus_tag="DehaBAV1_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_011928655.1"
                     /db_xref="GI:500355074"
                     /translation="MNILHLGSGSLQTPPVGYGGIERYVFESARGLAARGNRVVIFDI
                     RLDRADLVSEQTGGIEIIRLHCLVAHRSSSLWLSNIYSVLNLLGFSLRARRYINKNSF
                     EVIHIHRTLVGLVLVLVLPSQREKMIYTVHSPVWVMQRGSFKDRLSRKLDIFIMKRVH
                     RVIAQSARIKNILERERAAPGRIRLLPCGVDTSAFNPASRCSFICRKYGIDDRLLVLF
                     VGRIVPYKGVEYLVRAANLVVNKAGFRKCAFLLAGPMAEHGLDALEHAAYPKKVSSLI
                     AEYNLGDFVFLSGSLPQDDLQMVFASADIFVLPSLAESSPAVVLQALASGCAVVASDI
                     SGIHEQVVEGVNGYLVKAGDETELAKRILELLQSPARRSAMGANGRELVKKEFDWGVI
                     CGRLEGIYREAT"
     gene            complement(142616..143470)
                     /locus_tag="DEHABAV1_RS00790"
                     /old_locus_tag="DehaBAV1_0143"
     CDS             complement(142616..143470)
                     /locus_tag="DEHABAV1_RS00790"
                     /old_locus_tag="DehaBAV1_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_011928656.1"
                     /db_xref="GI:500355075"
                     /translation="MEDYVPLSVIVCARNAEKTIGSCLESIMQNSPAEIILVDGDSTD
                     KTVSLAAAFTQHILNDRGRGTSFAHQIGSEIAGYDYIMFVDADVELPPYALGQMFAEL
                     KKAKLDGIYARTEGAGQGNFWERAATDFLSCRPNPAGIWFGAALVSRDIVLKYGFDSF
                     ISPGDDVDFNRRALSGGCVFGVSAVRVKHHHRTTFKNVVHQYIWYGKGNSRLAWKNGL
                     LILRFWPPFPAVYGLLHSLGHFKFRPVSLHLLAFVFQSWGMVCGLTELIFNPPPDRPR
                     RPCWKCGI"
     gene            complement(143472..145091)
                     /locus_tag="DEHABAV1_RS00795"
                     /old_locus_tag="DehaBAV1_0144"
     CDS             complement(143472..145091)
                     /locus_tag="DEHABAV1_RS00795"
                     /old_locus_tag="DehaBAV1_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928657.1"
                     /db_xref="GI:500355076"
                     /translation="MKNESALLASSKLFCILALVLWGLSLSGDGFNPDMGTMLKPPML
                     LFVSGLGFLCLGSVFLWKMRASQTRLLCLYTFIMLAMLWLSPVIMQSSPVSAQWAYGI
                     YYPNTQFISQTGGIDPAGYTFHNWPGFFILDYSLSAVAGTSCLDFMAFYGPFLMQVLI
                     LVPLYCLFKNIIPNPNHRFAAIWVFYLANWVAQLYFVPQGVGVFFLICLLAIITSPGF
                     SASEGNAVSHRVVIILVLAALTVSHLLTSIVALLCVGALTLSRLVKGFNLGILAGMLV
                     GCWTIYGAATQFDSQLPDFANRAFELENLFQFSSSSGGVDAGAAFLEISRARFIFSGL
                     FAGLAVLGVLLSLKYRNRFDFSLFALEGVAIVILCSMLYGSEFWTRAFLFSLVPIAYF
                     AVKLLRNRLSTLVMAAVLLVAIPGHLLAHYGAIPDMVSRFDLAAWQYLENYTLRGYIS
                     GGISYIKPDYLSLPLKKLDWQDGLLVSQGYTGRYPQYLQIGRSTGVGWVYYNGDSQYV
                     PALEAALEDSASYGLIYQNGEMNIYFNQGAN"
     gene            complement(145088..145999)
                     /locus_tag="DEHABAV1_RS00800"
                     /old_locus_tag="DehaBAV1_0145"
     CDS             complement(145088..145999)
                     /locus_tag="DEHABAV1_RS00800"
                     /old_locus_tag="DehaBAV1_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase, family 2"
                     /protein_id="WP_015406808.1"
                     /db_xref="GI:505219706"
                     /translation="MSLSVVICTRNSASTIKACLDSLMPAYRSSLIREIIIVDACSTD
                     ATCRIAGNYPVRIYYEPGKGVYFGYQYGWGICSGEYVLFLDSDAYLEKISLVGVLNMF
                     SDPQVGLVGVYSFSPDGSRLGRCAGQWWDYHRNRLLPKARSSLFGRWYHRVVGFGAEY
                     TSGPCFMASRQCLEATGGFAPELYLYYLYPKLAYPGDIILSGRAIQAGYKAVWANDGR
                     VGHSPPGDLPALWRQRANWGRGDAAYLDICRTGFSKRVTCVLSRLASPVMALYLAVKY
                     RNLLHLWYLPLAQLAWLGGYFNFRLKR"
     gene            complement(146027..146677)
                     /locus_tag="DEHABAV1_RS00805"
                     /old_locus_tag="DehaBAV1_0146"
     CDS             complement(146027..146677)
                     /locus_tag="DEHABAV1_RS00805"
                     /old_locus_tag="DehaBAV1_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="WP_011928659.1"
                     /db_xref="GI:500355078"
                     /translation="MIISKPSNPGSKENTPKTTDSKPEKDMDCLLRGYLGGLSHCLEE
                     LTAQDICGVAELIYQAYTRRRQIFIVGNGGSASTASHMARDLRIGTSLRGKPRLRTCS
                     LADNVAFITSLANDVNYESIFTEQLIGQIEPGDVLIAISCSGNSANVVRAAEYANECG
                     ASTVGLTGFGGGRLLEICDICVVLSSCDYGQVEDVHLSLGHIFSCMVKARIEKETV"
     gene            complement(146706..147683)
                     /locus_tag="DEHABAV1_RS00810"
                     /old_locus_tag="DehaBAV1_0147"
     CDS             complement(146706..147683)
                     /locus_tag="DEHABAV1_RS00810"
                     /old_locus_tag="DehaBAV1_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GHMP kinase"
                     /protein_id="WP_011928660.1"
                     /db_xref="GI:500355079"
                     /translation="MIISRTPFRISFAGGGTDLRAFYSLKAGEVVSTAINKYMYITVN
                     KRFDSTIRISYSSTEIVNTVEEICHPIVREALKLTGISGGIEIVSIADIPAGTGLGSS
                     STFTVGLLNALYAYQGKLLSAEELAKQACRIEIDCLKEPIGKQDQYIAAYGGMCHFRF
                     EPDEYVGVSPLPLKTELKANLSESLLLFYTGSSRQAGTILAEQQATTTRPDSFKNLTY
                     LTELAVSCRECLLDHAVPKDIGAILHKGWLAKKNLSRGISNPYIDKCYQSALNAGAYG
                     GKILGAGGGGFLLVCAPPDRHTAIRKALSDLPQVDFEFEPEGSKIIYVL"
     gene            complement(147680..148390)
                     /locus_tag="DEHABAV1_RS00815"
                     /old_locus_tag="DehaBAV1_0148"
     CDS             complement(147680..148390)
                     /locus_tag="DEHABAV1_RS00815"
                     /old_locus_tag="DehaBAV1_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-D-manno-heptose 1-phosphate
                     guanosyltransferase"
                     /protein_id="WP_011928661.1"
                     /db_xref="GI:500355080"
                     /translation="MQAVILCGGLATRLRPITENIPKCLLPMAGRPFLHHQFRLLKSQ
                     GFDRAVLCIGHLGEMVKDSFMQGDEYGLKLVYSQETEKLLGTAGALKKAEEYLEDEFF
                     VINGDTYLEMDYLHAWQTYTQSGRDALMAVYDNRNGRINARNDVALDENMLVRCYEKD
                     SHLPELKFVNAGALILKKSLFATLEEGKPYSLERAILPVLANTRRMLAYPVKQCFYDV
                     GTVEGIYTFCNYLENQTA"
     gene            complement(148393..149334)
                     /locus_tag="DEHABAV1_RS00820"
                     /old_locus_tag="DehaBAV1_0149"
     CDS             complement(148393..149334)
                     /locus_tag="DEHABAV1_RS00820"
                     /old_locus_tag="DehaBAV1_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_011928662.1"
                     /db_xref="GI:500355081"
                     /translation="MPEVLITGGCGFIGSHLADALLGQGFKVRVLDNLSNGSLENLKV
                     CDHGDELTVINGNLTNTNLLDSAVKGCEAVFHLAAHANVQNSARDTSIDLENNTLATH
                     NLLESMRKNGVGRLMFASSAAVYGESGLTVLDEDYGPLLPISLYGASKLAGEGLVSAY
                     SHLYGLKATMFRFANVVGSRRRNGVIYDFVNRLKKDPAALSVLGDGSQSKPYLHVSDC
                     VAGILLGFEKSTKTLGLYNLGTPDSVSVRDIACMVASEMGLKNVCYSYEGGERGWRGD
                     APQVRFDISRICSLGFKPRFSSLQAVKLAIKETLKEI"
     gene            complement(149327..150322)
                     /locus_tag="DEHABAV1_RS00825"
                     /old_locus_tag="DehaBAV1_0150"
     CDS             complement(149327..150322)
                     /locus_tag="DEHABAV1_RS00825"
                     /old_locus_tag="DehaBAV1_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_011928663.1"
                     /db_xref="GI:500355082"
                     /translation="MADPFISVVVSAYSMERYSDLLSLIDSLKSQSYTNFEVILVIEK
                     SGQLFSCLNRCLAQHPHNRNFKLFFNEGIPGLASARNLGVAKSQGEIMAFIDDDAAAS
                     PEWLACIAQCFGGDKKIIGLTGPALPWWEHPGLSWFPSEFNWVISSMPCLPRSRGYIR
                     NAWGTNMAFRREAFEGGQGFNPELGAKGGGCHGKSELVGEDTEFCLRICRLSGLHILY
                     APEVKVMHRVYKYRLKPGFIAKRAYWEGYTKAVFKYRLSKETNLNGVLSEERGLLKRI
                     ILHLLPLSLLNLPLKPRQSALTILTTLNILGSAGWGYLRGAASARFIADKEAVNA"
     gene            complement(150315..151547)
                     /locus_tag="DEHABAV1_RS00830"
                     /old_locus_tag="DehaBAV1_0151"
     CDS             complement(150315..151547)
                     /locus_tag="DEHABAV1_RS00830"
                     /old_locus_tag="DehaBAV1_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol phosphate phosphatase"
                     /protein_id="WP_011928664.1"
                     /db_xref="GI:500355083"
                     /translation="MEQKAIFIDRDGTIVEDVPYCNSPRRVRLLDGVGKAIKRLNDQR
                     YLVILITNQSGVARGYFSEETLGKIHNKLKEELDCFGARLDDIFYCPHHPGQGCTCRK
                     PATGLIDMAVEKYGIDIGRSYFIGDRFIDIQAANRAGCQAVLVPYAPPETDYFKQEVA
                     PDSRPSFLAADFTTAVDWVLADAAGKASVSVVIPTLNEEKNIGCVLPRLRCVPGITEV
                     ILVDGKSTDRTVEKALQLWPEIKVINQPGRGKGNAMRAGFEAATGDIVVTLDADGSLA
                     PEELPRYIGPLFEGYQMVKGSRFCRGGGTSDMPLFRRFGNFIFTKMANLVCGCHYTDL
                     VYGYHAFRRQILDSLCLRSDGFEIDTEMYIRAARIGLKVKEVPSYEARRLAGTGKLRS
                     FHDGARILRTILRENFHG"
     gene            151751..152758
                     /locus_tag="DEHABAV1_RS00835"
                     /old_locus_tag="DehaBAV1_0152"
     CDS             151751..152758
                     /locus_tag="DEHABAV1_RS00835"
                     /old_locus_tag="DehaBAV1_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_011928665.1"
                     /db_xref="GI:500355084"
                     /translation="MIKICLIGDFKVCPDRSIYKMAAQLADFLSKEKDILLLLCPREH
                     FTRPRSLNRIRRFQPDIIHLLGKPDAAELFRLKMAKLSAPRAKTVISAQQPVNTRTVR
                     NMLPYIKPDMAICLSQKSASFFREAGIETVILPNGVDMATFQPVSPEIKAELRRRYCL
                     PHNKLLLLHVGPIRAGRGVDLLRRMQNPDTQVIMAVSNPGIFNRTLLENLRKSGCMIL
                     TSFRPNIADLYALADAYVYPMLLEEDANHQIFSSEMPLSVLEAMSANLPVITTPFGAL
                     PEVFPAGEGLYYAHDDFEFLKAFQAYTQNPPANTRHKVAACAWPLIITSLKELYTKLL
                     A"
     gene            complement(152771..153682)
                     /locus_tag="DEHABAV1_RS00840"
                     /old_locus_tag="DehaBAV1_0153"
     CDS             complement(152771..153682)
                     /locus_tag="DEHABAV1_RS00840"
                     /old_locus_tag="DehaBAV1_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928666.1"
                     /db_xref="GI:500355085"
                     /translation="MNFLRRYDLYLVLLFIVLAVLAAEGGWVLPLRLLFGVPLVLIVP
                     GYALMSVLYPSRLSLSRSGRFMMGLGLSLSVSILAGLALNYTVGLEQASVLYALSGFS
                     LVFCLIAIGRRQHLPPNEKPGLILTPPDTKRHLPPNTSQIFLNVILSVCLLGVGGVAA
                     KQLLQVYSPSEFTRFYLLGLNDTAENFPSLFILNGEQVAGVKYGNQPAVVAVSARFKL
                     VISNSGQSEMVYQVEALLNGQNYRFSLKEGGEFDGLVKVPVDTIKSLELYFAPFEAGD
                     NQVLEIWLYAGETAVFTKPLKIVFSTV"
     gene            complement(153774..154277)
                     /locus_tag="DEHABAV1_RS00845"
                     /old_locus_tag="DehaBAV1_0154"
     CDS             complement(153774..154277)
                     /locus_tag="DEHABAV1_RS00845"
                     /old_locus_tag="DehaBAV1_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubredoxin-type Fe(Cys)4 protein"
                     /protein_id="WP_011928667.1"
                     /db_xref="GI:500355086"
                     /translation="MSSKLPEPSEGPVLFQARLKNEAEASGYHLNPDGSFVKMLAEGL
                     LANRQRYGYPSCPCRLAKGDKKADLDIICPCDYRDADLSEFGSCYCALYVNSHIAKGE
                     KKAQAVPERRHLPETRPETKPAEAPSGLAYPVWRCRVCGYLCGRDEAPDECPICKADK
                     ERFERFM"
     gene            complement(154274..154549)
                     /locus_tag="DEHABAV1_RS00850"
                     /old_locus_tag="DehaBAV1_0155"
     CDS             complement(154274..154549)
                     /locus_tag="DEHABAV1_RS00850"
                     /old_locus_tag="DehaBAV1_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_011928668.1"
                     /db_xref="GI:500355087"
                     /translation="MEKIIGRNAGKIKLYALSTCGWCRLTRQLLAELGVAYEFEYVDL
                     LTGAEREKAVKELTALNPSSSFPTMVIGENRVIIGYKESEIREALKA"
     gene            complement(154740..155126)
                     /locus_tag="DEHABAV1_RS00855"
                     /old_locus_tag="DehaBAV1_0156"
     CDS             complement(154740..155126)
                     /locus_tag="DEHABAV1_RS00855"
                     /old_locus_tag="DehaBAV1_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308810.1"
                     /db_xref="GI:499628076"
                     /translation="MNIRVIVIGFQSRFFGVCDAASVTERNVVSMQMLLNQDIINKCV
                     CHKCPVQNQSECVHTQMAELKNSLKETPLDPHKIPKAYCVNGKSLCKGIDHSKPCICG
                     SCDVYAKYHLSEGEPGGFYCFEGKSV"
     gene            complement(155284..155814)
                     /locus_tag="DEHABAV1_RS00860"
                     /old_locus_tag="DehaBAV1_0157"
     CDS             complement(155284..155814)
                     /locus_tag="DEHABAV1_RS00860"
                     /old_locus_tag="DehaBAV1_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928669.1"
                     /db_xref="GI:500355088"
                     /translation="MVRRVTVEEYNPCWAEQYDAEAVRLQALLADNLLEIHHIGSTAV
                     PGLSAKPIIDIMPVVKDISAIDRLQKTFERAGYLYLGEYGISGRRFLVRGTDKIRFAH
                     VHIFGVSSSDIERHLAFRDYLRCHAAEAAEYSCIKKALALKFPEDIEAYINDKSGFVR
                     DLETKALKWFRANLQT"
     gene            complement(155818..157125)
                     /locus_tag="DEHABAV1_RS00865"
                     /old_locus_tag="DehaBAV1_0158"
     CDS             complement(155818..157125)
                     /locus_tag="DEHABAV1_RS00865"
                     /old_locus_tag="DehaBAV1_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928670.1"
                     /db_xref="GI:500355089"
                     /translation="MTVKEIVVIGAGAGGLVAAGRAAECGGKVILLEKSEQPGKKMLI
                     SGQGRCNISNSRDMAEFITAFGPNGRFLYSAFSRFFRQELVELLARYGVETKTERGGR
                     LFPDSDKAGDVVGALMKYASAATLIAGQKVSQILVNDGQVVGVKTEKETFRADAAVIA
                     TGGASYPGTGSSGDGFRMAEALGHTIVKLRPALVPLVVKEIALVQSMQGVALKNIRLT
                     SYRCEADKIPLDLILQDWGRGITGKKPPKAVIESRMGELMITHFGLGGPLTMLMGLPV
                     AEALEQGAVSVAIDLKPALSLDKLRLRLQRDFDTFGKRSFQNLLSELLPQKMIRPFVD
                     LTGIDPFKCGGQITASEREVILANLKCLRFNITSTLPLTSAVVTAGGVNLKEIDPRTM
                     ESKLIKGLYFCGEVMDIDADTGGYNLQAAFSSGYLAGESAAGA"
     gene            157300..159741
                     /locus_tag="DEHABAV1_RS00870"
                     /old_locus_tag="DehaBAV1_0159"
     CDS             157300..159741
                     /locus_tag="DEHABAV1_RS00870"
                     /old_locus_tag="DehaBAV1_0159"
                     /EC_number="6.1.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWQ1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine--tRNA ligase"
                     /protein_id="WP_011928671.1"
                     /db_xref="GI:500355090"
                     /translation="MAEKYNPQETEKKWQDKWAADRLYHASEDSPKPKWYSLTMFPYT
                     SGNLHIGHWYAEVPADCFARYKRLRGFNVMRPVGFDSFGLPAENAAIKHNIHPRIWTL
                     NNVENMRRQLKTIGAMFDWDREVITCLPEYYKWTQWFFLKLYEAGLAYRAKAPVNWCP
                     SCQAVLANEQVVDGTCWRCETPTTRRDLEQWFFRITNYADELKDHEGLDWPEKITAMQ
                     RNWVGKSYGAEVSFALDCPTAFEKEIKVFTTRPDTIYGVTFMVLAPEHPLVEKITTPE
                     NKAAVDAYIKKSRTCTEIERLSTEREKDGVFTGTYVTNRVNGQKVPVWIGDYVLQSYG
                     TGAVMGVPAHDERDFVFAQKYHLPVITVIAPSAYDGKPLEAAYINEGVMLNSGPFNGT
                     PNTEGKEKVCDYLAEHGWGKKTVNYKLRDWLISRQRYWGAPIPMVYCEKCGIVPVPEK
                     DLPVLLPEDVGFRSGGESPLKYNEGFVNTICPVCGGKAKRETDTMDTFMCSSWYFLRY
                     TSPGYDKGPFDPVKLKYWMPVDLYTGGAEHAVMHLFYSRFFTKALRDMGIIDFGEPFK
                     KLFNQGIIVSNHQKMSKSKGNVVTPDNLVAEVGTDAVRAYLMFVGPWDQGGEWNDSGL
                     SGMSRWLNRVWNLFTEEYTPQTASAEAERELKRTLHQTIKKITMDIERLRFNTVVAAL
                     MELSNSLAKLKETAAISAENWQNTLQTFALMLAPVAPHIAEELWANLGMKYSIHNQNW
                     PTWDEELAKDEVITLIIQVNGKLRERLEMPAGISEAEAKETALNSERVKPHLLGKTPV
                     TVIYVPGKLVNIVVK"
     gene            159743..160546
                     /locus_tag="DEHABAV1_RS00875"
                     /old_locus_tag="DehaBAV1_0160"
     CDS             159743..160546
                     /locus_tag="DEHABAV1_RS00875"
                     /old_locus_tag="DehaBAV1_0160"
                     /EC_number="1.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_011928672.1"
                     /db_xref="GI:500355091"
                     /translation="MNIAFIGGGNMGEAILGALIQKNICPPQNITVSEIKAERRTYLE
                     TSYGIKTTASNPDAIKSAEVVLLAIKPQNLPELSAELKGKLADKQLVISIIAGATLSK
                     LSGGLAHKAVVRVMPNTPAMIGMGMSVWTALPSVSPAQKDQAKAILSAMGKEIYTGKE
                     TMLDAATAISGSGPAYFFLFMEGLEKAALEMGFTPEEASILVSQTAAGSAIYAGKSGF
                     ALTQLRKNVTSPGGTTAEAIKAFEEAGLEATIIKAAKAAFNRSVELGKG"
     gene            160640..161128
                     /locus_tag="DEHABAV1_RS00880"
                     /old_locus_tag="DehaBAV1_0161"
     CDS             160640..161128
                     /locus_tag="DEHABAV1_RS00880"
                     /old_locus_tag="DehaBAV1_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V production CvpA"
                     /protein_id="WP_011928673.1"
                     /db_xref="GI:500355092"
                     /translation="MNWLDIVLLISLGIQTVSGFFTGLIRNFLHLVGLIIGIILAGRF
                     YPTVAEWLSFISSPEWANIVAFLLILMTIWVATTLIAKLLDTMIKPTFLNWVNRLGGA
                     IFGLLVSGIFTAALLAIWVKFFDSGSVITDSAVAQILLDKFPLILSLLPDEFGVIQDF
                     FN"
     gene            complement(161239..161493)
                     /locus_tag="DEHABAV1_RS00885"
                     /old_locus_tag="DehaBAV1_0162"
     CDS             complement(161239..161493)
                     /locus_tag="DEHABAV1_RS00885"
                     /old_locus_tag="DehaBAV1_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011308804.1"
                     /db_xref="GI:499628070"
                     /translation="MSFKITDDCISCGACEPECPNKAISEGETIYIIDPEKCSECVGA
                     FDTPQCVEICPVDSCVKCCNESNDELLAKWQKQHPGESPK"
     gene            complement(161582..162061)
                     /gene="coaD"
                     /locus_tag="DEHABAV1_RS00890"
                     /old_locus_tag="DehaBAV1_0163"
     CDS             complement(161582..162061)
                     /gene="coaD"
                     /locus_tag="DEHABAV1_RS00890"
                     /old_locus_tag="DehaBAV1_0163"
                     /EC_number="2.7.7.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWQ5.1"
                     /note="Catalyzes the conversion of ATP and pantetheine
                     4'-phosphate to diphosphate and 3'-dephospho-coA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="WP_011928674.1"
                     /db_xref="GI:500355093"
                     /translation="MIAIYPGRFDPVTLGHLSVARRASGFCDRLIIAVFDNPAKPGLF
                     TAAERVDFIKQSIKDLPNVEVRSFSGLMVNFARKMGASLIIRGLRVGADFEREMEMYV
                     MNRRLDEGIELCCLFSEPQYQYLSASLIKEIVILGGDSSGLISEHVAVALKNKLASV"
     gene            complement(162033..162611)
                     /locus_tag="DEHABAV1_RS00895"
                     /old_locus_tag="DehaBAV1_0164"
     CDS             complement(162033..162611)
                     /locus_tag="DEHABAV1_RS00895"
                     /old_locus_tag="DehaBAV1_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011928675.1"
                     /db_xref="GI:500355094"
                     /translation="MRIIAGDAKGKNIIVPQRKATRPATELVRGAMMSMLEAVAEDWS
                     EVLDIYSGSGSLGLEALSRGAGHVDFVEHERCCCDIIKQNLETIGCASHAHVYCLDVP
                     KAMAFLKKQYDVILADPPYRNQQIGEVLEKLGNSGLIGENTVMAVTHSAHLTLAECYG
                     RLKMLKEHRHGDSLITIYRKDSSFDSHLPGPV"
     gene            162990..165971
                     /locus_tag="DEHABAV1_RS00900"
                     /old_locus_tag="DehaBAV1_0165"
     CDS             162990..165971
                     /locus_tag="DEHABAV1_RS00900"
                     /old_locus_tag="DehaBAV1_0165"
                     /EC_number="1.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="WP_011928676.1"
                     /db_xref="GI:500355095"
                     /translation="MRSQFSRRDFLKISGGTAGLFATAGLFRGPIKGVEPKMVDTRPR
                     WVKETTTICPFDASGCGFICYTDSAGNLTNMEGDPDNPVNRGSACSKGASLIQLHNNK
                     HRLEKVLYRAAGANDWEEKSWDWAFGEIAKKVKASRDSGFVAKNAAGKTVNRTEAIAS
                     LGGATLDNEECYLLSKMLRALGIVYLDSQARLSTASSLEALAASFGRNAMTNSWTDVS
                     NANVILDMGGNPAENYPACFSHLGEAMGKGAELISVDCRLTRTAAKAGTFVAARSGSE
                     IAFIGGLIKYVISDIEAHPANYNLTYITEYTTASMVVNSNFKGPADLDGMFVGYNTAS
                     HSYDQSNWNFTKASNGEPVIDKTLTNPNCVFQLLKKQYARYTPEMVSATCGCSQADFA
                     KVCASFAATGKADKAGAIVYAMSSTQHTSGAQTVRAYAVLQMLLANIGVSGGGLFALG
                     GESNVQGAADNGVSWNKLPGYLSAPNEDDTTFAAYASKAGDQSAASLLKAWYGSNASS
                     SNGFGFGFLPKTDNNTNYSYINAIKQMAAGKIKGAFAWGANPVVESAAAGQATQALAK
                     LDWLVVTDMFESETAAFWKKDGVTSQTEVFLLPTACSYEKEGSVTNADRWIQWRNKAV
                     SASGEAKSELEVISSLLSRLQTLYQGESGLNAEAITKLSWTYSTNPSAADVAKEMNGY
                     KISSLQQLESPEDLRADGTVACGNSLYIGSFTNAGNQMARREQTGAFHAGWAWSWPMN
                     TRIMNNRASVDLSGKPFNAAKPVISWNGISWTGDNVDGKNAPFNQSGGLPFKGTNGNT
                     AQLFAAMADGPMPEHYEPWESPVDNALSGTQNNPTAMVFEGDTQGSAGEYPVICTTIR
                     TVEHSLGGQLTRNMPFLVELAPAAYVEISEQLASEKGIKAGDIVKLTSARGSVSVAAA
                     VTKRLKPFSIGGKTVHQVAIPNHWGFMGIAQGDSANVLAPNTADSNSSTPEFKAFLVK
                     VEKAADGTVPTITGRYKVLED"
     gene            166059..167270
                     /locus_tag="DEHABAV1_RS00905"
                     /old_locus_tag="DehaBAV1_0166"
     CDS             166059..167270
                     /locus_tag="DEHABAV1_RS00905"
                     /old_locus_tag="DehaBAV1_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="WP_011308800.1"
                     /db_xref="GI:499628066"
                     /translation="MFSAIKGWVNKLEQTGNPNVPLFGKWGLLQIILGLGALTVAALK
                     LAYGLGPITNLSDNWPWGLWVAFDVGAYIASAAGGFTMAAIVYIFGYEKFRPLVRPAI
                     LIGALCYTIGAIGIMIDLARSIRIVHPIWMWNHESIMFEVGWCVMMYLTVLYLEFSNN
                     IFERIGWKKLGNLQHAFIIPLVIFGIMLSFLHQSSLGALFLINPAQQPLWHGPLMGHL
                     FLVSAMALGLSVLTYFSVILSRSWKMTLRMDILSKLGLIIAWIMLVYLAARGVDYAIT
                     GNLATGLNGDWYTVLWVAEVGIGMLLPMILLFIKKIRSSRSGLLWSTGLMIMGVVLNR
                     INTLVISQAPNREGSYFPHILEFVFTFGLIAGAMYVFRLCAKYLPLYTDHMKGLTPEQ
                     VKKAPAVIPAD"
     gene            167271..168119
                     /locus_tag="DEHABAV1_RS00910"
                     /old_locus_tag="DehaBAV1_0167"
     CDS             167271..168119
                     /locus_tag="DEHABAV1_RS00910"
                     /old_locus_tag="DehaBAV1_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="WP_011928677.1"
                     /db_xref="GI:500355096"
                     /translation="MNTNRLERINSEIERYRAAQPELETILALYQKVFDIQESASSQE
                     EPAPLISDEDAIAKLAAGEYILKDIPFEPSAELFHQTGLKLGRAFTQTAGEKFPTPAL
                     LKLIESHPGGLSGFITAMLSDNLDYLAKFTQNTSFNPETLLFFVTNLVSPFLTAQAKY
                     YQPQVDLLGWDKNTCPFCGSSPRYSCLAKDNGARRLFCSLCHTQWNYRRIKCAYCSNA
                     NAEKLRHFYSAIFPYQRVDVCEKCKTYIKTTDERRLGRECLPEVEDAVSIHLDSIAQN
                     EGYQPG"
     gene            complement(168301..169266)
                     /locus_tag="DEHABAV1_RS00915"
                     /old_locus_tag="DehaBAV1_0168"
     CDS             complement(168301..169266)
                     /locus_tag="DEHABAV1_RS00915"
                     /old_locus_tag="DehaBAV1_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011308798.1"
                     /db_xref="GI:499628064"
                     /translation="MSLTVLWVIFAVMVLCMMALDLGVFHRRAHEVKTKEALVWSGVW
                     IALALIFGGLVYSSLGSETGLNYLSGYIIELSLSVDNLFVFIMIFSYFCIKREYQHKV
                     LFWGILGAIIMRAVFIAAGITLIENLSWVLYIFGVFLIYTGIKMVKDQNKEIHPDKNP
                     LVNFVCRILPMTNKLHGDHFFIKENGRKLATPLILVLVSIEAMDLVFAVDSIPAVMAI
                     TLDPFIIFTSNIFAVMGLRAMYMALSGVIQKLHYLHYGLAAILAFLGIKMLISDFFHM
                     PVTASLGVVAVILAISIAASLLKPPKEIKPVEVPHPACPVDEGDK"
     gene            complement(169433..171118)
                     /locus_tag="DEHABAV1_RS00920"
                     /old_locus_tag="DehaBAV1_0169"
     CDS             complement(169433..171118)
                     /locus_tag="DEHABAV1_RS00920"
                     /old_locus_tag="DehaBAV1_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_011308797.1"
                     /db_xref="GI:499628063"
                     /translation="MSFESFNFDPAVMAGVRACGYKEPTPIQAQAIPPIMAGHDVIGL
                     AQTGTGKTAAYALPIIQKMLSTPRGRVRTLVIAPTRELACQISDSFRSLGQRARIREC
                     SIYGGVNMDQQIRRLRSGVDVVVACPGRLLDHIWRGTIDVCGVETLIIDEADRMFDMG
                     FQPDIQSILKCLVQPHQTLLFSATMPPEVRKLTLETQTNPVTVQVGTQSPVSSVSHSV
                     YPVKSHQKTPLLLEILKTVETKSVLIFARTKYGAENLADEISKAGFTTASLQGNLSQN
                     RRHAVMEGFRRGNFKILVATDIAARGLDIDHISHVINYDMPDSPEDYTHRIGRTGRFD
                     RTGQAFSLVTGRDGDMVRDIQRLLSSPIQRLRVDGFDYATTRNDGQNQSQRRDFAPRR
                     GYSHGGYNRPEMAVNETSQTDTPSEMPVSPARPFNPGFRPSRPANSAPRFHREGNFAP
                     RMQSHSSFEGTSAPAARPAARYNDRPAFRKENSFQTTEASRPSFRKETGFTPREHTQA
                     DFENSEQPSGRRPARFNGKASFADRPARSGNKVGKPPFFRRSKPAVSEKNETY"
     gene            complement(171186..171380)
                     /locus_tag="DEHABAV1_RS00925"
     CDS             complement(171186..171380)
                     /locus_tag="DEHABAV1_RS00925"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_034376813.1"
                     /db_xref="GI:736351016"
                     /translation="MAPVSHRPSPGREKSQGWVAFKPSFQKDRLIYPQVITCTPIFCI
                     LPLKQGRIMMGHKISYLDNS"
     gene            <171927..>172370
                     /locus_tag="DEHABAV1_RS00930"
     CDS             <171927..>172370
                     /locus_tag="DEHABAV1_RS00930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012994533.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377927.1"
                     /db_xref="GI:755024984"
                     /translation="DVWLCDETVLKIAGKNIWFYDIIDMKTRFLLASHLSDKRYLGDA
                     RTVLHRAGIKAGKSPKVVITDSLNSYPQAIGDVFGADVRHIKYKGITKSPNNNILERF
                     HGTLKARTKVMRGLKSMETARLFTDGWLVFYNFMRPHESLDNQTPA"
     gene            172547..172819
                     /locus_tag="DEHABAV1_RS00935"
                     /old_locus_tag="DehaBAV1_0171"
     CDS             172547..172819
                     /locus_tag="DEHABAV1_RS00935"
                     /old_locus_tag="DehaBAV1_0171"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928679.1"
                     /db_xref="GI:500355098"
                     /translation="MIKITLKEYYFSVFSCEIGSFLAIKLFIDEDDLIPKIALIILAL
                     LSISAFVMLIRKGGINKRQYNHGERKETKYPEPDAINGKFRNNKEE"
     gene            complement(173038..173325)
                     /locus_tag="DEHABAV1_RS00940"
                     /old_locus_tag="DehaBAV1_0172"
     CDS             complement(173038..173325)
                     /locus_tag="DEHABAV1_RS00940"
                     /old_locus_tag="DehaBAV1_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928680.1"
                     /db_xref="GI:500355099"
                     /translation="MTGIVFLFGLLIGILGTWLWYTAKERSIKLAWVDYLLIAIFVLM
                     AGGGIWFVNTFTEESVASAARSSGLIFGLLALLVLGVTWQLIRRRNHKSGI"
     gene            complement(173374..174741)
                     /locus_tag="DEHABAV1_RS00945"
                     /old_locus_tag="DehaBAV1_0173"
     CDS             complement(173374..174741)
                     /locus_tag="DEHABAV1_RS00945"
                     /old_locus_tag="DehaBAV1_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928681.1"
                     /db_xref="GI:500355100"
                     /translation="MDEKINRRDFVKGAGLASAATVATLMATASTVSAEELVNPGGKA
                     MDEMGNASIKRDLPESFYKRIENKAGYIGTTRVVAPTQRLDAREHGFSQIVRRGSTGD
                     WSGEPGDWGPILLAAVQEKKKHAAEISPLEAADYTWSNAFQIAMDRWHITLEPGRYQQ
                     APIAATKVELSPEEMTARIKKICRWFGCEQVGICEVTEDMKPFFYSVGRTRGTYTTGH
                     ANYVDNGREIPWPYPYKYCIVMADKCDTDTLNALTGPLVEASAKIACSQSDFAPHYLE
                     SIIRSLGHDAKANIFSDTDIMDTPFAVKAGLGELGRSGLVISPWGAQMRIMEVFTNLP
                     LVPDKPIDFGLQEFCKVCKKCADNCPASAISMDDEPSEVDTVVKSIRWFQDGKKCLAQ
                     RLAYGCSKCQGVCPWSKPDTLIHEVGRMVGQNPAFAPFLVKLDDFFYNRYPEGHATGE
                     WAPWR"
     gene            174984..175583
                     /locus_tag="DEHABAV1_RS00950"
                     /old_locus_tag="DehaBAV1_0174"
     CDS             174984..175583
                     /locus_tag="DEHABAV1_RS00950"
                     /old_locus_tag="DehaBAV1_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308793.1"
                     /db_xref="GI:499628059"
                     /translation="MVHQNLLSETSMITRTQSAELEKAISGILPSETAKLIDLVDQMF
                     DDYIRGAIHHNEIRRLIGIIQNKAGKAQTMPRSCAPIAIFNPISFIPPGITLLEAYLK
                     LNGFVPVVLGLDEQTIKKMAGQIHPTVVVSLTLFHHIDKLAKLKPCFEAAGLNVLAGG
                     VPFMYQNQNKDKLSFCSFPDSFKQIVCKLSEDLLNENRK"
     gene            175567..177360
                     /locus_tag="DEHABAV1_RS00955"
                     /old_locus_tag="DehaBAV1_0175"
     CDS             175567..177360
                     /locus_tag="DEHABAV1_RS00955"
                     /old_locus_tag="DehaBAV1_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011928682.1"
                     /db_xref="GI:500355101"
                     /translation="MKTENNKVGVVTCVSMSNFVKNWALHRNLDARIYPITNSCFYSV
                     KIEMLSYYIERAILENGYCILNYGMCNESITQLKNHYAGRLSVVELDNCYEAAIGTAI
                     YHERIEQGHIFRNPTTMSCWHNMPTLEVMQPVEAGIYPAPITFILENGEEEKAASYVN
                     NLKNTTILDYSVEILHPQPHFLEDKLDQAYAQIQLASDEEDETSHQLIFPFSFHNSDE
                     YLYILDKHDNVIFSPYVAPATPNQICEKLLQLILSRQPDRSFQVKGLDSLLKQRGLYL
                     DKCKRFANRSSLTTEYEIIQNGESTWIKEILWVSYDDNCSISNICGRMEDITKVKTSE
                     KSIAESYTKECLLRQALQDETKKRQAHLKALVHEIRTPLTPLLAASDALVNVSEKGTE
                     LYNLASSIREGAETLNSRIHDLIELERGKIGMLKLKMAGYSIEDIMEELQLRYMPIFL
                     KQHKSLVFCDETANSEIYCDKERLLQILTNLIDNALKYTKPEDSVSVATRLDNESLRF
                     TVSDSGAGVPACLIPDLFTEYGKLSGGHNLSGLGLGLPIAKLYVEAHGGNIIYSPREP
                     KGSEFSFTIPVKTVSRNERDNIRIANEYFNS"
     gene            177341..178021
                     /locus_tag="DEHABAV1_RS00960"
                     /old_locus_tag="DehaBAV1_0176"
     CDS             177341..178021
                     /locus_tag="DEHABAV1_RS00960"
                     /old_locus_tag="DehaBAV1_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011308791.1"
                     /db_xref="GI:499628057"
                     /translation="MNILIVEDNDAAASTISSILKLSYHDAKITICRTGYEALESINS
                     DKADLVMLDLGLPDMNGLKVLDEIRPITGAPIIVVTACEEEENVLKALEQGADEYIIK
                     PFRHLEFLARVKKALSKNISPNTAIIKFGDLTIDCAKHELTFRNDRVLLTRVETMIMS
                     LLLQRGGQIVDYRDISDTLWGHAYPGSDESIRVYVSRLRIKMEKNLKTGGIIKNEAGI
                     GYRLSFAE"
     gene            complement(178307..178747)
                     /locus_tag="DEHABAV1_RS00965"
     CDS             complement(178307..178747)
                     /locus_tag="DEHABAV1_RS00965"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015406798.1"
                     /db_xref="GI:505219696"
                     /translation="MKTKTLHFYTKIFYWLALACIPVVFSVLFMLNQTGGFPILKLDE
                     NIQSTFILVTNIFVFIFLITAERTPKILVKMNLDNANDKSIYTAFLFRLALVITLIML
                     GFMQAASRDTFILTVGPLVFGPLILLYFWPTARNWEKLKRELVK"
     gene            complement(178952..179650)
                     /locus_tag="DEHABAV1_RS00970"
                     /old_locus_tag="DehaBAV1_0177"
     CDS             complement(178952..179650)
                     /locus_tag="DEHABAV1_RS00970"
                     /old_locus_tag="DehaBAV1_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928683.1"
                     /db_xref="GI:500355102"
                     /translation="MGAFSINGTSLVTSSTGTSLGSTKYYPYGLTRSGSIPTDEKFTG
                     QKLDDTGLYYYNARYYDPTIGRFISPDTLVQNIHNPQCLNRYSYVLNNPLKYIDPSGH
                     RMVIPGNPPQNGIPFPGPEDPGGSSGNGSSDDSDDSDSNSGSFFETDGDNTAPPRMNA
                     VDAIVGTTILAAGAMMAVTGAIVFLAVFIPGGALAAPEVGLGFWTIGGLLISEGVKRL
                     FHIEYFYIPGLIGP"
     gene            complement(179904..>181532)
                     /locus_tag="DEHABAV1_RS00975"
                     /old_locus_tag="DehaBAV1_0178"
     CDS             complement(179904..>181532)
                     /locus_tag="DEHABAV1_RS00975"
                     /old_locus_tag="DehaBAV1_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004397294.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377929.1"
                     /db_xref="GI:755024986"
                     /translation="EAMAFDFCEDYHDQVTGWGTYYGPMMVFNNGDGTATEAPSITRI
                     TEEIISYWSDRSKTAKHPILRTRYADLVWDFQKRITGQAPHYSMAQIVIDSTIEIAQR
                     NCHSVKVDVIKRLERALSIAIALNDDDRLQRVADATIAYEDAVTDDSKPGLWGFAWDM
                     LFDNDKVKLTADQRQKLIGDLEGHLQRASNTTDEGDIDPWLVEAAALRLAKYYRKTGR
                     GEDTKRVIIAIGEAFGQASSKGSGLQASAWLQRVHSTFKEFGLTDEAEKVAIQLREVG
                     EKAKSELKSFSYTMEVPKEKLEQYIAALTEGELDVALKRITAHFIPKKSEVEKQLKEL
                     ASKAPVAFLIPHELQDDMGRPLAKVGSLEEDLLGHTVKQMSQNMGIESIFLRQALEAL
                     VKKYPAFENLCLDYLFRSPIFKDDRKPIIQQGLKEYIDGHHMEAVHLLIPQIENALRV
                     LVETAGGSILKPARGGGFHLKVLDDLLREPIVTQVFGEDMVFYFCTLLVDQRGWNLRN
                     CVCHGLCDASEFGPRMSDRIMHVLLCLALVRKKE"
     gene            complement(181715..182533)
                     /locus_tag="DEHABAV1_RS00980"
                     /old_locus_tag="DehaBAV1_0179"
     CDS             complement(181715..182533)
                     /locus_tag="DEHABAV1_RS00980"
                     /old_locus_tag="DehaBAV1_0179"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928685.1"
                     /db_xref="GI:500355104"
                     /translation="MDWNFLTGLGTLILAIATILYVTQSRLQTQVLMKQVNLQIGQQI
                     PRLFIRQVTFEANSLKMEIQNAGSTPAYWVGLETRFFVIGQRLYSDQHSDNEINWGEA
                     VKLHEQGNTIYSKYFWTGPTKLRFENKEVDADTAVSFLSPQGVSVYFPPNSVVLTETR
                     PMFLVSWKGDQGLPASKGFEYNEFREFLLSNNIRAVAVVMSLMCKDAGETVHGQGYVA
                     SFVVRTDLDHSLVESSKNSHRFDFIPLSHEEQLSGNSWTRYDDYRNTFSNWHVF"
     gene            complement(182628..183593)
                     /locus_tag="DEHABAV1_RS00985"
                     /old_locus_tag="DehaBAV1_0180"
     CDS             complement(182628..183593)
                     /locus_tag="DEHABAV1_RS00985"
                     /old_locus_tag="DehaBAV1_0180"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928686.1"
                     /db_xref="GI:500355105"
                     /translation="MTTSFKNVLILRTLISLCKNDRKLPHVFYDLGYTQIRIDKTIRL
                     PDNKTVEPDLIMSSRQQNHSIVWESKSGRNIENDQARKLAQVTENIFTEQLLFNLRTD
                     GSFVFDVAYACDDGQCQNIRIDLNRLSNGHSTVGEFPIVGFSQDRVIKHSGQFKHSTI
                     ESVFNAGISVDLNEIPVAYLPFDKDCSLSEIAPFVIRSLVSYVTSQEGNFSSEQIAKE
                     SYGSGWEYIASNRTKNELVHKVEEILVEGTRNELRGYLSKTGRGKTRSPKWRLSYANV
                     KGGAYPAGRLKKLQRRCKEFVNRLRIEESGVKQLRLPLFLEDEPI"
     gene            complement(183577..184734)
                     /locus_tag="DEHABAV1_RS00990"
                     /old_locus_tag="DehaBAV1_0181"
     CDS             complement(183577..184734)
                     /locus_tag="DEHABAV1_RS00990"
                     /old_locus_tag="DehaBAV1_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013799535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928687.1"
                     /db_xref="GI:500355106"
                     /translation="MIKAELRRTRLDMASYLQEKMRTGYERYLDEQKLEWEGGLLKTY
                     LVEADVITRPSDSHNQIFSFLQKQTAALNYTAEQLDEENFFALIARSRVSRQAKSDIF
                     YIDASDYRFWITYSIGHSSRTDRFIDKFVSHSPKLDNAWFPMQFLSKLADTKGIFTGL
                     GGRFNNSPFTKDEEEQLRISLKLWGNLAKDVFDAFQKSDMLKRAFSLSNVRLKRYLQN
                     TDESVTDDINYSGKITSMGQSFDSHLDLVNSIYREEYRNTLVGIIEKELAIGFDTDSS
                     GGFLKGEPIFVSFQKTIPNVEKFVKDLFSGTSPFRLWGLQEMVKKDFARIYAVDMHLG
                     RPLTFEVFPDTIRIFLHSGTCGNSIIRFFTLFQHHYDSSAELSGGKHDHLF"
     gene            complement(184727..187846)
                     /locus_tag="DEHABAV1_RS00995"
                     /old_locus_tag="DehaBAV1_0182"
     CDS             complement(184727..187846)
                     /locus_tag="DEHABAV1_RS00995"
                     /old_locus_tag="DehaBAV1_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012991535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928688.1"
                     /db_xref="GI:500355107"
                     /translation="MNEERLSRLIEEFTSKNLNLFFRGKCENFAETPEDLRRYDDDRF
                     SDFQKLGEIRFDSDDKLVITSSLASGDLSERSGKKAQYEKAKKILKELAVYDAGFFIF
                     YDRSGSFRFSLVYAQFQGTKRSFSNFRRFTYFVSKDQTNKTFRIRVGGCTFSSLEAVM
                     DAFSVEKVNKEFYNHIARFFYRLTGYDRKREMTLPSVSDDDKETYQEFAVRLIGRAIF
                     CWFLKHKKSTNGVSLIPESMLSSESVKQNEQYYHSTLEKLFFEVLNTPLEQRHKNILP
                     DADKIPFLNGGLFEPHTNDFYSGKPLYNLVIPDQWFEEFFEILEQYNFTIDENSTVDA
                     DVSVDPEMLGRIFENLLAEVNPDTGETARKATGSYYTPRIIVDYMVDQSLKQYLLSKT
                     KIDEDRITALLSYEAPESALNEREKASIISALDEIKIIDPACGSGAFPMGILHKMILV
                     LQKADPDLKLWLKNHLGNIEPGIFKDRLIERIRNENWEYVRKLLIIQKSIYGVDIQTI
                     AVEISKLRFFLSLIVDEQIDDLKSNRGVEALPNLEFKFVAADSLIGLPPVMNRQVGLG
                     IVNEEVVRLKELRSKYLRSYGTEKKQIERDFLETRGKLIEQNINWGNKDALALQLVNW
                     NPFTNEASEWFDPDWMFGEDRFDIVIANPPWGVDLSKETKLLLKERIPEIDSSTPNSF
                     AYFVGMANRISKLNVAFILPDSILIKDYAKTRKLIAPKLLSLDWYQNTSVPENFRPFI
                     YVEHDVCVIIFNNENKEDIRCCKHEYDSQAKSVVHNEWAAQKSEMIFPEYDYVFNLML
                     EEKDRLIHEKLLKYKTIDSFAQCHEGIHTGNSRDILFVKGRKNGYCKPLFYGGRAGDF
                     IANYVSKTSGWYVDYREELIDKDRGYYASLRDENIFKYPKIYITRTGNPFKCFYDENT
                     YASNNFFSLQFKTKSENTKENLLVLLAIINSKLTQYFIRTFPAPRLGDTYIETKIIHL
                     LKVRAPNMSKELKDDFLPLIYQILAKRESNIEADISILETKINHMVYELYGLTPEEKA
                     VVEGRAQDD"
     gene            complement(187849..191217)
                     /locus_tag="DEHABAV1_RS01000"
                     /old_locus_tag="DehaBAV1_0183"
     CDS             complement(187849..191217)
                     /locus_tag="DEHABAV1_RS01000"
                     /old_locus_tag="DehaBAV1_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_011928689.1"
                     /db_xref="GI:500355108"
                     /translation="MSTDTTFITNEGNKKLKDRIAELIAHSKELKFLVGFFYFSGIRE
                     LYTSLKNNPNIQLDVLVGLNVDKTVHGLTEYGDTTKGLTDKEKFEQFLGSISKSINSD
                     DFDNQVFYDQARFFLEAIKQDKLRIRKTYDPNHAKLYIFKLKDELATIKKAFFITGSS
                     NLTKAGLSHQNEFNVEISDYGAKEAEDYFDELWEEAVKVTEIASFKDRLINLLEKKTL
                     LTEVTPYEAFALVLKTYIELQEQKQIKQSLVDLLKKKGYRAYKYQTDAVAQAISILDQ
                     YKGVIVADVVGLGKSIIAGLIAKSLGKRGIILCPPGLIGDDNAASGWRKYREDFALHD
                     WEIRSSGLENLKKALDLVRSNPEYEVVIIDEVHRFRNQDTEAYEVLSNICRDKLVIML
                     TATPFNNTPADILSLLKLFIVPGKSNITLANDLTARFRSYTQTFRRLSNIRKNCNSPS
                     LPKRNQAIADYEVMFGANKIDLNNVRDRTRYLSKSIRNVISQVTIRRNRIDLRKDPEY
                     SKEIYELSDVQDPCEIFYELTPEQSEFYDRVLQDYFGERGQFTGAIYQPFLYETGQLE
                     PDEETLNQAENRESLIQRNLYDFMRRLLVKRFESSFGSFRQSIINFKSVTEKVQTFIE
                     NSNGKYILDRPLLEKIYEADIDEIEEELAGFEQRISEGTFPKTEKVYKVNDFISKDKF
                     NTDIQSDIDLFDQILDELDSLKLVNKDPKLKKLATEVKNILKKKDNPEEPERKIVIFT
                     EYIDTARYLEAYLEKEFPSCCITVKGDLNKTKSDEVLRNFDTTHKKPEDSYKILITTD
                     KMSEGFNLNRAGAVINYDIPWNPTRVIQRVGRINRISKRVFKNLYIYNFFPTLQGATY
                     VKSREIATEKMFLIHNTLGEDAKIFEPDEEPSASQLFKRIMENPDNMEEESFQTKIRQ
                     LYADIVVSSPEVIKRISELPPRIKVAKNFNENNLVLFIKKGLGLFTRGILSDDKKPQD
                     LVFENTLELIECKKEEKAIPFSDSFWDSYYNVKEFKETSGPPSSEISIEKKALNNVNT
                     LLQGKIPELESYLPFLRELREDILEYKTLSDYTLRRIANLNSLNKDNAKIQKTKDELE
                     KLQQELGADYLDKVKSKLGQLQTEVIIAIENVKE"
     gene            complement(191288..191470)
                     /locus_tag="DEHABAV1_RS01005"
     CDS             complement(191288..191470)
                     /locus_tag="DEHABAV1_RS01005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_042377527.1"
                     /db_xref="GI:755024575"
                     /translation="MSDNKPGAILTVDEISVYLKIPRSTIYKLVREGKIPAQKIGRHW
                     RFRKEAIDHWLENKKS"
     gene            complement(191603..192088)
                     /locus_tag="DEHABAV1_RS01010"
                     /old_locus_tag="DehaBAV1_0185"
     CDS             complement(191603..192088)
                     /locus_tag="DEHABAV1_RS01010"
                     /old_locus_tag="DehaBAV1_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928690.1"
                     /db_xref="GI:500355109"
                     /translation="MSKNINTMIDDLVGTLTDPIIVYPGGWGDSLPEWLKNAITLERL
                     TENMKGSKGEQPSGTDAEACAYLNTASLTMPMDSDWSQIYLYVAGKTYTRWRKGEMPK
                     DIRVDSLNNQQMADLNRLKEWLYCRRTTAKQELERAERRQQKEEEVAKRESEQPALFE
                     F"
     gene            complement(192130..192447)
                     /locus_tag="DEHABAV1_RS01015"
                     /old_locus_tag="DehaBAV1_0186"
     CDS             complement(192130..192447)
                     /locus_tag="DEHABAV1_RS01015"
                     /old_locus_tag="DehaBAV1_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928691.1"
                     /db_xref="GI:500355110"
                     /translation="MNSLFVINAAFNTGQIVATRGVFDLACENPEFAQFIQKSLNRHV
                     KGDWGDVDDEDKQTNDQALKQGTRLLSAYNDERFPKNGVATIWIITEADRSATTILFP
                     DEY"
     gene            complement(192501..192983)
                     /locus_tag="DEHABAV1_RS01020"
                     /old_locus_tag="DehaBAV1_0187"
     CDS             complement(192501..192983)
                     /locus_tag="DEHABAV1_RS01020"
                     /old_locus_tag="DehaBAV1_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013218620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928692.1"
                     /db_xref="GI:500355111"
                     /translation="MATGQMDLFDGVKLAEPEPTTTVRLGRKAAQIPLRKKRREAIKR
                     LMEILEELEGKDIYIGSYDAGGRHFWLDNLKLPRLQMEWHPMRLKSDQTYIPSVIVLW
                     GSKSAAVRIFTDYLVAVREQEYQGYWHYLLDFRNGFWQSPIDNFRSHYSCLHITRFKD
                     "
     gene            complement(193054..193389)
                     /locus_tag="DEHABAV1_RS01025"
     CDS             complement(193054..193389)
                     /locus_tag="DEHABAV1_RS01025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377531.1"
                     /db_xref="GI:755024579"
                     /translation="MPIKWNALMVNEAMDMVEEYVNQAIEPLEQAKLVAVEARKIPNL
                     PGYIDQHLSRLIGEIERVTGGISPWNQQPHPGNVRSAISSVRESIPSGTVEAERQKVN
                     SGKQLSLVS"
     gene            complement(193457..193645)
                     /locus_tag="DEHABAV1_RS01030"
     CDS             complement(193457..193645)
                     /locus_tag="DEHABAV1_RS01030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377533.1"
                     /db_xref="GI:755024581"
                     /translation="MADTDTIFVLSKVDVIDCAREMGIPEEAITDDILAQVKKGVEWG
                     LECWSDVVKEAINMALKS"
     gene            complement(193972..195231)
                     /locus_tag="DEHABAV1_RS01035"
                     /old_locus_tag="DehaBAV1_0188"
     CDS             complement(193972..195231)
                     /locus_tag="DEHABAV1_RS01035"
                     /old_locus_tag="DehaBAV1_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_011928693.1"
                     /db_xref="GI:500355112"
                     /translation="MNIEGKRSGEGFCAHKTILVNALSRALAERVVLMDFTIGRKGFL
                     TYIKSLGGSNVVKVVPSSNGDASGLRVADKRLKVVCGANTSYLDDMAWVGEKTPLTLC
                     DVRVSPSNAVKPNLGALELSEALSRVVPFTAKEDNRPVLQSVLFKVADGKLTMVSADG
                     YRLAMVKLDFDGDEGQVLINRDELRGVISALRRAYRVRVGFEKSGESLDGMSLVLDTE
                     LIRYKWRGADGNFPEYEKLIPANFNTFVSFDTNEAIRAVSSLKVLSDSKAYPIDLTIG
                     NGKLTMSSPDDKGMAEIPADTQGDGKIRLDGSYLADALRACGGMVELKLVDSKSPMLF
                     TSPDYELVVMPMFAGESQTPKGEAQTAEPVEVETEPAEDTEPTEPEAEMVSEAEKANA
                     VAEAEAITKAEKPKRKRSKAKEPVAVA"
     gene            complement(195367..195978)
                     /locus_tag="DEHABAV1_RS01040"
                     /old_locus_tag="DehaBAV1_0189"
     CDS             complement(195367..195978)
                     /locus_tag="DEHABAV1_RS01040"
                     /old_locus_tag="DehaBAV1_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928694.1"
                     /db_xref="GI:500355113"
                     /translation="MVTLCCPQDDNPLSYDRLNGEWAQWFRTAQRFEHKVPAQDRGDI
                     RHSIILELALTRARNGNKSFSEAMMCRIASCVVALYWRKQYKLTNGLDCGSCSQKQRA
                     KCKAGYLYGECPKAIKIEYLSKPITDGDGNVTEFGNTIADDKAIDVGAWIDARTFLLS
                     FPNRLVEIAYKRLEGTPLDKKDQKYLERFRRHEQIRLLQYVAN"
     gene            196354..197508
                     /locus_tag="DEHABAV1_RS01045"
                     /old_locus_tag="DehaBAV1_0190"
     CDS             196354..197508
                     /locus_tag="DEHABAV1_RS01045"
                     /old_locus_tag="DehaBAV1_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic"
                     /protein_id="WP_011928695.1"
                     /db_xref="GI:500355114"
                     /translation="MDTALFKNSPSGKLVRAAGGYWAFVPNSLPSTIEWDTALVSQVS
                     RADLAVGTLSGLGETLPNPHLLIYPFIRREAVLSSRIEGTQSSLSDLLLFEATQIEKQ
                     RDVREVQNYVRAMEYGLKRLNELPLSLRFIRELHGILMEGVRGEHATRGEFRQSQNWI
                     GSAGATLNEATFVPPPVPEMLECLNQLEKFLHADTELPPIVQAAMVHYQFETVHPFLD
                     GNGRIGRLLVTLLLCQKNVLAKPLLYLSAFFEQHRQEYYELLLKVSQRGAWREWIEFF
                     LKAVTEQADDAVSRSRRLLDLLHQYSQMAREKRLSPTAGQLVELIFMKPVLNAKTAQE
                     FLKVSYPSAQYALSSLEEAGILTEITGRKRDKAYSAKDVLKALDGETTRE"
     gene            197565..199514
                     /locus_tag="DEHABAV1_RS01050"
                     /old_locus_tag="DehaBAV1_0191"
     CDS             197565..199514
                     /locus_tag="DEHABAV1_RS01050"
                     /old_locus_tag="DehaBAV1_0191"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928696.1"
                     /db_xref="GI:500355115"
                     /translation="MSKKQNKGKENKHILEDMGNSMSVESLFSTYVLLDTFLSSGLMS
                     KAKSFDTKMKGRHAREAFRQGYKLLLIASLDNYIDEIIRSPELIGIDPDLDYRDYWAF
                     TKGRGREITRAVARPGHHISKFVGRASSYIDEILTLDTWEGIEAFGERTKSFRDCLRL
                     ISEKAYVVSRGGRKVDVRNAILEASSTILWSNSGNPLPIAHMYTDYFIGRKNDEVGIH
                     DLDEIVRECESSPGMTRLDFSRVDPTFFPRPLPAQWALGYAFILHESLKMLTPDNKHV
                     ASLKSLDEFVLNTKNWDDIEKYDKKLETVYGLPKIFRGYGYAMHHIITDDDRQALIAD
                     VEGPSSPERLLSIFGNRARIVERGSPGAFGSFECLLDGALKRSARTKEKAKVAIIVHK
                     NYREQEDYSTAIFMPAYGGGWISTNASMWWVFYLIGNNHSGGASYRWKLVFNKIKRNR
                     RAIDLTVIYAGEEEFYKYCEDPGYLRLNNAVVLTNRVANDVRGAFPELLLANMLTNMG
                     CRIVRIGFEPKLLKPLKGELDVLGVKYANDSPQRILLFESKGQATVDDELQKEINRFS
                     KNVETVKENLESFCSELELPHSDGVEIEATFVSMDTLEYVTNIEVPSNVKLWNFNDLV
                     SSLKRNKIPPKYLELLKMNRVAVSM"
     gene            199571..201061
                     /locus_tag="DEHABAV1_RS01055"
                     /old_locus_tag="DehaBAV1_0192"
     CDS             199571..201061
                     /locus_tag="DEHABAV1_RS01055"
                     /old_locus_tag="DehaBAV1_0192"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928697.1"
                     /db_xref="GI:500355116"
                     /translation="MEHFVIVPYLKTSETVTIRGIQFRSSLDLTSVPVSAQQHLTTLF
                     PMFFLKDDLHIKQMSYAYLKVDNEKDLERLKKRLSEVHHLLAFLYSSPHPTLLDPFLK
                     EEHATLYTFIPEPVSQFLIYPEDRNLECVSPEYPYPKPDDRHEMSGYTGTLNSESIIW
                     VTRGSRIYPPSGRFWLNLSQDLYADLLRGSSSSHGSGAWSLLKASEPKFGPIEDRIFT
                     ALNWYNRSNSICSSDEAALLHLAIAFESLLSLEQAPQITQRFKDSVRLLVGPVPKLEN
                     WADQFYNARSRIVHKGCGADLAFYALGTGSKVSAQYRSLISLGRSIFRICLNAAVAGA
                     DMACKTGLASLLITNQERFENICKTLSSVKPGASDALISLNKEITDIDEYKFVPEDNL
                     RIDTIIAANRLAAQYFIGKNPNVSQELITLFSDLANAASSADHFLELQAVSKIADYIG
                     AYNAPQYTSPVNDTDLIFSLTRSVHHYAFMHYYSLKEQREKNQNAK"
     gene            complement(201126..201662)
                     /locus_tag="DEHABAV1_RS01060"
                     /old_locus_tag="DehaBAV1_0193"
     CDS             complement(201126..201662)
                     /locus_tag="DEHABAV1_RS01060"
                     /old_locus_tag="DehaBAV1_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928698.1"
                     /db_xref="GI:500355117"
                     /translation="MVIRLAPTRGGFLRPFGCGWFIREYLLGNGPEGSRKVDPRRGAP
                     QADINFEYKEALARATARERAERIISNMVVKHADVTEAEAEKIYQRELKRVSRKFTHM
                     RYHSFLMYFGVLKRLGWVEVTNRTEASTIQDNYPSAPERTYYRLTKKGIDAGEDLWSN
                     PLFTLYPEIGSSHMKKVE"
     gene            complement(201666..203210)
                     /locus_tag="DEHABAV1_RS01065"
                     /old_locus_tag="DehaBAV1_0194"
     CDS             complement(201666..203210)
                     /locus_tag="DEHABAV1_RS01065"
                     /old_locus_tag="DehaBAV1_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928699.1"
                     /db_xref="GI:500355118"
                     /translation="MAGQVKITIEDKEWLASLSSTYWELVQGLGDIPGMDAGTGMLFD
                     LSYTQYITVTTEPMLFPLDIAFLSEDLVITEIYHNVEPGYLVHATMPSRYFIEVNAGE
                     MEGIEIGEQVSIELLALQDIPTEPDWVSAMISFTGFTLMGFLIVGMVKDMVRKMSDES
                     TKTLPARSYATTPVYNRVSKSVSSGECAFCANSGHQCNVCEKISPRDYHLLSWVGAPV
                     PDYSFTVEPETKERKIDDVLKRLKEGVDGIQQSENFRTFLLTMSKFHEYSIGNLILIM
                     LQKPDATRVAGYSTWKDLYRWVKKGEKGIAILAPCMPPKKKELEPSESVNAPDAKEKQ
                     EEETEIRPIYFKVVYVFDVSQTEGKPLPEFEVPPLTGDANEDLFERVMHLAELQGLDV
                     SFEPKPDQDPDIKGFYTGKTIWVRPEESRAQQLKTLLHEVAHYYSEGVFRIPRSDAET
                     IAESVAFTIGAHYGFDTGARSFPYVAIWSKDKKVLEANLAAIRKVSEKIFDGLEQTTK
                     KPVGVA"
     gene            complement(203210..203515)
                     /locus_tag="DEHABAV1_RS01070"
     CDS             complement(203210..203515)
                     /locus_tag="DEHABAV1_RS01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377537.1"
                     /db_xref="GI:755024585"
                     /translation="MGKYANHEEFGINAPINYREDSTSESFLKGMSAIAPSGMKPKVS
                     RGKKFEEKTDFKASARWHKNFDLAMFGGSDIGTSDFESRQMSLEGKINGVKRIPGRH"
     gene            complement(203508..204203)
                     /locus_tag="DEHABAV1_RS01075"
                     /old_locus_tag="DehaBAV1_0195"
     CDS             complement(203508..204203)
                     /locus_tag="DEHABAV1_RS01075"
                     /old_locus_tag="DehaBAV1_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011928700.1"
                     /db_xref="GI:500355119"
                     /translation="MKAYLEPEEVERLEQSAEYMRDRLLIRLLFHLGCRVSEALGIKV
                     SDIDFKQGLVTIQHLKQRIKLSCPKCSARLGKGHKFCPVCGQKVEKVVAEEKEHRKFR
                     NLPLDTVTLGMLKEYIKRGGASSKKGNQQLFNLTRHRAWQIVKECAEKAALPDLINPE
                     SGKVHNVSPHKLRDAFAVHAVKLDDSGDGLRLLQEHLGHQSITTTMKYRKVSGEEQKE
                     WYEKLWQGGKQDG"
     gene            complement(204203..204676)
                     /locus_tag="DEHABAV1_RS01080"
                     /old_locus_tag="DehaBAV1_0196"
     CDS             complement(204203..204676)
                     /locus_tag="DEHABAV1_RS01080"
                     /old_locus_tag="DehaBAV1_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928701.1"
                     /db_xref="GI:500355120"
                     /translation="MVLDIVLKPMALSPQTFTVGDKVRVTVSFKYVIGVTATVKLFAG
                     PYYTNIFGKHMVNACVGQADLSLAATSTPTAGTATIDFLLIPKDQGGIEDGTYGLRVW
                     IEDTKAMAEQDNVIIVTGNPSSGDMFSSIMPMLMMLMMMGMIMPMTQQMGEGVEG"
     gene            complement(204687..205262)
                     /locus_tag="DEHABAV1_RS01085"
     CDS             complement(204687..205262)
                     /locus_tag="DEHABAV1_RS01085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377540.1"
                     /db_xref="GI:755024588"
                     /translation="MEVKTLALDLGLVDVLQDGLEPSPDPLTSGWYIDPRTGMRVFYD
                     TATKNFYTLAGGVYIPLGYMNPAPKQVALGPGEKLRITISYKYSGPSISGAIERFCIG
                     VYGTFGFNETLVGENTRSLPASTTPLPYTGSYTFTIPTSVGNDWDDIYCKIYGGSPGV
                     PQTLFGYEQALLIVGKDPTISEFTIADFAKV"
     gene            complement(205273..205656)
                     /locus_tag="DEHABAV1_RS01090"
     CDS             complement(205273..205656)
                     /locus_tag="DEHABAV1_RS01090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377542.1"
                     /db_xref="GI:755024590"
                     /translation="MAQYADIVEIVAPSQAAPGSRVDITIRIKNLYSAPIGVMVGGAL
                     EYGVSPWPGISFSEDSANVNAGVTYSFNGYFYMPENRVTIHAYSYWYGADGYWHVDDE
                     LTKVINLVTLTPQVSEFKISDFYKV"
     gene            complement(205657..205983)
                     /locus_tag="DEHABAV1_RS01095"
                     /old_locus_tag="DehaBAV1_0197"
     CDS             complement(205657..205983)
                     /locus_tag="DEHABAV1_RS01095"
                     /old_locus_tag="DehaBAV1_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928702.1"
                     /db_xref="GI:500355121"
                     /translation="MERLFIALVALVGGLVSALIGWLDSGEHFDPRKFGGSAVRSLIA
                     GVVFAVGYHLSGAVSILDLFYAFLGGAGIDVLGNRISSKLGNGSFPLPGSSSLGDSTI
                     SEKKDE"
     gene            complement(205983..206168)
                     /locus_tag="DEHABAV1_RS01100"
     CDS             complement(205983..206168)
                     /locus_tag="DEHABAV1_RS01100"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377545.1"
                     /db_xref="GI:755024593"
                     /translation="MGKMKLIPIIIELVGVAAIGTGIGVELATHADIGWTILTIGSCM
                     VAIGGVIWGKFMRGGNS"
     gene            complement(206168..207424)
                     /locus_tag="DEHABAV1_RS01105"
                     /old_locus_tag="DehaBAV1_0198"
     CDS             complement(206168..207424)
                     /locus_tag="DEHABAV1_RS01105"
                     /old_locus_tag="DehaBAV1_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_011928703.1"
                     /db_xref="GI:500355122"
                     /translation="MRYTVIAKGKPLSQVEVEVKKAGATNIRVAKLLGQIFCELDENQ
                     AKAIAQISGLSLKPIKEYKTDQVVAEMPPVESLADVFYMLRAYFNPPLTSTGLTVAVL
                     DSGIRKSHEALQNKVVYEANLTDSPSATDIFGHGTQVAFIIAGGFHAIGSKAGVSPGA
                     ALMNIKVISDEGIGNDEDIVLGIDRVCELAEEAREKGLWPTDDLYPNVINLSLGAEDD
                     GDPDNPVRSACRKASTEYGLDVIAAAGNSGPKMTTVMLPACDPEVIAVGAVETTGDLV
                     IWEKSSRGPTMQGETKPDFVIWGTNLEMASHKADDEYLTKSGTSFAAPMISGLTGLLW
                     ESGRRAYGESWQFRWTDARQYAPYFSTKPSDAPLNKDNAYGYGLPAMGTMLGEVSQVG
                     ASSQGGMEMLPMVMMMAMMSALTGGS"
     gene            complement(207438..208577)
                     /locus_tag="DEHABAV1_RS01110"
                     /old_locus_tag="DehaBAV1_0199"
     CDS             complement(207438..208577)
                     /locus_tag="DEHABAV1_RS01110"
                     /old_locus_tag="DehaBAV1_0199"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928704.1"
                     /db_xref="GI:500355123"
                     /translation="MLRGTIDISKFGKNGKENYSQLCRSFNRNFISLLYSGFAQVNYG
                     LTDIDGIYRTCEIDRDRPLLGVTQPALHLPFASQDMLGVQVGSSDAVAGPLDFDLGNR
                     VIHADASPETANVVMEGVRYTGSTSTRNIYAANWVIQTFHVPWAVNAYAIRLYCYRAG
                     DLSARTLTVSIRKTDGAWNPTGGELAVGTATGVELQGITTDANGQWFEVAMTSPCVLR
                     PYTRYCIIVRIDGGDYSNSLRWQYGGSGSSSGYRLYRGGADCSGSSSNSGGSWSLSDN
                     YHQSNYFLVMGRHSVGLCHYPTIVRTISFPTPPPDMQFTIERFFHNFSGSAITLRETG
                     LYASAPTSASYENFVYLIARDILTAPIIVNNDELLKVSYAVQISV"
     gene            complement(208587..209246)
                     /locus_tag="DEHABAV1_RS01115"
                     /old_locus_tag="DehaBAV1_0200"
     CDS             complement(208587..209246)
                     /locus_tag="DEHABAV1_RS01115"
                     /old_locus_tag="DehaBAV1_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928705.1"
                     /db_xref="GI:500355124"
                     /translation="MTDIEIKTQPNLKVIKEEIPHLLAEGEIGAILELTVSDKNGNIT
                     QKRVMKSESFVRQFLELLWVNFQNLDYRSGRYCADVYGGVACVRADRRLWTAGGAIGE
                     THRGILVGTGTNVPTINDYTIQTLISHGTGAGQLQYSAVTFGAPSSDATTSQFTVTRN
                     FANGSGAQVTVHELTLVVQSYADSNIQYSHMVIRDMIPGGIAVPNGQTLTVNYRIQVT
                     T"
     gene            complement(209261..210178)
                     /locus_tag="DEHABAV1_RS01120"
                     /old_locus_tag="DehaBAV1_0201"
     CDS             complement(209261..210178)
                     /locus_tag="DEHABAV1_RS01120"
                     /old_locus_tag="DehaBAV1_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928706.1"
                     /db_xref="GI:500355240"
                     /translation="MSLLIKIKGITRLSELEIDADKDWQTKGITNLKQVAAMMSKGDI
                     AVRDTSILVRLPPGPEDYCLTSAGSGKLPSWQPKGGMLKFYYPVYIASNHTESKPSVA
                     QSLNKPIIPDLDKRYAYSDSPSDNLRMFSPFVTLAKNSAIATVNQSHSKNAPIGRDIS
                     ILVDGAVSETSIGVQTDETAAARDSNGNDMNLCPMTPAVDDKYYFGFDRLFPRVWLNI
                     GMSGAGNWANVLEYWNGSTWVQASDEEDHTSDFTKSGINRINWTIPGDWARNTILGMN
                     LYWLRCRTITFVNQTVKPLGTQVWACLSA"
     gene            complement(210179..210436)
                     /locus_tag="DEHABAV1_RS01125"
                     /old_locus_tag="DehaBAV1_0202"
     CDS             complement(210179..210436)
                     /locus_tag="DEHABAV1_RS01125"
                     /old_locus_tag="DehaBAV1_0202"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928707.1"
                     /db_xref="GI:500355242"
                     /translation="MGIFWGTSGCLLVRPKTMHKLSELVIDTDKLWGEKGILNVKEIA
                     EGMTKGDMVFSDGVKLVKITPGSIGTMLTAHDLGNDLTWSY"
     gene            complement(210436..210903)
                     /locus_tag="DEHABAV1_RS01130"
                     /old_locus_tag="DehaBAV1_0203"
     CDS             complement(210436..210903)
                     /locus_tag="DEHABAV1_RS01130"
                     /old_locus_tag="DehaBAV1_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928708.1"
                     /db_xref="GI:500355494"
                     /translation="MPGEFYVETKGGKVNLVPIETSLTDLQAKVDAIKAQADKLAGEI
                     PGQGSTTADWQLSEADVVSIGTAGVRYKLHDLTVSIHNLTGTQIRVRFYKKVNDIERK
                     VYDQLFDASLDPPGLPVINGSWAIHGVLRVTLESNDAADNSKAVDYDFMLEAM"
     gene            complement(210903..211454)
                     /locus_tag="DEHABAV1_RS01135"
                     /old_locus_tag="DehaBAV1_0204"
     CDS             complement(210903..211454)
                     /locus_tag="DEHABAV1_RS01135"
                     /old_locus_tag="DehaBAV1_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377548.1"
                     /db_xref="GI:755024596"
                     /translation="MTTSLSIMSGELGDIFWDLPPAVSYIAGLDLGCSIYVANPTEIE
                     REYALIARLYKGETLISEEALPVFGYTWFKVEPGDFIKLNGALRFSESDASLMVLLVE
                     KDTEEVTDSVSTHLVQVSSSVLPPWPGSTATTTDWSSMLGFMLPFLMLGIMAVTLKPQ
                     SEKKESISQTKEERKLLPAGRQG"
     gene            complement(211451..211624)
                     /locus_tag="DEHABAV1_RS01140"
     CDS             complement(211451..211624)
                     /locus_tag="DEHABAV1_RS01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine permease"
                     /protein_id="WP_042377549.1"
                     /db_xref="GI:755024597"
                     /translation="MSQYPQEYYYTPADYQVTQWQGVLGTLMGVAILVAMAAWAFSLV
                     RKAIKGEEVKYPL"
     gene            complement(211621..212151)
                     /locus_tag="DEHABAV1_RS01145"
                     /old_locus_tag="DehaBAV1_0205"
     CDS             complement(211621..212151)
                     /locus_tag="DEHABAV1_RS01145"
                     /old_locus_tag="DehaBAV1_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928710.1"
                     /db_xref="GI:500355932"
                     /translation="MPYTMVPEGYRALLIGSATSIGDLGTFAPLEESADEGAFFLMRL
                     DLVDLPSAESLGQLEQGLIDAGVEIWPGYDHYVYAVQNEPVVYIVWQKGLAWIPIIVG
                     ILVTTVLPPLLMAGIWLILPAEVKSLITGFINLGMMALVMFIMMQVMKPLTASNKEKP
                     KKIEQPKQPKPEEVAA"
     gene            complement(212169..212756)
                     /locus_tag="DEHABAV1_RS01150"
                     /old_locus_tag="DehaBAV1_0206"
     CDS             complement(212169..212756)
                     /locus_tag="DEHABAV1_RS01150"
                     /old_locus_tag="DehaBAV1_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928711.1"
                     /db_xref="GI:500355933"
                     /translation="MTEKIVTQQYPGYPGTRPPKGWVPPLGQSLTLLGVYDNESGYWM
                     GLPLQVLREALLNAEALHTEDRIDERDKIEVTVPNVSAQDVVKTTEFEVPAGEVWFLN
                     RLNLITEAEVSGNIRISKFPKVSDIDKKYLGTDQAAGTDTDYDLATPGQLGADLRLVG
                     GEKITVVATVMAVGGTTADRKVTLNPYGRKAKRLV"
     gene            complement(212790..212987)
                     /locus_tag="DEHABAV1_RS01155"
     CDS             complement(212790..212987)
                     /locus_tag="DEHABAV1_RS01155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_042377552.1"
                     /db_xref="GI:755024600"
                     /translation="MFTAQQFAGQQIRPQQYQYGTVSGYYPAQTTDMTSMFSAMMPMI
                     MMIMMMAIMMPMMKGMTSSSK"
     gene            complement(213031..213240)
                     /locus_tag="DEHABAV1_RS01160"
     CDS             complement(213031..213240)
                     /locus_tag="DEHABAV1_RS01160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_042377554.1"
                     /db_xref="GI:755024602"
                     /translation="MYKTQQLTGPVAPGQMSPMQVSGPGAYYPTQTTDPWSGMFTSMM
                     PMIMMIMMFAIITPMLKGVTASSKD"
     gene            complement(213369..213581)
                     /locus_tag="DEHABAV1_RS01165"
                     /old_locus_tag="DehaBAV1_0207"
     CDS             complement(213369..213581)
                     /locus_tag="DEHABAV1_RS01165"
                     /old_locus_tag="DehaBAV1_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928712.1"
                     /db_xref="GI:500355934"
                     /translation="MGKYASWNEFEKNVPITYKEKATPEAFRTGMNGIAPSGLKVKEG
                     RVNHYRDGVDGKGEVMVSGYKRAMFE"
     gene            complement(213823..213999)
                     /locus_tag="DEHABAV1_RS01170"
     CDS             complement(213823..213999)
                     /locus_tag="DEHABAV1_RS01170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_012984043.1"
                     /db_xref="GI:502749059"
                     /translation="MPLLVERKLFKIGEGGFAVTLPKAWINYHRLKPGDTVEVVVDGD
                     LIIRVKVKPEEKLI"
     gene            complement(213999..214247)
                     /locus_tag="DEHABAV1_RS01175"
                     /old_locus_tag="DehaBAV1_0208"
     CDS             complement(213999..214247)
                     /locus_tag="DEHABAV1_RS01175"
                     /old_locus_tag="DehaBAV1_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928713.1"
                     /db_xref="GI:500355935"
                     /translation="MNSWFAPLQWLVFLALWRMSYETANINKLANSEKSFLIEKTPPQ
                     ETGNPREKEWTEKAVKKYADAQAKKWQHWNEAMFERSD"
     gene            complement(214240..214518)
                     /locus_tag="DEHABAV1_RS01180"
     CDS             complement(214240..214518)
                     /locus_tag="DEHABAV1_RS01180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377557.1"
                     /db_xref="GI:755024605"
                     /translation="MFDFMQMANSPQARDMLFKMMTRQMGQSPPDVKEAISKVEIAIK
                     RNERGFELRLGKSEHQQVEKMLQESTDSWIEMLSRGFQAVGYKVKIYE"
     gene            complement(214511..215332)
                     /locus_tag="DEHABAV1_RS01185"
                     /old_locus_tag="DehaBAV1_0209"
     CDS             complement(214511..215332)
                     /locus_tag="DEHABAV1_RS01185"
                     /old_locus_tag="DehaBAV1_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928714.1"
                     /db_xref="GI:500355936"
                     /translation="MDDQFLEEIKKRKEQGQSERQMATELGVSRSKVHNVLQDLKLTE
                     TGASLVPEDKLRVIIREELERVRNGEEEEAKTSSEFPIIRKMGGGMEMIAPEAVLKHY
                     MGGTPEGEVELRAIMKFRAAMLMVMDLVNIQKGSAEADARRMEPILRLMKETREEQDA
                     AAARAKASSEEIAERTAQATAGQLFGAISQSNTQVNSTLAQIKQMVGGQSNDPFSQVV
                     SMLQSMQQMSQMFGMPLPGMMPGAPQGGGPPGGQPPSDPPPIEKHTAKEWEERNV"
     gene            complement(215506..216429)
                     /locus_tag="DEHABAV1_RS01190"
                     /old_locus_tag="DehaBAV1_0210"
     CDS             complement(215506..216429)
                     /locus_tag="DEHABAV1_RS01190"
                     /old_locus_tag="DehaBAV1_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_011928715.1"
                     /db_xref="GI:500355937"
                     /translation="MKEGDMELITEIARFEASVDMEKEYRIGWSWRHVRVWPATLSRL
                     FKDGYLDNVFRSNSFTGYKLTEKAKAILLANQQEATTESQLESLVNPDDDLFTDIIGH
                     EDVKALLKAILLSEKPVHVMLTGPPALAKTLFLWDIEQTFGEQAIWLVGSATSKAGLW
                     DLVAEREPKILLIDEMDKMNAVDMAALLTMMEGGRLVRVKRGRELDINNPLKVIAASN
                     RLEKLSPELRSRFAIRKLNPYSRSEFLTVVKGVLVRKEGLPNDLAEEIARKLDGQSQD
                     VRDAIRIARLAPQVGVDKAISLLLGGEPCTS"
     gene            complement(216429..216743)
                     /locus_tag="DEHABAV1_RS01195"
     CDS             complement(216429..216743)
                     /locus_tag="DEHABAV1_RS01195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_042377931.1"
                     /db_xref="GI:755024988"
                     /translation="MTEATAEMMSRWLNQMLQGMCNDPVLEELWSAMKMGNQSSRTAG
                     IDSYRVLGLEKSVTDDQIKKRYRELVVRLHPDTAGVNGTEFLFQLVTAAYQQISKERG
                     WR"
     gene            complement(216857..217150)
                     /locus_tag="DEHABAV1_RS01200"
     CDS             complement(216857..217150)
                     /locus_tag="DEHABAV1_RS01200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377559.1"
                     /db_xref="GI:755024608"
                     /translation="MSKKEKRTLYECAHARVRNERICCDKEYPLSQTSVDGNLDIQHL
                     AEGKPLAPKICQQCINFDRIGPPVPEEERGWLKVKEVVKRDANHRQALREGVA"
     gene            complement(217143..219338)
                     /locus_tag="DEHABAV1_RS01205"
                     /old_locus_tag="DehaBAV1_0212"
     CDS             complement(217143..219338)
                     /locus_tag="DEHABAV1_RS01205"
                     /old_locus_tag="DehaBAV1_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928716.1"
                     /db_xref="GI:500355938"
                     /translation="MPELVFSEAVPQLLAEHLTHLSEGSGISLDVIKERGYRSILGKD
                     ELAKAGFTSSQQRTTGILIPLWGVDGGQVGYQYRPDNPRLDSRQRPVKYESPVGSSNH
                     LDCPPRCKQILGDPKTPLWITEGSKKADALATHGACVISLTGVWGFKGKNEFGAITLL
                     SDWDRIAIKDRLVYLAFDSDIVSKEMVRKALEHLGEHLSRKGATILVVYLPQEGNQKV
                     GIDDYLLNHTLEEARKLATDFKIDDTANRERFVPGFVLHDGTVGEMVVSKEDERAFII
                     VINGSVRKVFRYETPKAIYLPTDDPLVTEVVHFATTATPYDSQARLFEEIRSFVHKYL
                     ELSADFEEISSLYVLLTWVYEFAPSIPYLRVIGDWGTGKTRFLQVVGSVCFRPTFASG
                     ATTPAPIFRILEQFRGTLVLDEADFKDSSSWVEMVKLLNNGYRPGMPVLRADKENGKW
                     FPRSYQVFGPKLIATRFPFKDEALESRCLTSEMMSLTRDDIPRVLPPTFDKEIDDLRA
                     KLLTFRLANLIKLKGKTFGNDLLEPNLQPRLQEILIPLKAMLNGDRSMVEAITSFVHR
                     LQDSLFIRRRESAPGRVLAALMELHEEGKELTSENVAKKANETDDEVEQLSAEKVGRM
                     TKRLGFAKERTGKSRQRLICWDESRVTKLIGSYGLQMALPLSQEKPSEPSLLSALATK
                     QADSNKGGSVYCPPYCPPKTEADSSVGADSRTERTVTDDELTKEASAGE"
     gene            complement(219388..220368)
                     /locus_tag="DEHABAV1_RS01210"
                     /old_locus_tag="DehaBAV1_0213"
     CDS             complement(219388..220368)
                     /locus_tag="DEHABAV1_RS01210"
                     /old_locus_tag="DehaBAV1_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928717.1"
                     /db_xref="GI:500355939"
                     /translation="MPIKGVTGVVRLPRLGKVRLGVKKENASGISYPCPTDHFVCPEE
                     VKKVFGEKPKELRIMFPTDDQTQWASQYLRCYSASRGLVCRGDGETAVAKIDTRTGEI
                     ANRESVETEMKEVTCNPAKCTYYQLARCRRVMNLQFLLPDCPGFGVYQLDTSSFYSIV
                     NVNSSLELIRGTCGRLSMIPLSLKLVEQEVQPEGKKKTVRVLSMTAPFSLVEIQRYAQ
                     IPPGQVLLLPPPDNEAPDDLFPDEILSKEEPAKTILGSDKDLMLLWDRVKSKVWQMDM
                     QDYQVSHWFQKNCNLDFHLTDLDPLTPPTRIKTEHLENFLKTLERYTDRS"
     gene            complement(220488..220730)
                     /locus_tag="DEHABAV1_RS01215"
     CDS             complement(220488..220730)
                     /locus_tag="DEHABAV1_RS01215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_042377562.1"
                     /db_xref="GI:755024611"
                     /translation="MVKVKLNRIAFEVAMSRKNLSQRDLAEKIGFSRSHLSHIINGRR
                     EPSPVLRRLILEYLPEYTFDDLFVIEENGSNVRTND"
     gene            220889..221284
                     /locus_tag="DEHABAV1_RS01220"
                     /old_locus_tag="DehaBAV1_0214"
     CDS             220889..221284
                     /locus_tag="DEHABAV1_RS01220"
                     /old_locus_tag="DehaBAV1_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011928718.1"
                     /db_xref="GI:500355940"
                     /translation="MMENFGEYLRTLRVEKRLSLREVEQQSGVSNSYLGLIERGQRPI
                     PGADILKKLAPVYDVPVRDLLKAAGYLKDEDISISENDEIEMAFNYVMNDPRYKSGTR
                     IKGGLTTDVKRFIVEMYEKATGKKLLPGG"
     gene            221289..222218
                     /locus_tag="DEHABAV1_RS01225"
                     /old_locus_tag="DehaBAV1_0215"
     CDS             221289..222218
                     /locus_tag="DEHABAV1_RS01225"
                     /old_locus_tag="DehaBAV1_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928719.1"
                     /db_xref="GI:500355941"
                     /translation="MKSFSDLRYFCEYIVNKYGSPSNASEDDKAQEFRKIYLRDLPLD
                     IRTLRAIASACGIYVNGVDSKNLPQNIRGYHDVFDDKRNIYYKKGDTKSGIENTVLHE
                     FREMIEPVFAELYTDYSPLRTNAVHLAANKFATAVLLPKEEFRDKVYELGFDVIALSK
                     FYSKSCSQVLLRMGEVLQGSVFLYSALYEQGPEIDNWILNYWTGSANNDDPEANIYGA
                     DGLFPRKGRAVVPGSLVEMVIKAKKPQLVRRITILDSQEDDGLVAIANPLVITGSLVK
                     VALVVVLSHSIGLLQPQIERLNPVEVEGFHKHL"
     gene            complement(223784..223859)
                     /locus_tag="DEHABAV1_RS01230"
                     /old_locus_tag="DehaBAV1_R0004"
     tRNA            complement(223784..223859)
                     /locus_tag="DEHABAV1_RS01230"
                     /old_locus_tag="DehaBAV1_R0004"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(223824..223826),aa:Val,seq:cac)
     gene            complement(223909..224403)
                     /locus_tag="DEHABAV1_RS01235"
                     /old_locus_tag="DehaBAV1_0217"
     CDS             complement(223909..224403)
                     /locus_tag="DEHABAV1_RS01235"
                     /old_locus_tag="DehaBAV1_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928721.1"
                     /db_xref="GI:500355943"
                     /translation="MKKFPKRTYSNPIQFFSDIGFILRNRRKLKESRLSGFPGPAFRE
                     RLMLAVTGVNECRFCTYAHTKMALESGISQSEVKALLDGDFGNCPPDELGAVLFAQHW
                     ADTAAKPSAKMQGKFEADYGAEKSGFINLYLRMIRIGNLSGNTADKLLYYISFGKMGL
                     DRQL"
     gene            complement(224517..225551)
                     /locus_tag="DEHABAV1_RS01240"
                     /old_locus_tag="DehaBAV1_0218"
     CDS             complement(224517..225551)
                     /locus_tag="DEHABAV1_RS01240"
                     /old_locus_tag="DehaBAV1_0218"
                     /EC_number="4.1.2.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_011928722.1"
                     /db_xref="GI:500355944"
                     /translation="MKIIDLRSDTVTRPTPEMKKTMCDAPLGDDVFGEDPTVNRLEKM
                     AAGKTGKEAALFTPSGTMSNLLSVLSQTRPGDEIILGSEAHILWYEVGGASAVGGVVM
                     RAVPNQPDGTIYLADIKDAIRGSNLHFPPTRLICLENTHNRCGGAVLSPSYTAGVANL
                     ARMRGIKVHLDGARLFNACVALGVSAKELCQGMDTVSFCLSKGLSAPAGSLLCSDQET
                     INRARKFRKMLGGGMRQTGVLAACGIVALETMIERLALDHAMAKTLAEGLFDIDNHTL
                     DKQIVQTNIVIFNPPFGLGADEFLEQAKQAGLLFTMGSHGRVRAVCHHDLSEADIQTA
                     LRRIAAMKKA"
     gene            225636..226538
                     /locus_tag="DEHABAV1_RS01245"
                     /old_locus_tag="DehaBAV1_0219"
     CDS             225636..226538
                     /locus_tag="DEHABAV1_RS01245"
                     /old_locus_tag="DehaBAV1_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011928723.1"
                     /db_xref="GI:500355945"
                     /translation="MLHMKAKTYLLLLLGVFGIAAASVFTRLADAPPVIIASLRMLAA
                     TLLLLPFAARPVYLAIKRLSRRNLLLIILAGFLVGMDQFFWVSSLEYTSIASSVILVT
                     SHPVLVAIMSYIMWREQLNPKAIFGVLAAFGGMVLINLATTQVGEQAFLGNMLAMAAT
                     IPTTGYLIIGRQMRNSIDFLPYITLLYGSAAFFLLAGAFISGDSFGGYPGTTYLMIFL
                     LAVVSQLVGHSSLNMALRLVPALVVSVAILGEPVGAIILGYLFLGEGLTFNEFLGGML
                     VLAGILIVMLNQPRTKKMEAEIPR"
     gene            226535..227257
                     /locus_tag="DEHABAV1_RS01250"
                     /old_locus_tag="DehaBAV1_0220"
     CDS             226535..227257
                     /locus_tag="DEHABAV1_RS01250"
                     /old_locus_tag="DehaBAV1_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928724.1"
                     /db_xref="GI:500355946"
                     /translation="MSPRNVYSRPEVIGKKSIVLEGKEIHYTLRKSRFSDLIRLAIRS
                     ATGLVVTVPHQYNMNGLDDILLQRSAWILKHQNKMNANRFVLEDGLHDGQQVPYLGKL
                     YTLRIKEGGERGHVSLAENTIHLLTGGKTPVEVMEKWYRHRAAGIVKTCLEKNASKMG
                     LSFGRLCIRAQKTRWGSCTSRGDLNFNWKLATIPPEVMDYVVIHELSHRVEMNHTDRF
                     WVIVEKYCPNWKALRKQLKTYE"
     gene            227481..227741
                     /locus_tag="DEHABAV1_RS01255"
                     /old_locus_tag="DehaBAV1_0221"
     CDS             227481..227741
                     /locus_tag="DEHABAV1_RS01255"
                     /old_locus_tag="DehaBAV1_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928725.1"
                     /db_xref="GI:500355947"
                     /translation="MSKKSFSTKEALAVAKTLGITFKNYDIEQFRMGMDVELEHGTRD
                     PHTNVTSDDPVMTGKIALAHLNEIEDYYTRLAKMEAEAGVED"
     gene            227748..228581
                     /locus_tag="DEHABAV1_RS01260"
                     /old_locus_tag="DehaBAV1_0222"
     CDS             227748..228581
                     /locus_tag="DEHABAV1_RS01260"
                     /old_locus_tag="DehaBAV1_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011308783.1"
                     /db_xref="GI:499628049"
                     /translation="MRFTEGHFKGCQEYNCYYQALLPNGSPKAIVLVVHGLGEHSGRY
                     SELAHYLADRSYAVYAYDHFGHGKTDGKAGYVSSYDVYIYDLISAFSMVQAKHPTSKI
                     FIFGHSMGGLITAAYASKNQYDAAGLIFSSIALKPNTGMPGVINQLIKPLSKIAPMLG
                     VRKINASTISHNKDVVKAYNEDPLVLHHRMSAQMAAEFLRICQDLPDFLKNISLPSLI
                     IHGEEDHLVNIKGSRELVQRIRSKDKTLITYPGMYHEVLNEPDCPQVWNDLFFWLENH
                     I"
     gene            complement(228810..229313)
                     /locus_tag="DEHABAV1_RS01265"
                     /old_locus_tag="DehaBAV1_0223"
     CDS             complement(228810..229313)
                     /locus_tag="DEHABAV1_RS01265"
                     /old_locus_tag="DehaBAV1_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron hydrogenase"
                     /protein_id="WP_011308781.1"
                     /db_xref="GI:499628047"
                     /translation="MFNVQSISLRKELVIAFLVMLGLATAAPLLGNQYLTGSLVNAVL
                     FISAVTLGWKNAVAIGLISSTIALATGLLPIVMAPMVPFIMAANALLVTSFSALRGKS
                     FWLGAGVGAVLKFAFLWATSSLILNLFIEQNVADKIAGMMGLTQLFTALMGAVIAYGA
                     LRLGKKI"
     gene            complement(229353..231074)
                     /locus_tag="DEHABAV1_RS01270"
                     /old_locus_tag="DehaBAV1_0224"
     CDS             complement(229353..231074)
                     /locus_tag="DEHABAV1_RS01270"
                     /old_locus_tag="DehaBAV1_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_011928726.1"
                     /db_xref="GI:500355948"
                     /translation="MVTLNIDNKQVTVPEGTTILQAAKEANINIPHLCYFEGLKSYSG
                     CRVCVVEIEGEPRLATSCSRKVAEGMKVNTHSARVRRARRTILEILLANHPQDCFNCE
                     RNQNCDLLRLAFECGVKKLRFEESEKRVLPIDNTSPSIIRDPNKCIACGRCVRVCHDI
                     QTVNAIGFINKGPDTMVATSMDRGMGNVACANCGQCILVCPVGAIKERSAVDAVWAAI
                     ADPAKHVVVQEAPSIRVSLGEELGLPAGTLVAKKMYAALRRLGFDAVFDTNFTADLTI
                     LEEGSELVERVKEGGVLPQLTSCCPGWVKFMEHYYPELAPNVSSAKSPQQMFGAVCKT
                     YYAEKAGIDPKTIVNVSVMPCTAKKFECQRPEMNDSGFKDVDYVLTTRELARMIKEAG
                     LDFVSLDEEPAEDLLGLYTGAATIFGATGGVMEAAIRSAYMLITGRELENLDIEPVRG
                     LEGVKTATLNVDGLELKVAVAHGLGNARALLEEIKEGTSPYHFIEIMACPGGCVGGGG
                     QPIRFDSSLKKKRGEALYEEDRNMPKRCSHHNPSIAKIYADYLEKPLGKRSHKLLHTE
                     YTSRPVV"
     gene            complement(231062..232315)
                     /locus_tag="DEHABAV1_RS01275"
                     /old_locus_tag="DehaBAV1_0225"
     CDS             complement(231062..232315)
                     /locus_tag="DEHABAV1_RS01275"
                     /old_locus_tag="DehaBAV1_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit F"
                     /protein_id="WP_011308779.1"
                     /db_xref="GI:499628045"
                     /translation="MKDLKIITRHLNTANSADIDVYLADGGYQALKKALSMTPEEVIA
                     EVKRSKLVGRGGAAFPTGLKWELTRKEKANPKYIVCNASEGEPGTFKDRLILKNDPHM
                     VLEGFIIAAYAVGTSQGFIHAREVYTQEIELFQKAIDQATERGFLGQNIMGSNFSLDI
                     QFYKSAGAYICGEETALFESLEGHRGIPATRPPYPVQVGLMDKPTTVNNVETLCNIPA
                     IINNGADWFASIGHPDYPGTKLFCLSGNVKKPGVFELPLGTNLKDLLEAGGGVDGKFK
                     AVLPGGISSSLLTETDISLDFKTLAKAGTMLGSGAVIVINSDTSMVNVASNVAHFFDE
                     EGCGKCSICREGTRRAAEILSRFSRGQGNRNELEWLLELHEVMKDTASCGLGQVALNV
                     AASAIRNFKGEFLAQVRKEEGVWLR"
     gene            complement(232317..232784)
                     /locus_tag="DEHABAV1_RS01280"
                     /old_locus_tag="DehaBAV1_0226"
     CDS             complement(232317..232784)
                     /locus_tag="DEHABAV1_RS01280"
                     /old_locus_tag="DehaBAV1_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron hydrogenase"
                     /protein_id="WP_011308778.1"
                     /db_xref="GI:499628044"
                     /translation="MESIWKEKVDGVITQSGSSRLSLLPCLEAVQEECGYIPHEAVNY
                     LRECLSIPSIDIYGMITFYSLLSTNQKGKYVIRLCNSLPCYLNGTENILDTLVDNLGI
                     EPGQTTLDRRFTLELVPCLGLCDQSPAMVINGVVYGKLTAQLVTEVLDELRTY"
     gene            complement(232999..233187)
                     /locus_tag="DEHABAV1_RS01285"
     CDS             complement(232999..233187)
                     /locus_tag="DEHABAV1_RS01285"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041223224.1"
                     /db_xref="GI:752551981"
                     /translation="MAQGLPSQQVIAAKQAAVQGAVYPALLYSSLLPFRNIFYIIAKV
                     FMVGDSQGLHCVVLYKKY"
     gene            complement(233230..233643)
                     /locus_tag="DEHABAV1_RS01290"
                     /old_locus_tag="DehaBAV1_0227"
     CDS             complement(233230..233643)
                     /locus_tag="DEHABAV1_RS01290"
                     /old_locus_tag="DehaBAV1_0227"
                     /EC_number="1.20.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="WP_011308777.1"
                     /db_xref="GI:499628043"
                     /translation="MENRLQVLFVCLHNAGRSQAAEAIFNNLSGGRVVAISAGTEPSS
                     ALNPEVVAVLKEDGINTDGLKPKLLSQDMLDKASRIISMGCDVTLSCPGHLYGQEDWG
                     ITDPRGKNLAEVRLIVGGIRQKVENLLAELEKSEG"
     gene            complement(233645..234310)
                     /locus_tag="DEHABAV1_RS01295"
                     /old_locus_tag="DehaBAV1_0228"
     CDS             complement(233645..234310)
                     /locus_tag="DEHABAV1_RS01295"
                     /old_locus_tag="DehaBAV1_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoU family transcriptional regulator"
                     /protein_id="WP_011308776.1"
                     /db_xref="GI:499628042"
                     /translation="MPRMGFDRHLKELENDLLLLGSMVGKAIDRSTQAMKERDIALAK
                     QVIEEDKLINCKRFEIEEKSIELMATQQPMARDLRIIVAVLNMIVDLERIGDHAAGNA
                     KIVLMLGEEPPLKPLVDIPRMAVKTQEMLNRALGAFINRDSAEAINVINDDDEVDNLY
                     DQVFRELLVFMAEDPHTISRATRLIWAAHNLERSADRVTNICERVLFVITGKSEELGS
                     SNY"
     gene            complement(234323..235078)
                     /gene="pstB"
                     /locus_tag="DEHABAV1_RS01300"
                     /old_locus_tag="DehaBAV1_0229"
     CDS             complement(234323..235078)
                     /gene="pstB"
                     /locus_tag="DEHABAV1_RS01300"
                     /old_locus_tag="DehaBAV1_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWN4.1"
                     /note="ATP-binding protein; PstABCS is an ATP dependent
                     phosphate uptake system which is responsible for inorganic
                     phosphate uptake during phosphate starvation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="WP_011928727.1"
                     /db_xref="GI:500355949"
                     /translation="MDPKIKIRGVNFFYHKHQVLKNINMDFPERQITAIIGPSGCGKS
                     TLLRVLNRMNDIVSGARLEGAVLLDNENIYSPNLDVVNLRKRVGMVFQQPNPFPKSIF
                     DNVAFGPRMLGTTAQSRLDEVVEKSLRQAALWDEVKDNLHKSGLALSGGQQQRLCIAR
                     VLAIEPEVILMDEPCSALDPVSTMRIEELMQELKQNYTIAIVTHNMQQAARASDWTGF
                     LLTGDLVEYGRTGEIFSRPRDKRTEDYITGRFG"
     gene            complement(235079..235930)
                     /locus_tag="DEHABAV1_RS01305"
                     /old_locus_tag="DehaBAV1_0230"
     CDS             complement(235079..235930)
                     /locus_tag="DEHABAV1_RS01305"
                     /old_locus_tag="DehaBAV1_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_011308774.1"
                     /db_xref="GI:499628040"
                     /translation="MLKFTSRSTQKVAFSLLWTAGIITLLILLLIIGYIIIRGLPGFS
                     WDFLFTPPAGGLAGDGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRLTR
                     FIRYGVQTLAGVPSILFGLFGFALFVTVLHFRFSILSGALTLACLLLPVLITATEEAL
                     KTVPRSYRAGAMALGATKWQSITHVILPAALPGIATGVILCAGRALGETACLYVTMGG
                     SAAMPDSLLSGGRSLALHVFYLATETNAIDKAMATAAVLIVIIVGLNALTNFISRRFQ
                     KRMSGGV"
     gene            complement(235923..236783)
                     /locus_tag="DEHABAV1_RS01310"
                     /old_locus_tag="DehaBAV1_0231"
     CDS             complement(235923..236783)
                     /locus_tag="DEHABAV1_RS01310"
                     /old_locus_tag="DehaBAV1_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_011308773.1"
                     /db_xref="GI:499628039"
                     /translation="MLPRYFTDKLAKYGVFITALVSILVLLAIAIFIIKGGLPLFGEV
                     NPLDFLFGQSWSPTYGEYGILSMIVGSLLVTLGAMVIAVPLGIACAILLAEVAPRRVR
                     DLLRPAVELLVGIPSVVYGLVGIMVIVPAVRNLGGTGYSILAAVLVLSIMVLPTIISI
                     SEDSLRAVPRTYREGSLALGASHWQTIWHVLLPAARSGVGASIVLGMGRAIGETMAMI
                     MVIGNAVIIPSSPLDPARTLTGNIAVEINYAAGLHENALFATGLVLLILILILNSLAT
                     LVLKRGEQHA"
     gene            complement(236858..237712)
                     /locus_tag="DEHABAV1_RS01315"
                     /old_locus_tag="DehaBAV1_0232"
     CDS             complement(236858..237712)
                     /locus_tag="DEHABAV1_RS01315"
                     /old_locus_tag="DehaBAV1_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-binding protein"
                     /protein_id="WP_011928728.1"
                     /db_xref="GI:500355950"
                     /translation="MNKIASNKKIMLPVTAIMLLALGVAGCGNDTDDNNDDNTTALSG
                     TINEAGSTTVQPLAEKLAAAFTALNPNVKVVIGGGGSSVGVKSVTEGTVDIGAASRDL
                     KDTETGLTKHLLAKDGIAIVVHPDNTAVNNLTIDQVRDIFSGVITNWSQVGGPDKAIH
                     VMAREEGSGTRTAFEELVMGADVRIVTNAVLQNSNGALKTALSGDKDAIGFISFGYID
                     SAVKALSINGIAATSENGKNGTYPIIRPLYFLTKGTTSELVQAFIDYCLSDAVQQIIT
                     EEGYLSVN"
     gene            complement(237752..238186)
                     /locus_tag="DEHABAV1_RS01320"
                     /old_locus_tag="DehaBAV1_0233"
     CDS             complement(237752..238186)
                     /locus_tag="DEHABAV1_RS01320"
                     /old_locus_tag="DehaBAV1_0233"
                     /EC_number="4.2.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylglyoxal synthase"
                     /protein_id="WP_011308771.1"
                     /db_xref="GI:499628037"
                     /translation="MERITLALVAHDNKKQEMVELVKKHETDLASLNLVATRTTGKLI
                     QASTSLNVTLLQSGPLGGDQQIGAMVASGVVTAIIFLRDPLTAQPHEPDISALMRVCD
                     VHNVPLATNVSTAEAVLHLIFEHPEELKEHRLKSQLLNSLNS"
     gene            complement(238395..240140)
                     /locus_tag="DEHABAV1_RS01325"
                     /old_locus_tag="DehaBAV1_0234"
     CDS             complement(238395..240140)
                     /locus_tag="DEHABAV1_RS01325"
                     /old_locus_tag="DehaBAV1_0234"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011928729.1"
                     /db_xref="GI:500355951"
                     /translation="MTRSLKWRLITLFCLLIAGCVGILSIFLSNHLENSYMDNLQSRL
                     IQEVTLFSRVVPEYITESPDSFDAGVKKLGASLDIRLTVIALDGQVLADSLQLPSEME
                     NHSTRIEFIDALASGIGISIHPSASLGYEMLYVATLVKSGQDVLAVARVALPVEEVYA
                     AVREVDRTILLGAVISILAAGLLAVWVAASVTRPVKELTAISRRIAQGQMDTIQIDVS
                     GKGEMEELAKAFRLMTERLRDSIKAVSSERDHLSAVLERMGDGIFLLDREGSINLLNH
                     ASERIFKLEAGGVIGHSFVEAIRDHEINAVFERAKSSGKQEMGFVELTAGKRFLGIIA
                     TPLVSQSGYLVLVQDLSELRRLEKVRRDFVANISHELRTPITSLKLLTETLQEGAASD
                     PDVAAGFIDKIHLEVDKLAQLVTELSDLSAIESGQAVLNLQPGDIRTAIKLAAERLSP
                     QAERAGIILGVELPETLPQVRLDENRVEQVLVNLVHNAIKFTPKGGKIKIGVRTQSQT
                     LVVYVTDSGIGIPEDDLTRVFERFYKVDKSRSGGGTGLGLAISKHIVQAHGGSIWAES
                     VYGKGATFSFSLPLA"
     gene            complement(240143..240835)
                     /locus_tag="DEHABAV1_RS01330"
                     /old_locus_tag="DehaBAV1_0235"
     CDS             complement(240143..240835)
                     /locus_tag="DEHABAV1_RS01330"
                     /old_locus_tag="DehaBAV1_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011928730.1"
                     /db_xref="GI:500355952"
                     /translation="MPEHKILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALSVYR
                     LFKPALVILDVMIPGIDGFELCRLIRAESSVPILMLTARSSEADKVNGLEAGADDYLS
                     KPFGMKELLARMRALLRRSQMLNSQADIAGGLKIGDLEIFIERHLVIRNGVALDFSPK
                     EFDLFSFLVQNRYRVFSREQLLEKVWGYDYPGGTRTVDVHISWLRQKIEVDPSKPRHL
                     ITVRGTGYKFEE"
     gene            240968..241387
                     /locus_tag="DEHABAV1_RS01335"
                     /old_locus_tag="DehaBAV1_0236"
     CDS             240968..241387
                     /locus_tag="DEHABAV1_RS01335"
                     /old_locus_tag="DehaBAV1_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein H"
                     /protein_id="WP_011928731.1"
                     /db_xref="GI:500355953"
                     /translation="MKMPLNIFKRESGFTLIEILVVVAILGALAGVVIPNVIKFMHEG
                     KVESANTELANVRLAVLSAMVDVKTNTLNDGGTVGPGHTSSVTYGSPSVSLPVHNFIM
                     GAVIGIYTLDEKGLIASAEMPEDSDWAGLTFVNGAWQ"
     gene            241477..241689
                     /locus_tag="DEHABAV1_RS01340"
                     /old_locus_tag="DehaBAV1_0237"
     CDS             241477..241689
                     /locus_tag="DEHABAV1_RS01340"
                     /old_locus_tag="DehaBAV1_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308767.1"
                     /db_xref="GI:499628033"
                     /translation="MQIPEAVCTKCGGHYHGWALLNARHQSCAQCGGKLVITTEDEII
                     QGYSPFSAEEVNLKAPKQTPSKKTQS"
     gene            complement(241693..242652)
                     /locus_tag="DEHABAV1_RS01345"
                     /old_locus_tag="DehaBAV1_0238"
     CDS             complement(241693..242652)
                     /locus_tag="DEHABAV1_RS01345"
                     /old_locus_tag="DehaBAV1_0238"
                     /EC_number="1.4.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984086.1"
                     /note="catalyzes the interconversion of alanine and
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine dehydrogenase"
                     /protein_id="WP_011928732.1"
                     /db_xref="GI:500355954"
                     /translation="MPTLILSRKDISGLISMPVVIQAVEQAFKDWAVGLADMPSKVYL
                     TLPGGDFRAMPASLPGAAGIKWVNVHPGNRALHMPTVMGLIIYSDPDTGYPLAIMDGT
                     DITAYRTGAAAAIASRYLARQDATTLGIIGAGRQAITQIMAHKVLFELREIRVYDISP
                     DAGLRLIEYFPDLNIRQTSLEETAASDIICTLTTSTKPVLFLKHLKPGCHINAVGADA
                     PGKQELDPLILKQAVVVVDDMDQAIHAGELNVPVKAGAFNKEMVKANLGQILMGGKSG
                     RSSVRDITVFDSTGVAIEDIAVAKWLYQRASNLGTFLSLPLVE"
     gene            242759..243331
                     /locus_tag="DEHABAV1_RS01350"
                     /old_locus_tag="DehaBAV1_0239"
     CDS             242759..243331
                     /locus_tag="DEHABAV1_RS01350"
                     /old_locus_tag="DehaBAV1_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_011308765.1"
                     /db_xref="GI:499628031"
                     /translation="MKFSNYRNQPDVILLIIITCVVVFFGVNFVPQLGPYLALQPATA
                     ISHPWTIVTSLFVHADLWHLFANMLTLYFFGNALLQMISQRSWLIIFFGGGLAGSLLF
                     ILLNAGSYGYVIGASGAVFALGGALAVLRPNSKVMVFPLPIPIPLWIAVIGSFIILSF
                     LPSVAWQGHLGGLLVGLACGYLIQQGKFKF"
     gene            243476..243868
                     /locus_tag="DEHABAV1_RS01355"
                     /old_locus_tag="DehaBAV1_0240"
     CDS             243476..243868
                     /locus_tag="DEHABAV1_RS01355"
                     /old_locus_tag="DehaBAV1_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011308764.1"
                     /db_xref="GI:499628030"
                     /translation="MTDKKYRVLVVEDEPSICQVCLRTLEGMGLDVTIAINGQIGQSL
                     IQRDTFDLCLVDIRTPVMNGKNLYAYVLNHYPNIAKRIIFTTGDLLDETTRGFLDATG
                     QPFLPKPFTPNDLKTIITETFQKLGEQN"
     gene            243949..244320
                     /locus_tag="DEHABAV1_RS01360"
                     /old_locus_tag="DehaBAV1_0241"
     CDS             243949..244320
                     /locus_tag="DEHABAV1_RS01360"
                     /old_locus_tag="DehaBAV1_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011308763.1"
                     /db_xref="GI:499628029"
                     /translation="MSKIKILIADDEEHIRQLVCSILDKGYQIVQARNGEEAVKESRE
                     QNFDLILMDIMMPKLDGLAACCMLKGDKQTSSTPIIMLTGVGYELNKKLSQQLGADGY
                     ITKPFNPQELRNKVSEFIKHD"
     gene            244313..244729
                     /locus_tag="DEHABAV1_RS01365"
                     /old_locus_tag="DehaBAV1_0242"
     CDS             244313..244729
                     /locus_tag="DEHABAV1_RS01365"
                     /old_locus_tag="DehaBAV1_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308762.1"
                     /db_xref="GI:499628028"
                     /translation="MTDALPLYRLEIPSHSQTEFIDITPQIRSVIHQSGITSGLCLIF
                     VPHTTAGLTINENADPDVITDIKAQLEQIVPSVTPFLHAEGNSAAHVKTSLMGNSLNL
                     IIEEGMILLGTWQGIYLAEFDGPRKRTVNIKILKEK"
     gene            244769..246160
                     /locus_tag="DEHABAV1_RS01370"
                     /old_locus_tag="DehaBAV1_0243"
     CDS             244769..246160
                     /locus_tag="DEHABAV1_RS01370"
                     /old_locus_tag="DehaBAV1_0243"
                     /EC_number="6.3.5.-"
                     /EC_number="6.3.5.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWJ9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinate a,c-diamide synthase"
                     /protein_id="WP_011928733.1"
                     /db_xref="GI:500355955"
                     /translation="MNFPRIVIAGVSSSSGKTTISSGLTAALAQRGHKVAAYKCGPDY
                     IDPGYLTLASNNPCHNLDSWMLSKDAMTEVFFHGLKNRDIALVEGVMGLYDGYSGERP
                     GGSTAEIARLLSAPVILLVNISHMAESAAAIVLGYKNLDPRINIAGVILNQAGSTRHY
                     EICRKAIEKYASTPVIGYLLRNKDLVIPERHLGLKTTSEGGELETFIQNLATRIESTI
                     DIDRILEIARNAPPLPEKPLPCLFPETPACPVTRIAVAKDEAFSFYYQANLDMLSDWG
                     AELCYFSPVHDTCLPPDIGGIYIGGGFPEIMAAELSANQPMKDTLTKAAADGMPIYAE
                     CGGLMYLSEAIEDFDSTKYLMLGLLPGISVMQKKLHRLGYTRAAVQNDNILSAKGTEL
                     RGHIFHWSKLPSPQTKPAYTLLEPAEFIGQNEGFIVGGSTNVLASYLHLHFGTNPDLA
                     KNFIRISKDFCTI"
     gene            246239..249426
                     /locus_tag="DEHABAV1_RS01375"
                     /note="ATPase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(249514..250638)
                     /locus_tag="DEHABAV1_RS01380"
                     /old_locus_tag="DehaBAV1_0245"
     CDS             complement(249514..250638)
                     /locus_tag="DEHABAV1_RS01380"
                     /old_locus_tag="DehaBAV1_0245"
                     /EC_number="2.4.2.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="WP_011928734.1"
                     /db_xref="GI:500355956"
                     /translation="MDENRVKNFGAVISRLISKENLSREEVKDCFSQIMRNEQPDLQQ
                     GAFMAALTAKGETASEIAGVWEAIYEQDTVRVKLQVNKPVVDNCGTGMDSLKTFNIST
                     AASIVAAAGGVVLAKHGARALSGSCGTIDMLESLGVDVETDVETVKRSIETVGIGIFN
                     GMSAKVHPQALFRILSQIRFGTTLNIAGSLANPALPHYAVRGVYSSELLQPVAEVMRE
                     IGYKKALVIFGSAPGGRGMDELSNLGESRIAELGEDGQITEYSLSPADFGLKVRQAED
                     ILTSGDKQGETLRLLRILSGNENGAAFEVVCLNTAPVFYVAGAVSSLREGYAKAAEII
                     RSGVAIAKLRQWIQAQNANPEAGIARLESLLGELDGAKIS"
     gene            complement(250653..251684)
                     /locus_tag="DEHABAV1_RS01385"
                     /old_locus_tag="DehaBAV1_0246"
     CDS             complement(250653..251684)
                     /locus_tag="DEHABAV1_RS01385"
                     /old_locus_tag="DehaBAV1_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_011928735.1"
                     /db_xref="GI:500355957"
                     /translation="MKAVLLEKPGELRLAEVVTPYCPKGGVLLKVLCCAICGTDVKMF
                     RRGHRDLEYPRILGHEIAAEVVCSGHPDFEVGCRVQVYPGIACGVCPLCLQGRENLCR
                     KVKIIGFNYDGGLAEYMALPPESLPVGLNIIPEHVSDEEASLAEPLASCIHAQSVCRV
                     GDGDRVLVLGAGPLGLLQAMLARHNGAEQVLVAEVLPERVNGAELASPDGIIDLGKTS
                     LKQGVFDQTGRAGVDVILIASSGVEVGELPFILSPGGRINFFSGLPKDRSELIIDANA
                     VHYQELVINGSYGSTAADNAEALRLIGKGIIPVKRLLSRITGISDIEAAFLGVERLDG
                     LKTVIKFHK"
     misc_binding    complement(251798..251990)
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            252226..254028
                     /locus_tag="DEHABAV1_RS01390"
                     /old_locus_tag="DehaBAV1_0247"
     CDS             252226..254028
                     /locus_tag="DEHABAV1_RS01390"
                     /old_locus_tag="DehaBAV1_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_011928736.1"
                     /db_xref="GI:500355958"
                     /translation="MAKTKKPVEKLEPAEETKKDGKVVSTKRTKGSEFFWTQSRCTGC
                     NRCASVCPVDAIKLERDKMPTKRVGTSPCTRACPAGLDIPRYVRFVADGNAPAATAVM
                     REKIPFPSVCGYVCFHPCELECQRQKFDEPIAIRALKRYAAENDDGSWKNNLKIAPPT
                     GKKVAIIGSGPTGLTSAYFLTLLGHEATIFESMEYAGGKMFYSIPEHQLPKEILNKEI
                     KTITDLGVTIHTSCQVQSVQTLFKQGYDSVLLSTGVLGVDEGLLLPCDETAKSDLIKG
                     SDFLKGIKSTTKETLGDKVIVIGGGSEAYNSAFAAKNLGVSEVNLVCSRHTGSKEASP
                     EEVDRAIDAGVTVQPSLDFVKLVKLNDKIEGVELFRIRSYGYDKENKLHYEIINDTRR
                     LISADTIITTVAQNDKPGSDYLSVVQPGVFAAGDGISGARSVIEAMAAGRSVAGLIDK
                     YLGGEGNLDETLAPPEKTIKPLGEPKSQNRSQVELNLVKQAGGDKVEIEKTLSPNAAK
                     KEAQRCLRCDIVHQVHDYSLDTSSCTYCGRCVDACYWDAITNGYGYEAAAKKRKAEAA
                     ALEEKNSVYNYAIRILPIAIGLMILAAAIAKLST"
     gene            254159..254446
                     /locus_tag="DEHABAV1_RS01395"
                     /old_locus_tag="DehaBAV1_0248"
     CDS             254159..254446
                     /locus_tag="DEHABAV1_RS01395"
                     /old_locus_tag="DehaBAV1_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase"
                     /protein_id="WP_011308755.1"
                     /db_xref="GI:499628021"
                     /translation="MKQLNDDEIYRIAQKRVKEKKDFYNHLSVYVVINAMIIGIWAFT
                     GSSYPWFIFPLGGWGIGLIFHFLSVFGFMRDESDWESKEIQKEIGRLKKNL"
     gene            complement(254443..255939)
                     /locus_tag="DEHABAV1_RS01400"
                     /old_locus_tag="DehaBAV1_0249"
     CDS             complement(254443..255939)
                     /locus_tag="DEHABAV1_RS01400"
                     /old_locus_tag="DehaBAV1_0249"
                     /EC_number="6.4.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935925.1"
                     /note="catalyzes the ATP-dependent carboxylation of a
                     covalently attached biotin and the transfer of the
                     carboxyl group to pyruvate forming oxaloacetate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxylase"
                     /protein_id="WP_011308754.1"
                     /db_xref="GI:499628020"
                     /translation="MLNKILVANRGEIAIRVMRACRELGIKTVAVYSDADKGALFVKY
                     ADEAYHIGPSQLSESYLNIKKIVAVAKKSGVDGVHPGYGFLSENPGFALALEKAGIKF
                     VGPSSRVIELMGNKIAARREMKKAGVPVLPGTEGCVSGIEQATEAAAAIGYPVIIKPS
                     GGGGGIGMRVANGPDELKDAIESSQKVAGNTFGLAEVYIEKYISNPRHIEIQIMGDSQ
                     GNIVYLGERECSIQRRYQKLIEESPSPVITPELRKKMGEVAVKAGKWVNYEGAGTIEF
                     IFSNGQFYFLEANTRVQVEHPVTEMVTGIDIVKEQIMVASGSELSFKQEEVEMRGWAI
                     ECRINAEDPLNEFAPSAAKLKGYRSPGGIGVRVDSGVHTRYNIPYLYDPMISKLIVWG
                     RTREEAIARMRRALYEYIIVGVKTNIPFHKAVMVNPNFVAGNLHTHFIEKETTLLDEM
                     KRIMSEEQPLEEKLSEIFDDTRRIAAIAAVTALTQLPAEIDEDEITGV"
     gene            complement(255932..257680)
                     /locus_tag="DEHABAV1_RS01405"
                     /old_locus_tag="DehaBAV1_0250"
     CDS             complement(255932..257680)
                     /locus_tag="DEHABAV1_RS01405"
                     /old_locus_tag="DehaBAV1_0250"
                     /EC_number="6.4.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406780.1"
                     /note="catalyzes the formation of oxaloacetate from
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase"
                     /protein_id="WP_011928737.1"
                     /db_xref="GI:500355959"
                     /translation="MGIKITDTTLRDAHQSLIATRMRTRDMIDIAARLDKAGFHSLEV
                     WGGATFDSCIRFLNEDPWERLRLIRQKAPNTPLQMLLRGQNLVGYRHYADDVVREFVR
                     LSVKNGIDIFRVFDALNDIRNMEVSIQTAKELKAHVQGTICYTTSPIHTVEKLAEMAV
                     ELEKMGCDSICIKDMAGLITPTAAAQLVKSIKSKVKLPVDLHSHCTSGMAPLAYYAAA
                     EAGVDIIDTAFSAFAWGTSQPTTESFVAAFKGTKLDTGLDLELMSEIGEEFNKISASY
                     RCLYTCEATQPSISVLLHQIPGGMISNLVSQLRQQNAFDKLSEVLAEVPRVRADLGHP
                     PLVTPSSQIVGTQAILNVLSGERYKQVTKETKNYLMGYYGKIPGKVNEDIRKAIIGDE
                     KPISVRPGALLEPELPKMKAEGEKLGILKTEEDLLTYAMYPEVAAKFLKGECKEECLL
                     PSTPEAAKPVKTEAKPVPAFSGSAEYSVEVDGEVFTVKVSAKAGVAGEAPKALKPTAS
                     HPGAIVSPMQGMLLSLKVKEGDKVTEGEVVATIEAMKMENDVCATVNGVVVGIYAYEG
                     EVVGSKDVIMVIEPDA"
     gene            257974..258516
                     /locus_tag="DEHABAV1_RS01410"
                     /old_locus_tag="DehaBAV1_0251"
     CDS             257974..258516
                     /locus_tag="DEHABAV1_RS01410"
                     /old_locus_tag="DehaBAV1_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_011928738.1"
                     /db_xref="GI:500355960"
                     /translation="MSRFAVLLAEGFEEIEFCTITDILRRADLEVKIVGLKNDLTGGS
                     RGIRIMPDIHIDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHAENKYLAAIC
                     AGPAVLSRAGVIDGKEVAIYPGVKHLLKNCTACDLRVKVEGRLITGRSPQAAMDFALT
                     LMDMFAKPQSAKVVRDEMLV"
     gene            258696..259334
                     /locus_tag="DEHABAV1_RS01415"
                     /old_locus_tag="DehaBAV1_0252"
     CDS             258696..259334
                     /locus_tag="DEHABAV1_RS01415"
                     /old_locus_tag="DehaBAV1_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_011928739.1"
                     /db_xref="GI:500355961"
                     /translation="MAKAKQNNISRDKILSAATHLFLNSHDAGKVSIEDIAVKANVSP
                     TTIYNNFGGRKALVLGVVEKIIDNSLIQSKDIMARPLPFPAKIQLILSNKNDMAGKMP
                     EEILKKLVNMDDDVTALIQEIYQQEIQPMWQKLIADGKAEGYVDPSLSEEAVFIYLKV
                     VRDGFNANAALFEPAKEKINLMMELSRIMMYGFFKKDACLIPDIKSGHAKTG"
     gene            259346..260212
                     /locus_tag="DEHABAV1_RS01420"
                     /old_locus_tag="DehaBAV1_0253"
     CDS             259346..260212
                     /locus_tag="DEHABAV1_RS01420"
                     /old_locus_tag="DehaBAV1_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_011308750.1"
                     /db_xref="GI:499628016"
                     /translation="MSQISISVEKLSYWYGDLKAVNQISFEVAQGEILGFLGPNGAGK
                     TTTQKMLTGQLRPKDGRATLLGFDVAKDTEEIHRRIGICFEQTNLYEQMNALENLQLF
                     ADLFGVNNFNGYALLKRVGLAGREKDKVAGYSKGMKQRLMVARSLVNTPSILFMDEPT
                     SGLDPVSSESIRDIILEERKRGATIFLTTHDMWEADKLCDRVAFINEGSIAALDAPVN
                     LKQQYGKRSLIAKVKSANGQLENREIALDTGKTAEEVSKLLSSERVLTLHSEEATLED
                     IFIKITGRRLTE"
     gene            260209..261267
                     /locus_tag="DEHABAV1_RS01425"
                     /old_locus_tag="DehaBAV1_0254"
     CDS             260209..261267
                     /locus_tag="DEHABAV1_RS01425"
                     /old_locus_tag="DehaBAV1_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011928740.1"
                     /db_xref="GI:500355962"
                     /translation="MNFSVIKALLKKDFSLFLQNRFYMLMTIVGLVFYIIIFFIMPNK
                     VDEQLKAGIYAPVMPPAFSILVADPASSLTSYASLEEAKAAVENGDSQVAIVLPADIM
                     QTWASGGKPEVEIYYASSAPLELRDAVISLVKELSYIQTGQSLTFDTNEQVMGQDMLG
                     EQIPMRNRMVPLLAIFILMMEILSLASLIAEENEQGTARALLVTPMTVPELFAAKGII
                     GVGMALGQVVLFMLLVGGFNSQPLITLGVLLLGSLMVTGLGFLLASLTKSLMSVTTWG
                     MLLFIILAIPGMGIMFPGLISNWAKVIPSYYLTDTVNRVVNYGADLSVVGGNLLILVG
                     FTAVIVTAGIVVLRRRYQ"
     gene            261264..262337
                     /locus_tag="DEHABAV1_RS01430"
                     /old_locus_tag="DehaBAV1_0255"
     CDS             261264..262337
                     /locus_tag="DEHABAV1_RS01430"
                     /old_locus_tag="DehaBAV1_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011308748.1"
                     /db_xref="GI:499628014"
                     /translation="MSIKHIITLFNREVIHGPKDVTFIMVVVTPILISLFISLAFGNI
                     FSEKPKLGLTDLGNSQIVNLLKENNTLLIKEYPDEAALKEAATSGAVDMGLVLPADFD
                     TSLIQTNTLKANAYVWGESLAKSRMIIPAVLADTARQITGANVPVEINSISLGDEMNV
                     PWADRLFPFVVLMAMFFSGLMLPASSLIDEKQKRTLEAVNITPATLGEIFTAKGAIGT
                     LLGVVMGLIILALNSAFGNSPLPLILMLGLGSLMASLLGLLAGAFIKDMNTLFAVWKF
                     GGLLLFGPAFIYLFPQIPQWIGYFFPTYYILKPVVDLSVYDAGWTDIALNAGISVILV
                     VILLVAVSKVVSRMSNSALRLYT"
     gene            263015..263818
                     /locus_tag="DEHABAV1_RS01435"
                     /old_locus_tag="DehaBAV1_0256"
     CDS             263015..263818
                     /locus_tag="DEHABAV1_RS01435"
                     /old_locus_tag="DehaBAV1_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010935918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ni/Fe hydrogenase"
                     /protein_id="WP_011308747.1"
                     /db_xref="GI:499628013"
                     /translation="MPNGMLIDTTRCTGCRGCQVACKQWNENPAVKTTFSPEVTNPLE
                     QNAFNYNLLECREIEEDGKLQWIFAHKRCLHCYEPACVSVCPVGALHKRPNGAVVWDQ
                     DKCFGCRYCQNACPFEIPKFEWDDNWAKITKCTMCWNRVDEGMEPACAATCPTGAIKF
                     GERADLLAEAYERLSNNPDKYYPYVYGEKEAGGTHVLYLSSVHPEKLGFDMHEHEFFP
                     SFTREFLGNIPLEISIVASLMVGVWYFRGRRIQAQAHDAEHAENKAGKH"
     gene            263871..264935
                     /locus_tag="DEHABAV1_RS01440"
                     /old_locus_tag="DehaBAV1_0257"
     CDS             263871..264935
                     /locus_tag="DEHABAV1_RS01440"
                     /old_locus_tag="DehaBAV1_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_011308746.1"
                     /db_xref="GI:499628012"
                     /translation="MFNTKLTRRDFVQLAAGSTAALSLGALKLPEFEKMFAEALKEIP
                     VIWLQGAGCNGCTISTLNVVSPTIQDLLLTSVVPGTHVSMQFHPTIMAAQGDLAMNTI
                     TDTAAKGPFVLVIEGSVPLKDGGIYAEVGEKDGEGITLLEHVLNLAPKALAVVAAGTC
                     SAFGGITAAAPNPTGAKAVSEILKDHNITTPVVNLPGCPPHPDWVVGTLATVLMSGLD
                     ALDLDDMGRPKAYYGKLLHDQCPRRGHYEKGLFATKLSEPYCLFLVGCKGPVTYADCS
                     DRLWNNKTRWCVEADSPCIGCAHPGFPDAVSPMFEAPPVINSTDKLAIGIAGTAVVLT
                     AGVAAVELAKKAKRNAAKKG"
     gene            264966..266546
                     /locus_tag="DEHABAV1_RS01445"
                     /old_locus_tag="DehaBAV1_0258"
     CDS             264966..266546
                     /locus_tag="DEHABAV1_RS01445"
                     /old_locus_tag="DehaBAV1_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron hydrogenase"
                     /protein_id="WP_011928741.1"
                     /db_xref="GI:500355963"
                     /translation="MQKIVIDPITRIEGHLKIEATVDGGEVKDAKCVGTLFRGFEIFM
                     KDRDPRDAVHITQRICGVCPTSHGTTAALNLDAAFGVADKIPNNGRILRNLIQGANYI
                     ASHIVHFYHLAALDYVDVTEVADYDGTDPELLKVKDFIARALAAGDMSMLAPFYPRYE
                     GDYRLPKKVAQAAVAHYVEALNMRRLAHELSAIYSGRMPHSVAVVAGGVTSHPSIDSI
                     SSFMSKLNTLRHFIDNVYLPDVIAVAETYPDYFGIGVGCGNLLSYGVFDLEANGTNLA
                     TRQRLFTQGTVSASDLTLHTFDPNKITEDIKYGWFKGETNEYPLNEVTEPDHTKAEGY
                     SWLKAPRYENTPYEVGPLARMVVNYVAGDPVVQKMVNDTLAHFGAGPAALFSTLGRHA
                     ARALECKIVADEMVKWVMELKIGEPVCADYEIPESAEGMGLWEAPRGALGHWIKIENH
                     KISNYQCVVPSTWNCSPKDGQGVNGPVEQALIGTKVRDNDNPFELVRIVRSFDPCLAC
                     AVHLVSPTGNEISRFRVY"
     gene            266549..267031
                     /locus_tag="DEHABAV1_RS01450"
                     /old_locus_tag="DehaBAV1_0259"
     CDS             266549..267031
                     /locus_tag="DEHABAV1_RS01450"
                     /old_locus_tag="DehaBAV1_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HybD peptidase"
                     /protein_id="WP_011928742.1"
                     /db_xref="GI:500355964"
                     /translation="MFFNPGDESPKPILVLGTGNILLSDEGAGVRCVERLSRFPVPED
                     VELYDGGTAAMDLLDVISGREKMFILDAVHGGDEPGMIYRFRPEDIKTQPKIDISFHQ
                     MGLMEILNLAKYHDAIPKDIIIYGIQPGSMAPGFELTPAVDKAVNRVVEMMKEELGIK
                     "
     gene            complement(267098..269017)
                     /locus_tag="DEHABAV1_RS01455"
                     /old_locus_tag="DehaBAV1_0260"
     CDS             complement(267098..269017)
                     /locus_tag="DEHABAV1_RS01455"
                     /old_locus_tag="DehaBAV1_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_011928743.1"
                     /db_xref="GI:500355965"
                     /translation="MKKFFQEKPGAVEFLLPALVFTLAISLFPLFGSGMTWILGDRFG
                     QGAGVLGLIALTVFSLSFLAKPLRRFLCSYKAIIFSAGGVGILSLLAQIGFSEPLLNF
                     VCSALGLSLFGIFLCVYLDSARVRGPSAVGHFGAGAVFGLLLNAALSAGFGTYDLLNQ
                     PSFFPLLVSAVMVGFLLFLLTVHMPLAEGPAASNDGLGWLAIGPFLFLELVVFGNIAR
                     LSALSGFSSPVASMFVLGALSLGLVGILWVLSLSERHIRLLTLISSLCLILSLTGISD
                     GVAFVSLIQQVLGQLAVVLLFGVILRYIGGRKADGHSESLNLPSGLGMLVFVILLLGY
                     YAVYQVAVPYDNTVLELVAGLIVVGLALYSGRESLPLLDFKSDRFILPAMSVLLLTLP
                     LLGLLTYKTPPSPPQFEGSLRIMTYNLHNGFNTQGKLDMEALARVIEDSGADVVALQE
                     ISRGWVISGRVDMLEWLSQRLNMYSAFGATAGEYWGNAILSKYPILDTHNISLESEGL
                     PIKRGYLNAVLDLGGRYLYLAATHLHHVPEEGDVRLIQAGELADFWDNAPATIILGDF
                     NAEPDSEEIGLLRQAGLSDSLEGQTSVLTYHSADLYQRIDYIWASPEIEYIDSYTIVS
                     LASDHLAIIADIRLS"
     gene            complement(269080..270384)
                     /locus_tag="DEHABAV1_RS01460"
                     /old_locus_tag="DehaBAV1_0261"
     CDS             complement(269080..270384)
                     /locus_tag="DEHABAV1_RS01460"
                     /old_locus_tag="DehaBAV1_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LemA family protein"
                     /protein_id="WP_011928744.1"
                     /db_xref="GI:500355966"
                     /translation="MEFQIWGYLVFVLGLAALALAFRAMRRKRLVDDIPTSRTHGVFI
                     GLVELKGTAESEKPFTGFLSAEQCVYYYYKVEERWSRMVTESFTDAKGHVQFRTRQES
                     GWTQVASGKEMQPFYLKDETGIILIQPEGADIQPKNLFNRTCGQNDPLYYAKGPQASI
                     PNSDHQRRFTEEAIPLHAGLYIMGQSRERQDIVAPEIAKDKSAPLYVISTRTEKQISR
                     TYSGWFWFWVGLGLLLASGSGLLLSQEGTSGFNPDFGVAVLWLGLYLICWLFGWLWAG
                     YNSLVGLRNRVCQGYAQVDIQLKRRFDLIPNLAKSVEGFGKHERELQEMLAEVRTISK
                     VNGQDPKDIQGASAILVFNMERYPELKADTLFLKIQEELAATESWIALARDYYNSIAT
                     FYNTRREVFPDRLLAGIFGFKERVLINASALERAVVKVKLAE"
     gene            270583..271422
                     /locus_tag="DEHABAV1_RS01465"
                     /old_locus_tag="DehaBAV1_0262"
     CDS             270583..271422
                     /locus_tag="DEHABAV1_RS01465"
                     /old_locus_tag="DehaBAV1_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid-binding protein DegV"
                     /protein_id="WP_011308741.1"
                     /db_xref="GI:499628007"
                     /translation="MTIKIVTDSTADLPADIVKNLGITVVPLYVHFGNEVFRDGVDIN
                     KETFFDRLAHGGIHPKTSQPSPEDFANVYRELAKDNATGIVSIHISSKFSGTYQSAME
                     GAKISGVSCPIEVIDSRLLSMGMGLVIKAAAIASRSGKKLGEVVEDCKNNIPKIKLMG
                     FFDTLRYVQVGGRLGKAKILMGSLLGVKPVLTVADGEYQPCGRVRNTGKGLERLVEFA
                     KTGKNIVDMSVIHSTTPETAHKLAEMLSDIFPKDQTIIAQLGAVLGTHGGPGTLWVAY
                     KEA"
     gene            271569..271934
                     /locus_tag="DEHABAV1_RS01470"
                     /old_locus_tag="DehaBAV1_0263"
     CDS             271569..271934
                     /locus_tag="DEHABAV1_RS01470"
                     /old_locus_tag="DehaBAV1_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928745.1"
                     /db_xref="GI:500355967"
                     /translation="MSFAAIFSIIAGVLVIFQWRENLNRRAIQDPNKGYKVRWGTYEL
                     ILRSAAEFATALMLILAGTGLLSEQSWGESIYLLATGMFIYSAVNSPGYFVQQKNWAV
                     VAVYAIALELAILGVILFL"
     gene            complement(272052..273038)
                     /locus_tag="DEHABAV1_RS01475"
                     /old_locus_tag="DehaBAV1_0264"
     CDS             complement(272052..273038)
                     /locus_tag="DEHABAV1_RS01475"
                     /old_locus_tag="DehaBAV1_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011928746.1"
                     /db_xref="GI:500355968"
                     /translation="MSIEPEIRETLGKINVAASGRTLANLNLLRDIEIQPDKIKISVA
                     SAGLSASSQQILRQDISLCLKPLLNKQTLEIEYISVPLNELNHVKKVVAVMSGKGGVG
                     KSLITGLCAVALNRQGYRVGILDADITGSSIPKMFGANQHLAGNEEAILPAQSRAGIS
                     LVSTNLLLTNQDDAVIWRGPLISKMINQFWDDVLWGELDYMVVDLPPGTSDASLTVLQ
                     SLPISGILVVFTPQGLVEMVARKAVSMAEKMGKPIIGLVENMAYLKVPELDKKIEVFG
                     TGHGEELAKSIGVPFIGQMPLDPALAALCDSGDIEKYQHPLLDELEGAISRS"
     gene            273519..274457
                     /locus_tag="DEHABAV1_RS01480"
                     /old_locus_tag="DehaBAV1_0265"
     CDS             273519..274457
                     /locus_tag="DEHABAV1_RS01480"
                     /old_locus_tag="DehaBAV1_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(4Fe-4S)-binding protein"
                     /protein_id="WP_011928747.1"
                     /db_xref="GI:500355969"
                     /translation="MTDKGKEGTTRSTHPPTRRDFIKSSGGVLGLAAITKLDERTQNF
                     SAAVAPPSTVSFPAEETAFIPNSTKEDPLIRMQAELRRAMQKPAAERHWAMVINLRKC
                     VGCHACTEACVSENKLPPGVIYRFVMDEEIGQYPNVSRRFTPRPCMHCDNPPCTQVCP
                     VGATFKQADGIVVIDYQRCIGCRFCIVACPYTARTMDYGDNYLEDEPEDSGLVLGYEQ
                     GGVWQSASNFEYGNEHSRTPKRDSPIGNARKCHFCLHRLEKGMLPACVTTCIGRVNYF
                     GDSNDPDSLVSELIANPGIIQLKSELGTDPSVYYLF"
     gene            274478..275659
                     /locus_tag="DEHABAV1_RS01485"
                     /old_locus_tag="DehaBAV1_0266"
     CDS             274478..275659
                     /locus_tag="DEHABAV1_RS01485"
                     /old_locus_tag="DehaBAV1_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_011928748.1"
                     /db_xref="GI:500355970"
                     /translation="MNWKRIALGILILSLAAGVWGFLMLLNNGQQMLGLGSFVVWGLW
                     MALYVFFASTAAGMFFIASLDLLFKVKTFAGTGKIFMLASLASLGAGLIHILINEGRP
                     ERVMNVFLHPNFDSVLAWSVWIYTLIALATAAILLVLFIPQKRLPFRKEPVIKWLMIL
                     GFPVAVIASGAVGFTLSTQSSHSFWSVGLFPVLFPIFGMSAGFALSRIIVALYGDKTS
                     PGYPRLAKTMAISTIALLLSITYIIGSVLFVGIYDATPPTIEAANYIMFGQYWYGFWI
                     VQIGLGIVVALGALIKVLSKPGLSKKPAWGLTIGVLVLLGAAVARLNFIIPAQIVAGA
                     DFLSSPIIDSRYIDSYIPTLPEWALSAGITAAVILAFYIIAKMMKLIPVRIGNEETGD
                     E"
     gene            275652..278864
                     /locus_tag="DEHABAV1_RS01490"
                     /old_locus_tag="DehaBAV1_0267"
     CDS             275652..278864
                     /locus_tag="DEHABAV1_RS01490"
                     /old_locus_tag="DehaBAV1_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_011928749.1"
                     /db_xref="GI:500355971"
                     /translation="MNKEKPEKNPSGGITRANFIKVSALLGGTALLSGCDLGTKPRRI
                     LGSSDYPLSKAEDIIYSTCQQCATQCSIKVKLIDGVIAKIDGNPFSPWNMMPHLDYKT
                     PVTTSAFTDASICPKGHSGAQTSYDPFRLVKVIKRDGPRGSNKWISIPFAQAIDEIAN
                     GGKLFSNVPGEENRTVEGLKDIWALRSPEITKAIKNDITAIWAEKDATKKSALVAVFK
                     EKHKDYLDKFIDPNHPDLGTKNNGFCFMFGRTQGGRVDFIKRFTNDAMGSVNAHGHTA
                     VCQGSLFQSAKALSAQFDSGTGSFSEGEKFYWMADIGKSEFVIFTGASPFEASFGPTS
                     RSMRISEGLDTGRMKYAVVDPRFSKAASKAWKWLPAKPGTEGALALALIRWIFDNSRY
                     DARYLANANKAAADADGEPTWSGSSWLVKIDAAGRAARLLRASDIGLEQGNFSFDTPL
                     VMKQGQFTRFDPNDKVNAVEGELLVDTTVNGLRVKSSLQILRDEASSHTIEEWAEICG
                     VKADDLAEIASEFTSHGKKAAADIHRGVSQHTNGFYNSLAWWNLNMLIGNYDWQGGML
                     KGSAYDIKGGKADGPFNLGQMRPGALTPSGVNIVRHGNIYEDTTLYQSTGYPAKRNWY
                     PLSEDIYQEVIPSAGDAYPYPIKALFLHMGSPVYVVPAGHTALEFLTDPEKLPLLVVT
                     DIVVSETSMYADYIFPDLTNMERWEFAGSQNTIPFKSQPVRQPAIAPLVETVKVFGQD
                     MPLSMETMLLGLAEEMGLPGFGPDGLGQGIPLSHFDDLYLRMAANLAFGEKADGSDAV
                     PDADEEEIRIFTQARRHMPDSIYNLERWSSLAGENWPKVVYMLNRGGRFQDYEGGYPA
                     NQQLGNKYGRLFNVFLEKTTEVKNSQTGESIPGHACYITAGRDCYGQELNDEKNGYDL
                     SLITYREIARTPTTASNYYLNPLLPENTILINQQDADRLGLTETDIVRVVSESNPKGV
                     WNLRNGQEWPMNAKLSIMQGIRPGVIAFSLGYGHFAYGGLDITIDGQLIPGEAKRTKG
                     VNANAAMRVDPHLKNTCLVDTVGGSAVFYDTKVRLEKVNT"
     gene            278887..279576
                     /locus_tag="DEHABAV1_RS01495"
                     /old_locus_tag="DehaBAV1_0268"
     CDS             278887..279576
                     /locus_tag="DEHABAV1_RS01495"
                     /old_locus_tag="DehaBAV1_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928750.1"
                     /db_xref="GI:500355972"
                     /translation="MNTYLNPEKNRIPTGLTLAVIGSVWGLLEMALGGFLHTIHFANQ
                     GAVMGGLAISLMAIFLSITKKPALIPLLGIIAASFKPFSAFIFGEPVFSAYVINPAIA
                     IIMEAIAFGAIAFIFKKAMEKHLFAQITTGFLAGALGIVLYAVIASVFGLGKWPMLDM
                     AGKLDTIVSTGLPVALAGTITLAAGYYLGKFGMPKLANFKTNYPRLYYVTSAAAVVSC
                     WVIPAVFHLGG"
     gene            279577..280722
                     /locus_tag="DEHABAV1_RS01500"
                     /old_locus_tag="DehaBAV1_0269"
     CDS             279577..280722
                     /locus_tag="DEHABAV1_RS01500"
                     /old_locus_tag="DehaBAV1_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA"
                     /protein_id="WP_011928751.1"
                     /db_xref="GI:500355973"
                     /translation="MNLIITGEVGSGKSSHCQRYAKHLQECGFKTGGVICRPVFQETT
                     KTGYKVTDIRTSAETIFSLTHPPSEFTGEKVGKYSICQSGLSFAGKAIQEAIQTGCTV
                     IFLDEIGHLEIAGKGLAEHAHLAYQKAPHTISVVRKSLLSKFLAAFAPDKSNNIFVIQ
                     DTQTDTDIHTHYFENRADTVDISCIILAGGKSTRLGSNKVTATLNSQTLLERAIANLA
                     GYGDEILVVTAYSKTDDKTRQLAGIKIIQDILPDKGPLAGIYSGLMASNSPLNLVIAC
                     DMPFINQPLLEYMRAQAEGYEAVVPRLAQRPEPLHAIYSKSAGEKALGLINEGKFAVS
                     DLLACLKTRYIEEAEINRFDPEHRSFFNINRPEDLEKARNIAETESI"
     gene            280911..281219
                     /locus_tag="DEHABAV1_RS01505"
                     /old_locus_tag="DehaBAV1_0270"
     CDS             280911..281219
                     /locus_tag="DEHABAV1_RS01505"
                     /old_locus_tag="DehaBAV1_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="WP_011308733.1"
                     /db_xref="GI:499627999"
                     /translation="MPEFGSPFSGMAKGQPLSNEELIRAIRFMVAAEYEAIQLYMQLA
                     ESTTNRLAIEVLRDIANEEKVHAGEFLRLLKELAPDEENFYADGAKEVEEEIEKRKNK
                     "
     gene            complement(281758..282003)
                     /locus_tag="DEHABAV1_RS01510"
     CDS             complement(281758..282003)
                     /locus_tag="DEHABAV1_RS01510"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377572.1"
                     /db_xref="GI:755024621"
                     /translation="MTVDQIDQIWEKRNPWLGYLDHASEKADEFRIVEAEIKEIRIRL
                     PSVVWNQIGTEARRMHIRHTELARKWIIEGLNKSRRL"
     gene            complement(282128..282412)
                     /locus_tag="DEHABAV1_RS01515"
     CDS             complement(282128..282412)
                     /locus_tag="DEHABAV1_RS01515"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377576.1"
                     /db_xref="GI:755024625"
                     /translation="MVDKEEIDYQEKSARYGQTLDNGIEAQKYVLEKKSQYWLALRQW
                     SLPIQLLSPKESSILDVACDMPPKIPSEKQCQVLIAIEKKALEEGFPGAV"
     gene            282499..282777
                     /locus_tag="DEHABAV1_RS01520"
                     /old_locus_tag="DehaBAV1_0272"
     CDS             282499..282777
                     /locus_tag="DEHABAV1_RS01520"
                     /old_locus_tag="DehaBAV1_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010937184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_010937184.1"
                     /db_xref="GI:499239644"
                     /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYR
                     WRQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
     gene            282915..283613
                     /locus_tag="DEHABAV1_RS01525"
                     /old_locus_tag="DehaBAV1_0273"
     CDS             282915..283613
                     /locus_tag="DEHABAV1_RS01525"
                     /old_locus_tag="DehaBAV1_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_042377497.1"
                     /db_xref="GI:755024544"
                     /translation="MVADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEG
                     LRVPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTR
                     ECLAITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTL
                     FIEPGSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGY
                     RPPAPEAIMAVVTT"
     gene            complement(284016..284702)
                     /locus_tag="DEHABAV1_RS01530"
                     /old_locus_tag="DehaBAV1_0274"
     CDS             complement(284016..284702)
                     /locus_tag="DEHABAV1_RS01530"
                     /old_locus_tag="DehaBAV1_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011928752.1"
                     /db_xref="GI:500355974"
                     /translation="MNVVIIEDDDVIIESLTLLFRMRWPEAKLVSSNLGDKGLELIVD
                     WNPNLVILDLGLPDLDGLEVLKRIRLFSNVPVIILTVRGDEAEIVKGLEYGADDYITK
                     PFKQLEFLARVKALTRRQEVPAIATCYQKGPFQLVSATHKLYLKDKEITLTNTEYLIF
                     YKLLENANMVISHSTLSKMLWGEDYPDSIDAIRVYISRIRQKIHDDSSEPSIILTKPG
                     LGYMLSTSKA"
     gene            complement(284702..287914)
                     /locus_tag="DEHABAV1_RS01535"
                     /old_locus_tag="DehaBAV1_0275"
     CDS             complement(284702..287914)
                     /locus_tag="DEHABAV1_RS01535"
                     /old_locus_tag="DehaBAV1_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011928753.1"
                     /db_xref="GI:500355975"
                     /translation="MKHILLFIAVICLIILPVYSNPVQAQEFTRFEHISIDDGLSQSS
                     VTAIIQDREGFIWFGTRDGLNRFDGSTMHTFSNNPENPGSLSDSYINCLFEDSRGIIW
                     IGTLSGGLNKFDKMTETFSTFRHSEGNSETLASDNVRMMREDLAGFLWLATPNGLDRF
                     NPHSNSFEHFSLHNGLSNNSVWSILITKEGTVWVGTEDGIDQFQSENGIYKHSNRLTS
                     DLSGNTIRYLFEDKTGNIWISTYNGVDCLNPLSGIIAHFENIPGNPSSLGNNRIRTIC
                     QDTAGSLWFGTTDGLDKLEQGTNEFIHFKNDSGNPDSISNNIIWSLMVDRSGVLWIGT
                     LNGGVNRLSLTKQVFICYRNNPGNANSLSNNIVKSIYQDQNGIIWIGTLGGLNKFDPL
                     ANTFYLFNHDGSNPQSIAGDTIKTITGDTNGNLWVGTTSGLDKYSEQLNQFTHFTHNQ
                     SDTKSISDDVIWSLFFDSQGQFWVATNRGLDKFNPDSSEFIHFGAVYGLPETTIYTIF
                     EYEPGVLLLGTDYGLYRFDTISETSVPFRFDANNPTTINNNAVRCIYQATNGTILIGT
                     HTGLNKFNITEGTFERYTQINGVTYGILEDNFGYVWISGNNGLIRLFLANETIKTFNK
                     TDGLQSDEFSEGAYFKGSSGLLYFGGINGLNVFDPSKLQTETAKPNIIITSLDLIGGN
                     ASFKLPEQISGGITLEYENNSFTINFTALDFETYQKVKYYFQLVGFDKDLRIANYDQR
                     DISYTNIDNGKYTFKIYAADQDESWVSDTAYLNIRITTPFWESWWFYSLCGVSSIATI
                     YFIVKLRIWAIQKQKNHLESLVEVRTDQLKTEIEKQQIIENKLKDEIENRAKFTRALV
                     HELKTPLTSLSISSELFTGEATNEPFVSLSRSIERSVTNLSKRCDEMLDLARGETGLL
                     KISKQMVDLDSFVEGIKTDLLSIAFSKGIHLTFEYAKNTRKAYIDPDRINEVINNLTD
                     NALKFTPPNGTITIKTDISNEQFIFEISDTGCGINKDYQKRMFSPGYQGETNPRLDGL
                     GIGLILAKMFIELHKGTIWVKSKPKSGSIFGFSIPIGEKD"
     gene            288132..289703
                     /locus_tag="DEHABAV1_RS01540"
                     /old_locus_tag="DehaBAV1_0276"
     CDS             288132..289703
                     /locus_tag="DEHABAV1_RS01540"
                     /old_locus_tag="DehaBAV1_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928754.1"
                     /db_xref="GI:500355976"
                     /translation="MANFHSVINRRDFMKALGLVGAGAGAAAAVAPVFRDLDDLVASP
                     TATFPRAWWIKERDLWDITTEYDWKAMSRHDTCETMWIKHSWAKYVGVDKVKEAAASA
                     AAIKKEALETGKPGMDLRATALGSTSGLYNAPQPYFSYTKTAQGWGGGKSFTGQSTIK
                     GPDVLGVPKWQGDPDANLRMLRAALRFYGAAQIGVVPYDTNVKNKLTCVREGGMASMS
                     DKYIEKWPIPAVDARPFVFEDVEKGYETAEKLVIPDKKELFVVSVIQPMSREMWRQGS
                     GNLRVATNGHRYSLASVWQTKIQGFLTTLGYQGLGYPTRAYGPMPTIPGFIFSGLGEL
                     GRSNNVCLSPEYGSTHGSFHFLTDLPLTPTKPIDAGMWRFCKTCAICAENCPSQSISY
                     DKEPSWEITPSKYAPNVPVEYSVPGKKVFWRDEPSCKQWTESCGYSCGICMGSCVFNV
                     DNASMIHQVVKGTIATTSLFNGFMKQADKFFGYGLTPESEWNNWWDMNLPAYAFDTTV
                     GVTDGGYKAKGLLQQ"
     gene            289727..289999
                     /locus_tag="DEHABAV1_RS01545"
                     /old_locus_tag="DehaBAV1_0277"
     CDS             289727..289999
                     /locus_tag="DEHABAV1_RS01545"
                     /old_locus_tag="DehaBAV1_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928755.1"
                     /db_xref="GI:500355977"
                     /translation="MWMIIGILVGLAIWGVVQFAKNKGLNLTWYDWVIGLLGLGLLLF
                     TFQNFIGAFAEAEDKAAYLFLLVTGLPSLILLAVAWQLAIRRTKKV"
     gene            complement(290133..290546)
                     /locus_tag="DEHABAV1_RS01550"
                     /old_locus_tag="DehaBAV1_0278"
     CDS             complement(290133..290546)
                     /locus_tag="DEHABAV1_RS01550"
                     /old_locus_tag="DehaBAV1_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928756.1"
                     /db_xref="GI:500355978"
                     /translation="MFAFLALISGCEQTQPPSVQTEIPAACPDSQVEIDKLILSEFPF
                     ESEGTTESVTVFNSGIRQIYCTFWLTDDLCCTVITLQLKDNAQVLFEWKMNGNQIGFP
                     QTVIMEFETGLGTGQYLLEIYMDKKMRVNFELVIV"
     gene            complement(290722..292206)
                     /locus_tag="DEHABAV1_RS01555"
                     /old_locus_tag="DehaBAV1_0279"
     CDS             complement(290722..292206)
                     /locus_tag="DEHABAV1_RS01555"
                     /old_locus_tag="DehaBAV1_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011928757.1"
                     /db_xref="GI:500355979"
                     /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYIASVLERAGHEVRIFD
                     NVVSELTPPDYAKDFAPEVVGFSVLTGPCIGNALVQSKEFKALLPGVKVVWGNVHATC
                     TTEQTLNEEAIDFVVRGDGEYTFLDLIEHLEKGEENYAEIQGLAWKDREGRVIINQPR
                     PFIHNLDELPNPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHQGHRADLSVERI
                     IAQIEHLQKNYKVKFIRFFEDNFTFNRKRMREFCQTVIERRIKIKWDTESRADMSEED
                     VALMAKAGCTSVGIGVETGSKRMLEYLNKGVDLDEMGRTFWRFVKHGIMPRLYIMLAV
                     PTETVEDFTETQDMLHRMEDPPFMYMRFVPYPGTPLYNQLVQDNRIKPPESLGEWAKF
                     SVYFATKGNLSELSDEVINQAISHWAHSYASRRVMFTLRHNPRYLLSAVKNPSEFFKA
                     VSSLIKNSLPVVFNKNTNIKPLVLEAVPNKMPGKQEPRLISNYE"
     gene            complement(292229..292978)
                     /locus_tag="DEHABAV1_RS01560"
                     /old_locus_tag="DehaBAV1_0280"
     CDS             complement(292229..292978)
                     /locus_tag="DEHABAV1_RS01560"
                     /old_locus_tag="DehaBAV1_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011928758.1"
                     /db_xref="GI:500355980"
                     /translation="MKVYHLIYEPSYKSAVFHHWTECNLDCKGCFCRVEKLDFGLFPD
                     ALERLKDKAPETAPTDFLESPEEALKLLEGCELERAVFIGTEPALDPDLPALAKALHQ
                     KYGSYNVLLTNGVRLCDLSAIDEIIFSLKAVTNAIYQDYTGRSNEKTLDNFKKVHASG
                     KKLQAECLLIPGLIEADEVEKIAKFIATVDKDITLRIDGYFPIPGCPWRGATPKEVTE
                     ASQRAGKHLAKVNYLSADLPRQGEKPLRLFG"
     gene            complement(293045..294457)
                     /locus_tag="DEHABAV1_RS01565"
                     /old_locus_tag="DehaBAV1_0281"
     CDS             complement(293045..294457)
                     /locus_tag="DEHABAV1_RS01565"
                     /old_locus_tag="DehaBAV1_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928759.1"
                     /db_xref="GI:500355981"
                     /translation="MTNYHSSVSRRDFMKAMGLVGAGMGAATAVTPAFRDLDELTATA
                     DLSVYNKWWIKENDFGQLTTEIDWKVFSSFDPAKHPMPVMFGPTANGAMSAKNLANRK
                     KRQTDGILNKWPGSTLRDLALDGATGGNYPSIPWTGPNATTPESRGVPKWEGTPEDNT
                     IMCKAATHFYGAPRCGAIEVDDNVKKFFNTSVVWENIDTAYIGDDGKQHVPNKCKWIL
                     TWLTKQNHAMNKYTLRNDPNDPWYNTVFRQGKAGENMAYSHAPQIQYQVMGFLKGLGY
                     QAIKATASGNTQFGVWSGLCESGRTTYALSPDYGLMVRYIDFAITDLPLAPTKPIDAG
                     LAVFCKNCMTCAKVCPSNTISLEKEPSWNTKDPGNNPGLKTWYLNWTTCAEYGGPFDC
                     VNCQTVCPFSHDNDKSAIHNIIRGTVGTTHLFDGFFANMEKFWGYNTQLSDQAHTDWW
                     YRDLDTWEHDTLLGFGTKGW"
     gene            complement(294482..294757)
                     /locus_tag="DEHABAV1_RS01570"
                     /old_locus_tag="DehaBAV1_0282"
     CDS             complement(294482..294757)
                     /locus_tag="DEHABAV1_RS01570"
                     /old_locus_tag="DehaBAV1_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928760.1"
                     /db_xref="GI:500355982"
                     /translation="MWFLIGIAVGAAVLGIVTLLRAKKIALTWYEWVLGIIGLGLLLF
                     TLQNFFGSFAELETKAAYIFLIIPGLPSLIMLALAWQLAARRQNKSV"
     gene            complement(294908..295174)
                     /locus_tag="DEHABAV1_RS01575"
                     /old_locus_tag="DehaBAV1_0283"
     CDS             complement(294908..295174)
                     /locus_tag="DEHABAV1_RS01575"
                     /old_locus_tag="DehaBAV1_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928761.1"
                     /db_xref="GI:500355983"
                     /translation="MWLGLFLGLVFGIGAMWLLKKGLVIKWHIWALSALAFLSLYGGI
                     THYVGSIHEYEPTAGLFGLIIFGAISLILAGFAFQLGWRQNKSR"
     gene            complement(295198..296688)
                     /locus_tag="DEHABAV1_RS01580"
                     /old_locus_tag="DehaBAV1_0284"
     CDS             complement(295198..296688)
                     /locus_tag="DEHABAV1_RS01580"
                     /old_locus_tag="DehaBAV1_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928762.1"
                     /db_xref="GI:500355984"
                     /translation="MSDFHSTLSRREFMKALGLTGAGVGAVAASAPVIHDVDELLASA
                     EESEIKHQNPWWVKERDYFNPTVPIDWDLKWRVDGRNARLYNVQDSKWFFNAYSETQA
                     QIYADACMKEDPDFKWGDARRMALEAGCSFAQFGSLTLNSGTYSLHSYLGNPPNRTPE
                     RDGYAKWVGTPEENLLLLRGAVRFFGGDDVGVMEHDTHLDRVLCTYDMNGFKNSFEDI
                     DEPYQTTNPKVTGIPNSYKWCFTWTLRQPMDVTRRQQGGIMRAYPNYNKYGEAESVGV
                     WRAYSELAIVENRLQLFLRGLGYRGIAGGMSAITSGNAIATVAGCMEHARMGQVAVHP
                     KFGSTVRGTYKMMTNFPLAPTKPIDAGIYEFCKACQICAEHCPTGIIQKNDPTWTTGR
                     NPEDGNDNGTFGEPLPYQAQGFEGWRTDIGKCPHCPVCQGTCPFNELPNASWVHTLVK
                     ATAANTTLFNSFFAQMDRTFEYGRKPFIGYWDDFGTRPTYDLDTYR"
     gene            complement(296763..297491)
                     /locus_tag="DEHABAV1_RS01585"
                     /old_locus_tag="DehaBAV1_0285"
     CDS             complement(296763..297491)
                     /locus_tag="DEHABAV1_RS01585"
                     /old_locus_tag="DehaBAV1_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP binding protein"
                     /protein_id="WP_011928763.1"
                     /db_xref="GI:500355985"
                     /translation="MADVFISWSGGKDCCLSAYRAIRDGHNIRYLASIITNNTGRLWP
                     HLLTPEVLNMQAQAMGIPLLEWDTDISNYNSEYIKMLQYLKGKGVNHGVFGDVSIGNA
                     QANEHKSWIDSVCVPNGIVSHLPLWDETRESLWRDLLESGFEAIIIAVDNDKLGKDYL
                     GQRLDKNLLSELKVRHQLSPTGEVGYYHTFVVDGPIFSHRLKLVKAEPIQYAVPKDVW
                     YLDIQECKLEKKESYSPSLKISQY"
     gene            complement(297683..298363)
                     /locus_tag="DEHABAV1_RS01590"
                     /old_locus_tag="DehaBAV1_0286"
     CDS             complement(297683..298363)
                     /locus_tag="DEHABAV1_RS01590"
                     /old_locus_tag="DehaBAV1_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011928764.1"
                     /db_xref="GI:500355986"
                     /translation="MKILVIEDNKDIIEFISLAFQVGWPSVKLEIAHKGEDGLELVEK
                     ETPDAVILDLGLPDIDGFEVLKRIRLFSQIPIIILTVRKEELDIVRGLELGADEYMTK
                     PFGQMELLARLRAMLRRQNILTEEPSIIAGPFRFSYYMHKLHYNNKEIPLTTTEGMIL
                     YHLAINSGNIISHKSLAETVWGEEYDGAADSLKVYIRRLREKIEEDPSDPKIIITKSG
                     VGYMLVKK"
     gene            complement(<298407..>298913)
                     /locus_tag="DEHABAV1_RS01595"
     CDS             complement(<298407..>298913)
                     /locus_tag="DEHABAV1_RS01595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881442.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_042377933.1"
                     /db_xref="GI:755024990"
                     /translation="RVDELLDVARGEIGTLNIKPNWFDPLILLKQLSDYFAPEASLNK
                     QIFITDLPDKLPLVWGDEERIQQIILNFLDNAFKYTPRDGQVTLKAYTHGNKIAIEVR
                     DTGPGILDEEKARIFKAYTRFKKQCRRESGLGLGLALAAMIVELHKGKIWCDSVGNQG
                     SVFGFSIPI"
     gene            298979..299257
                     /locus_tag="DEHABAV1_RS01600"
                     /old_locus_tag="DehaBAV1_0288"
     CDS             298979..299257
                     /locus_tag="DEHABAV1_RS01600"
                     /old_locus_tag="DehaBAV1_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010937184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_010937184.1"
                     /db_xref="GI:499239644"
                     /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYR
                     WRQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
     gene            299395..300093
                     /locus_tag="DEHABAV1_RS01605"
                     /old_locus_tag="DehaBAV1_0289"
     CDS             299395..300093
                     /locus_tag="DEHABAV1_RS01605"
                     /old_locus_tag="DehaBAV1_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_042377497.1"
                     /db_xref="GI:755024544"
                     /translation="MVADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEG
                     LRVPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTR
                     ECLAITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTL
                     FIEPGSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGY
                     RPPAPEAIMAVVTT"
     gene            complement(300086..301930)
                     /locus_tag="DEHABAV1_RS01610"
                     /old_locus_tag="DehaBAV1_0290"
     CDS             complement(300086..301930)
                     /locus_tag="DEHABAV1_RS01610"
                     /old_locus_tag="DehaBAV1_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011928766.1"
                     /db_xref="GI:500355988"
                     /translation="MKANKIQINDIPKLFDMFFNESRDGLLLLDAPTGIIKLANPEFQ
                     HQICLPLEKILGKHIWDLRPPKDRPLGKALYQQRFNSNVKLSTHEVIYKRGDNTEIIV
                     ELLSKLLEYDGEKNLIIITRDVTGLKRLDRISRITQFVVDNAGDAIFWLDNLGNIVYA
                     NNSTALLLGYSKEELLSLTIFDINVNLNQLNWESYFIDSGNTSANNKETLFKAKNKQN
                     VPVSIISNRLIYEGVAYNCVFARDLSESNRNKEALLMTQFAIDRAADSIFWLDDQGQF
                     IYSNNATSLLLGYTQAELSNMQIFEIDINFSRSIWRKEFKKLKNDTAGYVETLYRTKE
                     SDFIPVSVMGNYLQYDGKGFNCCFVRDLSKVKQADKAYRMAQFAIDTSGDAIFWLDRN
                     GKIIYANRATTELLGYTASQLSNMTVNQIDPTVVLEEWPNRFDILKSMGSDVVESILK
                     TKDGSILPVSIMGNYMYYDGKEYNFVFVRDISERLKIEESLRQQQTLLEKTVLERTSE
                     LTDTNSLLQVEITERKNAEIKLEKLLEQEAFLRQQIEGQMAQRIEFTRALVHELKTPL
                     TPILGASAMLANNFTEEPWHSIALNIENGAQHLNKRVDLPPIVIPLFK"
     gene            302586..302897
                     /locus_tag="DEHABAV1_RS01615"
     CDS             302586..302897
                     /locus_tag="DEHABAV1_RS01615"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377584.1"
                     /db_xref="GI:755024633"
                     /translation="MNITRQEKLLLTQFAVDRANDGIIWLKPDGCIVYANETLCKMVG
                     YNAEELYRMNIDDLHSSHEKYCTRFERLKKLGGRAILEGSYRNKLGYFIPVEISGNYL
                     L"
     gene            complement(<303011..303838)
                     /locus_tag="DEHABAV1_RS01620"
     CDS             complement(<303011..303838)
                     /locus_tag="DEHABAV1_RS01620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928606.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377917.1"
                     /db_xref="GI:755024973"
                     /translation="MNVERRREAVNRNHSSLSVARQCLLLDLNRSSLYYQAKGLADRD
                     LVVMKLIDRQYLATPFYGARKIALELKKQAGLTVNRKRVRRLMQLMGIRAIYRRPRTS
                     TPATGHKVYPYLLRELEITRPNQVWAADITYIPMSRGFLYLVAIIDWYSRYVISWRLS
                     NTLDADFCVAALEEALSKGTPEIFNTDQGSQFTSEAFTALLKEHNVGISMDGKGSYND
                     NLFIERLWRTVKYEEVYLKAYQDGREARISLCKYFRFYNTNRIHQSLGYLTPVEVYAG
                     "
     gene            complement(303835..304119)
                     /locus_tag="DEHABAV1_RS01625"
                     /old_locus_tag="DehaBAV1_0293"
     CDS             complement(303835..304119)
                     /locus_tag="DEHABAV1_RS01625"
                     /old_locus_tag="DehaBAV1_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011928605.1"
                     /db_xref="GI:500353679"
                     /translation="MEENRRKHSPSFKAKVALEAIKGEETIAQLASRFDVHPSQVHKW
                     KKELAEGAVGIFGDERKHQKPDNQQLVSQLYQQIGQLKVERDFLENALGR"
     gene            304200..304961
                     /locus_tag="DEHABAV1_RS01630"
                     /old_locus_tag="DehaBAV1_0294"
     CDS             304200..304961
                     /locus_tag="DEHABAV1_RS01630"
                     /old_locus_tag="DehaBAV1_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011928767.1"
                     /db_xref="GI:500355989"
                     /translation="MFDGKEYNCGIVRDITNRKIIEEELRCKNIQLEKKGKRIKALSK
                     AYVQAQEQEREWISIEIHDRIIQPLTSLFQQMQTVFSVDPTNERIVDGKLLVLVKSAI
                     KETRNIMNDLYPSDLGRHGLVKVMNEQLLELENRTGIKTQLSMGFCVTIPHSIEVTLY
                     RIFHEALLNIERHSQANNVSVYLTLSDDRTLIELLVKDDGQGFDLETILNNSKSKGIQ
                     SMKRRAEVVGGELFLDSRRGKGTAIEVHLPVKEMN"
     gene            304962..305693
                     /locus_tag="DEHABAV1_RS01635"
                     /old_locus_tag="DehaBAV1_0295"
     CDS             304962..305693
                     /locus_tag="DEHABAV1_RS01635"
                     /old_locus_tag="DehaBAV1_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_011928768.1"
                     /db_xref="GI:500355990"
                     /translation="MVNNQQYQSTKHSNHIEHKIRVILVDDHEIARQGLRTILSSASD
                     IQVIGEAANFEQMMDLLNDTIADVALIDIQIPGKNGIELAKELQICFPQMATLLITGY
                     QSNLYVAEALNCGIPGLITKDSRQGLIINAVRVAANGGSVWENAVLSETIKSMTRLCE
                     AQYSMRTYSGNSQFQQGKTVLLSPKQLELIKLVACGLTNKQIGSKMGYSEATVKKYLS
                     VLMYLLGVSKRTQVGIMATHFDINQ"
     gene            305957..307495
                     /locus_tag="DEHABAV1_RS01640"
                     /old_locus_tag="DehaBAV1_0296"
     CDS             305957..307495
                     /locus_tag="DEHABAV1_RS01640"
                     /old_locus_tag="DehaBAV1_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_011928769.1"
                     /db_xref="GI:500355991"
                     /translation="MEMNIYHSTISRRNFMKGLGLSGAALGAATASAPVFHDLDEMIT
                     SVPKSTTQHAWWVKERDYEDITTPVDWTVWSRREALKNPMPPGFAGNYVPKEQARLQS
                     FRNEIKRGITEKIPGATLRDWALSEAGRSNTTSSSWMGLDVKPPWLWGEASALPVEPW
                     PEGAPKWESTPEDNLRTVQAAGHYFGTPQVGAMEINEHMIRMFDKDGFEHNYSASYEK
                     PMMRFRSEWFEDIPVGFQDANQVKHIPKSCKWAVTYIAAKENALQMTYGMRTGDPQDP
                     WYKRIFPLGYTTGEAYSKADYVKVQFMKFIKMLGYQTYYMGLAGGTSSNSPAGIFSGL
                     AEEARPALACSPYYGNAVRHIGIIVTDMPLSPTKPIDAGIVNFCKVCKKCAETCPSGA
                     ISMETEQQWEPACTGNNPGRKTWYLDWFKCRPWGSPYYCPNCQTVCPFNNPNKAIIHN
                     AVRMTAATTPIFNSFFSSLDKSFGYAHQRSDEERLNWWYRDLNTWQYDDVFGMGTKDP
                     KSWL"
     gene            307508..307783
                     /locus_tag="DEHABAV1_RS01645"
                     /old_locus_tag="DehaBAV1_0297"
     CDS             307508..307783
                     /locus_tag="DEHABAV1_RS01645"
                     /old_locus_tag="DehaBAV1_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehalogenase"
                     /protein_id="WP_042377592.1"
                     /db_xref="GI:755024641"
                     /translation="MANLLVGILLGAVILMVFYWIRSKHYKLTWYEWVIGISGALLLL
                     FTIQNFLGSFAELQTLAAYLFLLVTGLPSLIMLAVVWQLVVRRAKKT"
     gene            308094..308381
                     /locus_tag="DEHABAV1_RS01650"
                     /old_locus_tag="DehaBAV1_0298"
     CDS             308094..308381
                     /locus_tag="DEHABAV1_RS01650"
                     /old_locus_tag="DehaBAV1_0298"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928771.1"
                     /db_xref="GI:500355993"
                     /translation="MLDALSWGLHLIVLTGVCQLLDATARYLIDRDIAPDSRVMVIEN
                     PACPDEKITSCSLAGVSSQRFGCFSVMVGFNKLGVNKRSSNLRLKNNFLKN"
     gene            complement(308492..308707)
                     /locus_tag="DEHABAV1_RS01655"
                     /old_locus_tag="DehaBAV1_0299"
     CDS             complement(308492..308707)
                     /locus_tag="DEHABAV1_RS01655"
                     /old_locus_tag="DehaBAV1_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011928624.1"
                     /db_xref="GI:500353838"
                     /translation="MTKKTIEQRFGERIRVLRKKAEISQEELAFRAGVHRTYLGGIER
                     GERNPSLKNIEAIAKALEVPISDLFIN"
     gene            308790..309389
                     /locus_tag="DEHABAV1_RS01660"
                     /old_locus_tag="DehaBAV1_0300"
     CDS             308790..309389
                     /locus_tag="DEHABAV1_RS01660"
                     /old_locus_tag="DehaBAV1_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928623.1"
                     /db_xref="GI:500353803"
                     /translation="MEDILVIKFIRSVATGLLIIMAGLALLNWVNSSESDNPISSTVA
                     YIPTKSSILQSPLALDSLKTSAHYADGYVFLDFYDPYRLSNYLNKYDYSETHQPYAEG
                     ERYGMYFSDVFYLVPGDNLKIVIYSDVPLGTDLACEISEYKNNGVSGSTPAYTVERYE
                     NGYRAIISCHATESGEYQFKLWHRDKSQSERCAIVFYFE"
     gene            309679..310638
                     /locus_tag="DEHABAV1_RS01665"
                     /old_locus_tag="DehaBAV1_0302"
     CDS             309679..310638
                     /locus_tag="DEHABAV1_RS01665"
                     /old_locus_tag="DehaBAV1_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928621.1"
                     /db_xref="GI:500353696"
                     /translation="MPRKKAPSIKETREWLDLYESGWSEALLAQRKGRDIRTIRRYLA
                     KAQDERRLDLVESELIKSALAKHQEQLLLTLDNLYSAIALPEPYLSLNSTGNNGRIEL
                     NSGRVVVTQVAESTGVAVHLESEDSVLFSLVEEHLDHDLLFLMLNEWKSKLENYVRAC
                     SYIKESRTERLSRRGADERSYNIKEKSADEQICKSICMSDLSEFIYKNSLNYIIKNDK
                     SVLTKARERLAINKERGELILKPGNTLLSCPGKEAEYLQKTLELLTEESLQEHKGPIQ
                     QAYRKLEDETSKLKKVIEEIKLCNFIPGECRVCRRLKGQGGLR"
     gene            complement(312176..312251)
                     /locus_tag="DEHABAV1_RS01670"
                     /old_locus_tag="DehaBAV1_R0005"
     tRNA            complement(312176..312251)
                     /locus_tag="DEHABAV1_RS01670"
                     /old_locus_tag="DehaBAV1_R0005"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(312216..312218),aa:Ala,seq:tgc)
     gene            complement(312287..313114)
                     /locus_tag="DEHABAV1_RS01675"
                     /old_locus_tag="DehaBAV1_0304"
     CDS             complement(312287..313114)
                     /locus_tag="DEHABAV1_RS01675"
                     /old_locus_tag="DehaBAV1_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_011308856.1"
                     /db_xref="GI:499628122"
                     /translation="MPKSKVPKIGIALGGGAARGIIHIGVLEVLEKEGLPLDLVTGTS
                     MGAIIGALYASGHKPQEMKEIVHNLSWKQLMPLLDLAAPRAGFLSSRKIKSYLKELIG
                     DITFAELKKPFACVAADVKTGEEVIFNEGLVIDGVIASMSLPIIFRPVKNKNRFLVDG
                     GIITPIPAQIVRDMGADFVIAVNAIYRHDYIKQNSDSEPSVFDTAFQIVNIMSIHMAQ
                     ENLLAADIAIEPDLSGIGPGDFLKAPEIVLRGELGATDAVPHLKHLLLQKFSYAPPI"
     gene            complement(313092..313727)
                     /locus_tag="DEHABAV1_RS01680"
                     /old_locus_tag="DehaBAV1_0305"
     CDS             complement(313092..313727)
                     /locus_tag="DEHABAV1_RS01680"
                     /old_locus_tag="DehaBAV1_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011308857.1"
                     /db_xref="GI:499628123"
                     /translation="MPDIFEATNGQGFKQAVVESQNLRLRIIQAADAYKAFSLIKDPE
                     VTRYLMWDGPKTINELRLAYQDEAADFETGHRYSFAIERVDKPGLIGSLAFRLIGYKE
                     QALIGYWLGHKYWTKGYMTEAIRLSVHFAFKHLKAERIFGGVFKGNQPSRRTLEKNGF
                     QLDGTLRRDILVRGTWTDVWFMSLLREEWEQNPARYIPLTEEVIHAQIQSA"
     gene            complement(313732..315324)
                     /locus_tag="DEHABAV1_RS01685"
                     /old_locus_tag="DehaBAV1_0306"
     CDS             complement(313732..315324)
                     /locus_tag="DEHABAV1_RS01685"
                     /old_locus_tag="DehaBAV1_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928773.1"
                     /db_xref="GI:500355995"
                     /translation="MTTENKLGIVIGGSLSGGVDVRLNGETLVEDMAVGRYVTIQGKT
                     KRFLGMITDVSLGVTDQRLMLTPPASDEKFLAEILSGTAAYGDLKVIPYLVLGSDEKS
                     LLDGPQPVKTIPSHYAPVDIASNEDIEMVFGKEDATHFYVGNPLDMETRLCLNLPELV
                     KRSNGIFGKSGTGKTFLTRTLLVGMLQKGSCVNLVFDMHSEYGWEGTSEKKHKVKALK
                     QLFPDRVAVFTLDGESSRKRKVSVDFEVKIGYDEIEPEDISLLRQTLNLTEQAVEAVY
                     QLRKHFKKNWIKEANNIGDEEEDKKLLDTLSIHESTFQNLRRGLNTLTRLPFIVENAP
                     VKAVDRVLEYLNRNINVVLEFGRYTDITAYILVANLLTRRIYTSYRDHMEQAMAEDAS
                     KPTPLVITIEEAHKFLNPEVASRTIFGTIAREMRKYNVTLLIIDQRPSGIDPEVMSQL
                     GTKITALLDNEKDIDAVLSGVSGKNELKGVLAKLASRQQALIFGAAVPMPVAFVPREY
                     DQNIYNEVSQKKISSEEIEELF"
     gene            complement(315321..315920)
                     /locus_tag="DEHABAV1_RS01690"
                     /old_locus_tag="DehaBAV1_0307"
     CDS             complement(315321..315920)
                     /locus_tag="DEHABAV1_RS01690"
                     /old_locus_tag="DehaBAV1_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928774.1"
                     /db_xref="GI:500355996"
                     /translation="MDNLSTSRIGEVIDTSTTDFTAQCYQLYNTPALGALVKTGEGEN
                     TIYAAVYHATTSSIEPGRKPIARGQDAVSEEAIYAQSPQLSKLLRSEFSCLILGHRGQ
                     GQILHYLPPRPAHIHSFAESCTPEETAEFCKSFGFLNILVNSELPVPPDEVTAACLRH
                     LSAAAPDKQTFLVKAGKELAKLLPGQYQRLKVILERIQL"
     gene            complement(315990..317195)
                     /locus_tag="DEHABAV1_RS01695"
                     /old_locus_tag="DehaBAV1_0308"
     CDS             complement(315990..317195)
                     /locus_tag="DEHABAV1_RS01695"
                     /old_locus_tag="DehaBAV1_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_011928775.1"
                     /db_xref="GI:500355997"
                     /translation="MSLNLDKTALQIQDMVSELKGRDLEHQKHLQACLDGMARTPAEY
                     QRLLDKVERSKTTFLLARPAEIPNAVHQPPVLPQSYRILATDGSQIDVDRHQLSRCYL
                     INIGRVQLEYGKAPSASLESLPVLYARPEDMVISCGSKELAVEGTLLGIKRSVEETRH
                     LSEMADAAAPGLPTLALGDGTLILWSLLSKEFPEYVVENLLVDGYLKYLEQIKNLNTK
                     DRQVALASYISYPRSTDVVNTLRLLYCPYEPANCISKCDQLANGKRPCDILSGITDSM
                     LFDRILKPGERSALFASSSSILEKYYGEHHVYFYYLKTSEEIARVELPAWTVHCAELL
                     NLSHSLILEQCRLGHGYPVSLSEAHEQAVVSGQDRRIFNQLVEEMLTASQINPSSSAK
                     SLSKKTRWV"
     gene            317320..317943
                     /locus_tag="DEHABAV1_RS01700"
                     /old_locus_tag="DehaBAV1_0309"
     CDS             317320..317943
                     /locus_tag="DEHABAV1_RS01700"
                     /old_locus_tag="DehaBAV1_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter LysE"
                     /protein_id="WP_011928776.1"
                     /db_xref="GI:500355998"
                     /translation="MTFMLTTLLSVMVISFSGVLMPGPMFALTLSRSYHTPWAGAQIV
                     LGHILVELPIILLIYFGFAGFFELIWVQILLSLAGGVMIVYMGLGMIKARREASQDKA
                     SFKHNTVVSGAAMSALNPFFLVWWATVGAMLVMKVSDYGLAGLGALAATHWLVDLAWL
                     CLISFIVYRTHRLWGSRVRELVFIGCGLLLVVFGVYFIISGLKLWLA"
     gene            317970..318995
                     /locus_tag="DEHABAV1_RS01705"
                     /old_locus_tag="DehaBAV1_0310"
     CDS             317970..318995
                     /locus_tag="DEHABAV1_RS01705"
                     /old_locus_tag="DehaBAV1_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase"
                     /protein_id="WP_011928777.1"
                     /db_xref="GI:500355999"
                     /translation="MAVGLVYNHIYLNHDTGTHVENPDRLLAIMEYLETHGLKDRLVH
                     VEPKRVGMRELESFHKRSYISRVEEVGFSGGGWLDQDTVISLDSYEAALYAVGGVIEG
                     VDKVLSRELDSVFVLCRPPGHHALPEASMGFCVFNNVALGALHALNKHKLKRVAVVDF
                     DVHHGNGIQHVCLNDPRLIYLSLHQIHHFPFTGDSRENGPFQNILNIPLPAGCGDSHY
                     QKAFDEVIGPYLRKFAPELILVCAGYDAHFADDMGEMCLSQQGFAGITRAIKHAAEEV
                     CGGKLVFSLEGGYHYLGLAEGVGATLAVLLNEALPPPNTKAPEGAVGNPDIDLMINDL
                     RHINGIR"
     gene            complement(318969..319904)
                     /locus_tag="DEHABAV1_RS01710"
                     /old_locus_tag="DehaBAV1_0311"
     CDS             complement(318969..319904)
                     /locus_tag="DEHABAV1_RS01710"
                     /old_locus_tag="DehaBAV1_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_011308863.1"
                     /db_xref="GI:499628129"
                     /translation="MATRKTRAASFSIASNSTLIAMKTVVGFVTGSVSILAEAIHSTL
                     DLIAAVIAFFGVKASDKPADIDHPYGHGKWENVSGTVEAVLIFVAAIWIIYEAVNRLI
                     GGSAPEMLEWGVVIMGISVVANTLVSRYLKKIAHETDSVALEADASHLTTDVITSAGV
                     LVGLVLVKITGWVILDPIVALLVALLIIKAAWDILNKSFGALVDARLPKEEVEAITSL
                     INEHTSKLVEFHNLRTRKAGSYRYVDLHLVMPKTLSVEKSHAICDHLEQDLKDKLKVD
                     YVTIHVEPCTEENCPECQMSCKKRHSELPDTVNMP"
     gene            complement(319927..320832)
                     /locus_tag="DEHABAV1_RS01715"
                     /old_locus_tag="DehaBAV1_0312"
     CDS             complement(319927..320832)
                     /locus_tag="DEHABAV1_RS01715"
                     /old_locus_tag="DehaBAV1_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecF"
                     /protein_id="WP_011928778.1"
                     /db_xref="GI:500356000"
                     /translation="MNKIIQHRPLFIFISALIILAGLASLLIFGLKPGIEFSSGSMLT
                     VKFDQTVSIDELTQELRSLGQNEAIVQVTGDGDYLIRTSQLDVSQKISLETSLEETFG
                     NLTERGFENVDPMIARQTTQMALIAIGAALVGILLYVTWAFRRMPKPFHYGTCAVIAL
                     FHDALVVLGIFALLAGIFGWEINLMFIIGIMAVIGYSINNTVVVFDRIRENQLKGIHP
                     SFEVVVNQSIMETVVRSINSSFTVIITVVALMLFLGASIQNLSIVMLIGLIAGTYDSL
                     FVAPSLLVTWENGDWGKLLKPFKKA"
     gene            complement(320825..322129)
                     /locus_tag="DEHABAV1_RS01720"
                     /old_locus_tag="DehaBAV1_0313"
     CDS             complement(320825..322129)
                     /locus_tag="DEHABAV1_RS01720"
                     /old_locus_tag="DehaBAV1_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecD"
                     /protein_id="WP_042377935.1"
                     /db_xref="GI:755024992"
                     /translation="MILAFTIVLPTDKGTLLGKGILFGLDLKGGLHMVYQADLSNVDE
                     SDIDGVMDGVVEVISNRINPLGVTEALIQRQGDDRIVVELPGLDITDEQKARIGRTAL
                     LEFGELAADGEDYKWENSLGKWKPVTATIDGVEYALTSAYFKDSTYVNRDQYGNILLV
                     FEWDATGAKLSKEITTRLLNQQLGIFEGDEALSGDDGVPIAPVINNVIETSGVIEGLS
                     YNEADMLSNQLNAGRLPVPLESIYEQTVSPTLGQNFVDLAVKAGLVGIILVMIFMIAF
                     YRLPGLLSSIALVFYGVIVMALFKLVPVTLTLAGIGGFIVSAGMAVDANILIFARLKE
                     ELLSGKTLGAAVEAGFSRAWSAIWDSNVTTFIACGILFWVGGTIAAGAPVKGFAVTLF
                     LGVAVSMFTAIFVTRTLLRLFVGTKTGKKLALFTTQTRGKNE"
     gene            complement(322188..323693)
                     /locus_tag="DEHABAV1_RS01725"
                     /old_locus_tag="DehaBAV1_0314"
     CDS             complement(322188..323693)
                     /locus_tag="DEHABAV1_RS01725"
                     /old_locus_tag="DehaBAV1_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="WP_042377599.1"
                     /db_xref="GI:755024648"
                     /translation="MKTVTNKNQLLHTDKKTAALLEDLHRLLSAEGTETYLVGGFLRN
                     LVLKKPTADIDLCVIGNGFSAASKISRHFKATQIVLDADNDVTRVMLPGFQLDISGTP
                     DISANLARRDFNLNAMAAPLSALNHGNLQIHAIVDPMQGLRDIENRVIRVTSSEVFRA
                     DPIRLIRAIRLSAELGFELDEQTQSLITTHAGLISTVAGERIREELLKLLETSQTGIW
                     EKCLELGLLLSIFTELDPCYRHPQPYEHTWDVLEHSIKTIYALDAILGKSVWPYQKPE
                     ITSEIYRDSNFEKYFIQQISGTSRIRTLAKLAALLHDIAKPQTRSTDPDGRVRFTGHP
                     LEGSRITSEILTRLRFSKKEISLVEKMVCYHLRPVQMNPDGQLPSSKAIYRYFRDLSE
                     AATATLYLSLADHLATDGPNLMVANWQEHVNIVAHILSEQKRQLTRLTPKRLITGTDL
                     IERFALRPGPRIKILLGEIAEAQAAGEIKTRREAFKFISQRLGGKPENNLN"
     gene            complement(323844..324245)
                     /locus_tag="DEHABAV1_RS01730"
                     /old_locus_tag="DehaBAV1_0315"
     CDS             complement(323844..324245)
                     /locus_tag="DEHABAV1_RS01730"
                     /old_locus_tag="DehaBAV1_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011308867.1"
                     /db_xref="GI:499628133"
                     /translation="MSKATSSNGWADLGEIIRQQRVKIPLTLQELAAKTSVSPSHLGR
                     IERGERFPSARILKRIAHPLGFEEDELFTLAGYLTPQKDSISEMEAEYTSIPRQLDPY
                     VAKVLAQEPIELQRAVIAILAMLKSISKSMT"
     gene            complement(324505..326952)
                     /locus_tag="DEHABAV1_RS01735"
                     /old_locus_tag="DehaBAV1_0316"
     CDS             complement(324505..326952)
                     /locus_tag="DEHABAV1_RS01735"
                     /old_locus_tag="DehaBAV1_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="WP_011928781.1"
                     /db_xref="GI:500356003"
                     /translation="MAFAELAVNTPVLRPGSFSYSIPLGLEIKPGQAVWAPFGPKIVQ
                     GIVLEVSDQPAFGQTREICGVISDTPLLSFHQLNLAAWISQTYLCSIYEALSPMLPPS
                     FERRSVAYISLEPSPLNKSEKPPATLSPSLQKIFDWLQTRDITPQTELENIFGKKTTQ
                     TAIPKLINQGLINRTYQISPVRTQTKFEKHFGLSEQALAFIKDQTLTKLSPRQTEVFE
                     CLRENPQGISKSRLNLLVKNNAAILKALEKKELILSEEHQVFRQPINYSQIETLPHLK
                     LSPPQEKCLESINRSLNTPPEDDQNPRTFLLHGITGSGKTEIYLQALAEALRLGKKAI
                     VLVPEISLTPQTIARFAGRFPGRVAVLHSRLSPGEQFDEWQRIKNGQADIVIGPRSAL
                     FAPLDKPGIIIIDEEHEWTYKQQNSQPRYHTRTVALKMTEEYGAVLVLGSATPDIDSY
                     FKAQNGLYQLLELPERLTPYRGASLPKTELVDMRTELSEGNRSIFSRNLHASIEKVLA
                     KHEQAILFINRRGGASFIQCRDCGYVAMCKSCDTPLTYHPDQENLVCHQCGRHYPNPL
                     TCPNCKSRRIKYLGMGTQKLEEETGLAFPQAKLLRWDSDVTKGKDSHQQIMDKFSRHQ
                     ADILIGTQMVAKGLDLPGVTLVGVINADISLNLPDFRAGERTFQLLAQVAGRAGRGLA
                     GGKVVIQTYTPENYAIQSAVCHDYPGFYAKEIAYRRELNNPPFQKLACLVFSHLNHDF
                     CQQQAILLAQTLREKADSTGSGTLEILGPAPAFIQRLRGRYRYQIILRSPNPANFLRD
                     INLGQGWSIDIDPYGLC"
     gene            complement(326973..327368)
                     /locus_tag="DEHABAV1_RS01740"
                     /old_locus_tag="DehaBAV1_0317"
     CDS             complement(326973..327368)
                     /locus_tag="DEHABAV1_RS01740"
                     /old_locus_tag="DehaBAV1_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZA7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_011308869.1"
                     /db_xref="GI:499628135"
                     /translation="MEETMNNQEAPETSEEETVAVENTKAEKVLPNFGPGDTIKVHAR
                     IKEGDKERIQMFQGVVLKVKQAADGGNFTVRRISYGVGVERTFPFLSPNVTKVEIMKK
                     GRVRRARLFYLRKLSGKAARIKEVKQTPS"
     gene            complement(327492..328238)
                     /locus_tag="DEHABAV1_RS01745"
                     /old_locus_tag="DehaBAV1_0318"
     CDS             complement(327492..328238)
                     /locus_tag="DEHABAV1_RS01745"
                     /old_locus_tag="DehaBAV1_0318"
                     /EC_number="2.1.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FSB5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /protein_id="WP_011928782.1"
                     /db_xref="GI:500356004"
                     /translation="MKIDVLTLFPEMFQSPFEESIFKRATDNNLVRLEIHNFRDFAHD
                     KHHAVDDSPYGGGAGMLLKPEPLFEAVEDVLREDPTPAPVILLSPQGRSFNQEVAREL
                     AKHERLIIICGHYEGFDERVREHLSTDEISIGDFVLTGGELAAMVVIDAVSRLIPGVL
                     GSGESSQDDSHSNGLLEHPHYTRPPVFRGWGIPDVLLSGNHAQINRWRRKESLRRTLK
                     RRPDMFEKIPLSKADRKLVDEILAEENTQG"
     gene            328421..328849
                     /locus_tag="DEHABAV1_RS01750"
                     /old_locus_tag="DehaBAV1_0319"
     CDS             328421..328849
                     /locus_tag="DEHABAV1_RS01750"
                     /old_locus_tag="DehaBAV1_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FSB6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator MraZ"
                     /protein_id="WP_011928783.1"
                     /db_xref="GI:500356005"
                     /translation="MFFGEFEYKLDEKGRFPLPPAIRPSLKDGLILAPGTGEKCIYAY
                     PLCEWKKLAESLKSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKTYAGVNI
                     EVIVAGVNNYLEIWDKETWESEKKASQEQAWQIIETLEEH"
     gene            328856..329905
                     /locus_tag="DEHABAV1_RS01755"
                     /old_locus_tag="DehaBAV1_0320"
     CDS             328856..329905
                     /locus_tag="DEHABAV1_RS01755"
                     /old_locus_tag="DehaBAV1_0320"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZA4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase H"
                     /protein_id="WP_011308872.1"
                     /db_xref="GI:499628138"
                     /translation="MIEYPHIPVMLEESIQGLGVIPGGRYVDCTLGAGGHSEAILEHS
                     YPGGQLLSIDADPSAITLAAERLKSFGSSVLLVNDNFANLKDICQRYEYMPVHGILFD
                     LGLSSMQLDRQESGFSFQTEAPLDMRFSPEQELTAADIINGYDVTELSDLIWKYGEEP
                     FSRRIARAIAEKRPFKTTTELAAAIERAVGGRHGRIHPATRTFQALRIAVNEELSHLE
                     SALSQAHSLLGHGGRLVVISYHSLEDRIVKQYFQKEAKGCICPDDIPQCVCDHQPSLR
                     IINRRVITPSDEEISRNPRSRSAKMRVAERIIEPGEGRFFSSREDELVNHVSRTGSVQ
                     HGQAKHKGVVQRGGS"
     gene            329976..331202
                     /locus_tag="DEHABAV1_RS01760"
                     /old_locus_tag="DehaBAV1_0321"
     CDS             329976..331202
                     /locus_tag="DEHABAV1_RS01760"
                     /old_locus_tag="DehaBAV1_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_011308873.1"
                     /db_xref="GI:499628139"
                     /translation="MKNRIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHK
                     GLVVNINDARESIRESIRKAEQASGYKVESAYVGVTGRHVTSMNNKGVVAITRNDRLV
                     RSDDLKRVMATAQNISVPNDRKLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIIT
                     AAATSVQNLVKCIRGLGIDIDDLVLEPIASSEAVLTDDEKQVGVILADIGGGTTDICV
                     FKDGSIWHTAIIPVAGYQLTRDVAIGLGLPFDVAEEMKKRYGSVLPVYETKMESPSPI
                     CEDGHGVSYQDLCDIIRARVEEVLRLIMLEIPNSDYDSLVPAGLVLTGGSSNLAGMET
                     LGRDILRIPVRVGNPDKVYGIVDSLHDPAYATGVGLLLWGAKHQPVKKSWLDNIGFFG
                     RMRNLLKGFAGLFGTN"
     gene            331242..332372
                     /locus_tag="DEHABAV1_RS01765"
                     /old_locus_tag="DehaBAV1_0322"
     CDS             331242..332372
                     /locus_tag="DEHABAV1_RS01765"
                     /old_locus_tag="DehaBAV1_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_011308874.1"
                     /db_xref="GI:499628140"
                     /translation="MAKTSFVPNPARIKVFGCGGGGCNAVTRMVREEIQGVEFIAINT
                     DAQALAITEAPIRLQIGERVTRGLGAGGDHNMGQKAAEESRDEIREIVNGADMVFVTA
                     GMGGGTGTGSAPIVAEESKKSGALTIAVVTKPFTFEGAHRASTAKEGINRLLGKVDTL
                     IIIPNDRLLDLCDQKTGVDAAFKMADDVLRHGVQAISEVITVPGLINLDFADVRAVMR
                     DAGPAWMSIGYGSGKNRASDAAKSALASPLLDVSITGSKGVLFNIVGGPDLSLMEVNE
                     AADVIKQAVDPDANIIFGVASDASMGSNVKITLIATGFVSKMGMAEEEGDDAITRQLK
                     GIKTEDELDVPSFLRRPLFNRARPVAPPVDTRSNKPSSRISW"
     gene            332516..333043
                     /locus_tag="DEHABAV1_RS01770"
                     /old_locus_tag="DehaBAV1_0323"
     CDS             332516..333043
                     /locus_tag="DEHABAV1_RS01770"
                     /old_locus_tag="DehaBAV1_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor NrdR"
                     /protein_id="WP_011928784.1"
                     /db_xref="GI:500356006"
                     /translation="MNCPYCSHPDSKVIDSRDVDDGVRRRRECVVCGQRFTTYERFQP
                     AGLFVVKKDQRREEFNKEKLLSGLRRACEKRPLPAGAVDKVAGDIEAELYNMGKAEIP
                     STLLGDMVMERLKMLDNIAYVRFASVYREFTDITQLKKVVDNLVNGQDEGIHKGQLSL
                     LPEDKAAPKTRYQRR"
     gene            333417..335645
                     /locus_tag="DEHABAV1_RS01775"
                     /old_locus_tag="DehaBAV1_0324"
     CDS             333417..335645
                     /locus_tag="DEHABAV1_RS01775"
                     /old_locus_tag="DehaBAV1_0324"
                     /EC_number="1.17.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936125.1"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="WP_042377938.1"
                     /db_xref="GI:755024995"
                     /translation="MKLTDNAMCVLERRYLKKDKQGKTTETVEDMFRRVARTIAMGEL
                     IYNPKADVRSREDEFFNLMTRLEFLPNSPTLMNAGRELGQLSACFVLPVDDSIESIFD
                     AVKHTAMIHKSGGGTGFSFSRLRPEQDRVGTTGGVASGPVSFMRAFDVATDVIKQGGT
                     RRGANMAILSIDHPDIMKFVHAKDKAGVLTNFNLSVAITDKFMQAVKDGVDYDLLNPH
                     NGEVVSSLNASEVFNKIVHMAWKTGDPGIVFIDRINAYNPTPQLGRIESTNPCGEQPL
                     LPYESCNLGSINLSRMVTVSGGQNTVDYKKLSRVIKSAVRFLDNVIDVNKFPLPQIEE
                     MTKKSRKIGLGVMGFADMLLELGVPYNSENSIKLAEEIMCFVNDEAHKFSSELAVERG
                     VFPAYRGSIYEKSGRPMRNASCTTIAPTGTLSIIAGCSSGIEPHFALCFTRNILDGTK
                     MIEVNPYFERAAKEGGYYSEELIKSLAEGAHLDEVDVPQDAKDLFVTAHQIVPEWHVR
                     IQAAFQKCTDNAVSKTVNFSRDAGECDVAEVYKMAHASNLKGITIYRDGSREDQPMST
                     GKAENKIETPAVAVNPNLMPRKRSKVTQGITERVTTGCGYIYVTVNSDEHGICEVFSS
                     LGKAGGCASAQLESTCRLISLALRSGMEVASVVKQLRGIRCPSIAWDDSKAVLSCADA
                     IASVLEKHVNGYSQPVAASTKTGSVSGLVRNIAGQCPECGSILVYQEGCFICPGCGYT
                     KC"
     gene            335875..336459
                     /locus_tag="DEHABAV1_RS01780"
                     /old_locus_tag="DehaBAV1_0326"
     CDS             335875..336459
                     /locus_tag="DEHABAV1_RS01780"
                     /old_locus_tag="DehaBAV1_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308878.1"
                     /db_xref="GI:499628144"
                     /translation="MTDTLERVMIFIDGSNMYHYLKSHFQRTDIDFGCFCSKIAGHRR
                     LVRIYYYNAEVGRKEEPERFNDQKKFFTSLEKIPYMELRLGRLVYSGWPATPPYEKGV
                     DVLLSTDMLSHGFKNNFDTAILVAGDSDFVSALQAVKDNGKNVEVALFGKESTSVELR
                     KVADKIIAVDGRLLRNCWKQQRNNYGTQRPPQES"
     gene            336428..338062
                     /locus_tag="DEHABAV1_RS01785"
                     /old_locus_tag="DehaBAV1_0327"
     CDS             336428..338062
                     /locus_tag="DEHABAV1_RS01785"
                     /old_locus_tag="DehaBAV1_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011928786.1"
                     /db_xref="GI:500356008"
                     /translation="MARKDRLKNRKELSRTRVSYASSQRVAGESGVVIKDWGGRLPLA
                     VAYPNSYYVGMSNLGLHTLYRLINNYPEYLAERFFWEGGTAKGRPTLSVESRRPLTDY
                     VALLFTLSYELDFLNIPSMLADCGMPLYARERDEAFPLVIGGGACIMSNPSPVADFFD
                     AFCIGEAEAILPELLAVLSETAGESKGLILERLAKIPGLYVPSIPPEQPIERVFPSEL
                     TQGVGTAVFSTATELGEMYLMEVERGCGHQCRFCLVAGVFCPLRYHPLELLLKQAEEG
                     MLKRKRIGLVGPVVSDHPQVTELVSRLRNMGFGLSVSSLRIKPLSEKMLDELALSGVS
                     SLAMAPEAGSERLRRIIRKGITEDDIIRAAALVAEKGFRQLKFYFMLGLPGEADEDVE
                     EMIVLAEKAQQAMSSKGRGVRLSLNIAPFVPKPATPFQWLGMEDAALIKRRLDTIRLR
                     LEGQGIEVRAESPEMSQIQAVLSRGDSSLSNLLATAGGDSLACWKRAAKSLEIDSQSL
                     AKTRFDLADELPWHMLENQKQRQKLETEYKAAFKEI"
     gene            complement(338112..338561)
                     /locus_tag="DEHABAV1_RS01790"
                     /old_locus_tag="DehaBAV1_0328"
     CDS             complement(338112..338561)
                     /locus_tag="DEHABAV1_RS01790"
                     /old_locus_tag="DehaBAV1_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl-tRNA amidotransferase subunit B"
                     /protein_id="WP_011308880.1"
                     /db_xref="GI:499628146"
                     /translation="MPTLKEKFGEEVKLSLRQGEKLKCSVLRMLVSAISYAEIAKQKT
                     FTDEEIIGVIAKEIKQRRESIDAYKQANRPELVEKEQQEMEILQSYMPEQMGEAELTL
                     IIKKVISETGASTPQDKGKVMGKLMPLVKGKADGQMVNAIVTALLNN"
     gene            complement(338563..338757)
                     /locus_tag="DEHABAV1_RS01795"
                     /old_locus_tag="DehaBAV1_0329"
     CDS             complement(338563..338757)
                     /locus_tag="DEHABAV1_RS01795"
                     /old_locus_tag="DehaBAV1_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z9K2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_010936130.1"
                     /db_xref="GI:499238590"
                     /translation="MADVRPENNESFESMLKRFNRKVQQDGILSEARRRTRFERPPTR
                     RKRKDAAKRRLAIKAARKAT"
     gene            complement(338931..340697)
                     /locus_tag="DEHABAV1_RS01800"
                     /old_locus_tag="DehaBAV1_0330"
     CDS             complement(338931..340697)
                     /locus_tag="DEHABAV1_RS01800"
                     /old_locus_tag="DehaBAV1_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377605.1"
                     /db_xref="GI:755024655"
                     /translation="MKHKFLLRVLGVFSTLALLIVALPLSPVSAAASITLYPNSGPAG
                     SLVNFSIATTATNGTTAWILFGGTQITTATVSGGSASGSFTVPTTVTRGAYTVSTLGL
                     ESVASATFTVTPSITLASATGYVGDSVAVTGSGFAPSTTVNFYLSGSTTAFAHLNSSS
                     TGTVSGTITIPPAKQGVLSITANDSGTPGTAPVNFTINPKITLSTDNPGVGDSITVTG
                     SGFYEGIIQISVDSGTAANAGVSVGSNGSFSTTFTIPALTRGIHTLTANDAWNKSAQA
                     TFDIAQKISVTPTSGTVGTSITVKGSGFNTTGSVTLTYFGQSVTVALTSGTFTTTFVI
                     PGVQAGVYTLSATDGSVIATTTLTVTTNITMSPTNNASTPGSVGQEITLTGSGLKAND
                     TVLVTFDSAQLTITPSPIVDSNGGFSLIFKIPATTAGPHTITVISGTTSKTFTFFVEG
                     TAPATPAPLTPEMGLKAKQPVVFDWEDVTDPSGVTYVLEIATDENFATILYQIKDLTD
                     STYTMTEAQKLESVSSDSPYWWRVKAVDGAGNASAYTGAGSFTVGFSLDLPAWATYVL
                     IGIGGLLLLALGFWLGRRNADY"
     gene            340905..341219
                     /locus_tag="DEHABAV1_RS01805"
                     /old_locus_tag="DehaBAV1_0331"
     CDS             340905..341219
                     /locus_tag="DEHABAV1_RS01805"
                     /old_locus_tag="DehaBAV1_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928788.1"
                     /db_xref="GI:500356010"
                     /translation="MTLLENDLRIEEADLLPELTSYPDQGCEFSKTCLGCPLPVCIFD
                     QPRGRQRWLKRQRDKEIVSLFQHGQSERELADRFRLSIRTIQRVLKKSLAGVNINRNA
                     EV"
     gene            341229..342593
                     /locus_tag="DEHABAV1_RS01810"
                     /old_locus_tag="DehaBAV1_0332"
     CDS             341229..342593
                     /locus_tag="DEHABAV1_RS01810"
                     /old_locus_tag="DehaBAV1_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="portal protein"
                     /protein_id="WP_011928789.1"
                     /db_xref="GI:500356011"
                     /translation="MVQVFNPGELASRDLDRLKRYMNLLDFYQGKQWEIRPSRNEKQL
                     TFNYARVVVDKLCSYLMSGVNFGAEAVTDQGSEKAALARSMLNEVYQQNNLEQLDLET
                     EIDCAVLGDGCFKVIWDAAAGRVRVSAPDIQGIYAWWSPDDMSRIYRVASRYALNSEE
                     AAVSYGLELSAKRSFLTEVWTEETFELWLDEKLLESKPNPYGFIPFVIFPNLREPKRF
                     WGVSDLDEIMEPQRELNRALSQLSRILELSGNPIAVLENVEQSEDIAVRPGAVWNLPE
                     DTRAYLLDLLQGGGVGLHINYVDLLYRTLHDIAEAPRAAFGGSGRDLSGVALEIELQP
                     LLQRVWRKRLIRSVAYRKRSGMILRLLEKYRGLDFNGVDPSISFSPVLPRDLSVVVGN
                     EQTMVQSGIHSRRKAMNELGIKDPDAEFERWCEERRRILEMNRDSSVKSGKQRQSERV
                     ALEE"
     gene            342596..343066
                     /locus_tag="DEHABAV1_RS01815"
                     /old_locus_tag="DehaBAV1_0333"
     CDS             342596..343066
                     /locus_tag="DEHABAV1_RS01815"
                     /old_locus_tag="DehaBAV1_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015406920.1"
                     /db_xref="GI:505219818"
                     /translation="MKKKGVQVKTTEKEPEPLVSETEAVSTEDSAESMDSLKERLALS
                     QSRAEELLKSQQEACERVTQLEVELRLAVESYRRLMVEQNPEVIPELISGQTVEEINR
                     SLEVSRKLVARVKQSLEKDAVLARVPLGQASRQKPDFSSLSAREKIKYAVGGTN"
     gene            343069..343989
                     /locus_tag="DEHABAV1_RS01820"
                     /old_locus_tag="DehaBAV1_0334"
     CDS             343069..343989
                     /locus_tag="DEHABAV1_RS01820"
                     /old_locus_tag="DehaBAV1_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928791.1"
                     /db_xref="GI:500356013"
                     /translation="MAISLTEASKLSNDILKQGVIETIVRESPVLANMPFIEVMGNGL
                     TYNQEKTLPDISFYDTGDTWDESTPTFEQKTAQLKIMGGDADVDNFLKTTRSNVQDLE
                     TAIIELKAKALKDKFEEVFIYGDSAVSSKQFDGLRKLINPASASSQLVAAGASGASLS
                     LAKLDELVDAVKGGKPDMLLMSRRSRRKLNALLRAGGGMLETDRDKWGNFIQFWDGIP
                     IGVSDWILDTHVVAEGLETATSGGGCSAIYALQFGEGGLCGLSSPGFVQVEALGSLED
                     KDASRTRVKWYCSLALFSAVKAAALIGVTD"
     gene            344057..344656
                     /locus_tag="DEHABAV1_RS01825"
                     /old_locus_tag="DehaBAV1_0335"
     CDS             344057..344656
                     /locus_tag="DEHABAV1_RS01825"
                     /old_locus_tag="DehaBAV1_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928792.1"
                     /db_xref="GI:500356014"
                     /translation="MNLVAMRTLVRRDLHDEDEVNRRWTDAELDRHIGHALEELSRSV
                     PLETECLIPVTDGDREFTLSTLEGFIRLQAVEYPIDSYPPVFHRFDCRADKMKLLDEV
                     LPEDGYIRLYYSASHTMTAESTSLPSYLEDLVAIGAEGFASLEWAVFCVNRVNSGGTD
                     TPKVFEAIGRERLVYFRNELRRLCSQNKVRVNSLFTPAG"
     gene            344703..344942
                     /locus_tag="DEHABAV1_RS01830"
                     /old_locus_tag="DehaBAV1_0336"
     CDS             344703..344942
                     /locus_tag="DEHABAV1_RS01830"
                     /old_locus_tag="DehaBAV1_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928793.1"
                     /db_xref="GI:500356015"
                     /translation="MNFYRELWSRIGGRPWTYILRDFWHKYEGLCILALVAGGAFLGH
                     WLWHNVLWYLLNFTFGYIAGHLFWGKDYIPDQKGD"
     gene            344943..346943
                     /locus_tag="DEHABAV1_RS01835"
                     /old_locus_tag="DehaBAV1_0337"
     CDS             344943..346943
                     /locus_tag="DEHABAV1_RS01835"
                     /old_locus_tag="DehaBAV1_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928794.1"
                     /db_xref="GI:500356016"
                     /translation="MYPLSPSLLSAQQSACACPKVKLTVRNRLDGASKLKWEEIYAGT
                     QPEGYHSVAIAGDGAMIRIRIGDNPDNYRLYFQRVAQPAPGADFGQWTYSGSYFFSRA
                     GVVSFGNKVCVVAVDYNRNMFIFESTNNGQTWSAPVKIGTSNTSHVYGVSIAFKPNGD
                     MAVFYIERTLLCYKKRVNGNWQSRQQWDKSTDVLSGVSAVYDGDWRLAVSGTDLFGCS
                     KVWSLSLGDGADFAVGVWSSLYEFASAPAGGLYSYTSVSMDCPDVFRVCYLENYTGSV
                     ADKRAFLSHLVADTGFNDNIWRESVPTSMSSDYGFAMVNDGQYVYLAGISRIYRAKIA
                     QNSLEIGADILRLESACGNLKGSLAVELDNSSGRYTGAGNGELDMLAPGSEIEFYPGY
                     ETESGNEYGPGQLYVIQSLGRRIAGGKSSLLIRAEDAFCRLKRWRATNQMRWNRNSSQ
                     LSVRGILGYVLSKAGIRMEVLNASAQLGNFYPDFTIHVGDDGFELMGKLLSFVTDLVF
                     LQGNCLYSIYPQAADNPLYSYGVTHPVFSGIYADTSSEVNRVVLEGVDAASNLFMVQG
                     FVWEEIYQNHDLTLRLYDRNINTLAQAGERLDSCLRMAVLKQQMGQIVVPINCGQQLF
                     DVISISQPECGLEGLIRRINGIRTSYEPCKGIYRQELSLGKV"
     gene            346953..347165
                     /locus_tag="DEHABAV1_RS01840"
                     /old_locus_tag="DehaBAV1_0338"
     CDS             346953..347165
                     /locus_tag="DEHABAV1_RS01840"
                     /old_locus_tag="DehaBAV1_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928795.1"
                     /db_xref="GI:500356017"
                     /translation="MDIKRAVLKVFNSTSYTASIQLAGDYKSVLEEVKVARNIPSSEM
                     LAGRNLGVWFYDDHNTKDTLVIAVYS"
     gene            complement(347280..348653)
                     /locus_tag="DEHABAV1_RS01845"
                     /old_locus_tag="DehaBAV1_0339"
     CDS             complement(347280..348653)
                     /locus_tag="DEHABAV1_RS01845"
                     /old_locus_tag="DehaBAV1_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928796.1"
                     /db_xref="GI:500356018"
                     /translation="MINKLRPYQQDVARAVLRSIFNQQGQTFSVEIARQGGKNELSSQ
                     LELLLLTLYMFEPKNLVKCAPTFKPQLNISMMRLKDRLNEAGFTNIYHTEGGYIIRLN
                     QARAVFLSAEPSASVVGNTAHLLLEVDEAQDVNKEKYSKEFKPMGATTNVTTVLYGTT
                     WDSFSLLEEIKEQNIEKEQKDGLKRHFRYDWEAVAAHNPAYLAYALSEKERLGENHPL
                     FLTQYRLLPVSGGGGMFSNEQLDLLKGNHPCQIYPEKGKVYVAGLDLAGEDSQTGGIS
                     PTTVNLRRDSSVLTIAELDYTFAKAPYNLPQVRLVCHYSWQGTRHALLYEKLVELLGK
                     VWKCRKVAVDATGLGQPVASFLRESLGSRILPFAFQPASKSRLGFNLLSAVNSGRLKM
                     YAANGSSEYTLFWQEMGLARADYRQSQQMNFYVETTRGHDDYLMSLALCLEAAEAYAP
                     RSAKGSN"
     gene            complement(348643..349005)
                     /locus_tag="DEHABAV1_RS01850"
                     /old_locus_tag="DehaBAV1_0340"
     CDS             complement(348643..349005)
                     /locus_tag="DEHABAV1_RS01850"
                     /old_locus_tag="DehaBAV1_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928797.1"
                     /db_xref="GI:500356019"
                     /translation="MTQEFIERKKGAPYGNQNARKHGFYSRVLDTDELEDYEQATLTE
                     GIDEEIALLRVKIKSVLRHDPDNLKLLMQAVTTLSLLLSARYNISRQDKGGLKEAIFN
                     VLRDVAVPLGIIKATFDK"
     gene            349113..349808
                     /locus_tag="DEHABAV1_RS01855"
                     /old_locus_tag="DehaBAV1_0341"
     CDS             349113..349808
                     /locus_tag="DEHABAV1_RS01855"
                     /old_locus_tag="DehaBAV1_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928798.1"
                     /db_xref="GI:500356020"
                     /translation="MQLAKELYQLQELELDLESHLMQASKLQAILQDDSALRQAENNL
                     VEAASHLKEQQASLRELESQSADLDAKINEIKKSLYSGRINNPKELSNLSKEQEILEA
                     KRTQIDDQALAGMDRLEELQTNCNQVMEGLETARSEWQQNQTQNTQSLNLILLEIEKL
                     KNERHEFMSCFEQPDLVLFQTLRKSKGRAVSKVEQGNCRGCGLKLTAAWMQRARAGTL
                     VQCSGCQRILYLD"
     gene            349827..>350222
                     /locus_tag="DEHABAV1_RS01860"
     CDS             349827..>350222
                     /locus_tag="DEHABAV1_RS01860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003924665.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377940.1"
                     /db_xref="GI:755024997"
                     /translation="MSKIIINTDGASRGNPGPASIGVTLKDEKNNLVACISKAIGHAT
                     NNQAEYQALLAGLEKAASLGAKELEIRSDSELLVKQIKGEYRMKNEGLKPLFSKAVSL
                     LGRFERYQIKYIPRAQNSEADALANKALDG"
     gene            complement(350258..350557)
                     /locus_tag="DEHABAV1_RS01865"
     CDS             complement(350258..350557)
                     /locus_tag="DEHABAV1_RS01865"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_034376741.1"
                     /db_xref="GI:736350944"
                     /translation="MRSPIWPCSGRGLPGQPVTRTAGELLPHHFALTCFHRRYVSVAL
                     SVGSPPLGVTQHPVWRSSDFPPALKAGGHPVYLASFSIAEICSTRIKSTLKTKSG"
     gene            350327..350681
                     /locus_tag="DEHABAV1_RS07240"
     ncRNA           350327..350681
                     /locus_tag="DEHABAV1_RS07240"
                     /ncRNA_class="RNase_P_RNA"
                     /product="bacterial RNase P"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            350362..350665
                     /locus_tag="DEHABAV1_RS07235"
     misc_RNA        350362..350665
                     /locus_tag="DEHABAV1_RS07235"
                     /product="RNAse P"
                     /note="Bacterial RNase P class A as predicted by Rfam
                     (RF00010), score 243.33"
     gene            complement(350773..351390)
                     /locus_tag="DEHABAV1_RS01870"
                     /old_locus_tag="DehaBAV1_0343"
     CDS             complement(350773..351390)
                     /locus_tag="DEHABAV1_RS01870"
                     /old_locus_tag="DehaBAV1_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928799.1"
                     /db_xref="GI:500356021"
                     /translation="MLGRLLLVLLGLSMLSGIYLAVQQSHLSAFLNTTSQTNFVIPSY
                     LHLCEEAVDQATLGLNILLAVSFVSGMFYLYLSHAFYVNLHRITPRYKSRRVFPGFLI
                     PVINLVFPLLFTAETWQLSKQPLETQTALPEYKINLLFKFWWILCLLAVTLFVFPQIS
                     PFALSDSYSSRESVANIFTVATVIAASGGSFILFYQFNTRLKLSN"
     gene            351733..351963
                     /locus_tag="DEHABAV1_RS01875"
                     /old_locus_tag="DehaBAV1_0345"
     CDS             351733..351963
                     /locus_tag="DEHABAV1_RS01875"
                     /old_locus_tag="DehaBAV1_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928801.1"
                     /db_xref="GI:500356023"
                     /translation="MEDLNISALDFVQFCHRRCGQEWPELYDEMCRVAGRRLYRGMGY
                     YELNNLGIPLDLANLDSTLALVDQFKSNQKCS"
     gene            352061..353194
                     /locus_tag="DEHABAV1_RS01880"
                     /old_locus_tag="DehaBAV1_0346"
     CDS             352061..353194
                     /locus_tag="DEHABAV1_RS01880"
                     /old_locus_tag="DehaBAV1_0346"
                     /EC_number="3.4.21.102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="WP_011928802.1"
                     /db_xref="GI:500356024"
                     /translation="MTFRIKVLLGTILSMVGLLGSFALGYFSGGVSALNSDENLSSIV
                     TAWQIITTEYVEPDIIDQAALAEAAIKGMMDELNDPHSVYLNAEDYQASLEYDDGQYV
                     GIGATVQIEDGVITLIPYEGSPAALAGIQAGDILLEVDGQSVDGFSLADLSPLVRGEK
                     GTLITLKVERSISAQPLLFNVTRDEILIPSVSSEMMGDIAYIRLSRFSERTDAELEQV
                     LKNLGDAKGIVLDLRGNPGGLVSSVINVTSRFVSSGVVLTTVDNAGNSEEYKIVPKAV
                     TTSLPMVVLVDQYSASGSEALSGALQDYGRATIVGKTTYGKGSVNRTFDVTGNTGIYL
                     TIGRWYTPNGRMIEGQGITPDIELELAGDEAVNWALNFMHGEA"
     gene            353310..354350
                     /locus_tag="DEHABAV1_RS01885"
                     /old_locus_tag="DehaBAV1_0347"
     CDS             353310..354350
                     /locus_tag="DEHABAV1_RS01885"
                     /old_locus_tag="DehaBAV1_0347"
                     /EC_number="6.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z9I8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine--tRNA ligase alpha subunit"
                     /protein_id="WP_011308890.1"
                     /db_xref="GI:499628156"
                     /translation="MEEIKNITDITQSALAELEAITDLKDLEAWRVRYLGKKSLLTGA
                     LRNLASLPIEERKAAGAAANEAKAALEAAFLQKEQISKEKQFASRNEGLDITLPGRPW
                     PIGRIHPLTQVTNEVTTIFSSLGFSVVEGPEIEDDYHNFEALNIPEDHPARENMQTFW
                     IDRPNDNGRLDTLLRTHTSPMQVRYMEKNKPPIRIVVPGKVYRYEATDATHIPMFTQV
                     EGLVVDRGISMAHLKGTLMEFCRRFFGANRKVRFRCDYFPFVEPGVEVAVSCTCGGKK
                     ECSVCHGSGWLEILGAGMVHPKVLERVGIDSEQYTGFAFGMGLERLPMLRYGIDDIRL
                     FYSNDTRFLRQF"
     gene            354352..356781
                     /locus_tag="DEHABAV1_RS01890"
                     /old_locus_tag="DehaBAV1_0348"
     CDS             354352..356781
                     /locus_tag="DEHABAV1_RS01890"
                     /old_locus_tag="DehaBAV1_0348"
                     /EC_number="6.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZD2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="WP_011928803.1"
                     /db_xref="GI:500356025"
                     /translation="MKIPLKWLKEYLPTDIQPAELAERMTMAGTEVTVLNSHKDKWPN
                     VYVGQIMEVNRHPNADRLVLVKVDWGQGQETVVTGAPNCKVGDKVVFARTGAVLIDGH
                     NGKEIVLKPAVLRGVESCGMVCSERELGLSDEHEGILVLPADALVGMLASEYLGEVIL
                     DLELTPNRGDLMCVTGVARELGALIDRLPAISDPDFKATGPDIKEKIEIEINNSKLCT
                     RYTASLIEGIKLGESPDWLKERLIACGMRPINNVVDATNYVMLEFGQPLHAFDYDQIK
                     SRHIIVRPAAEGEVLTTLDGVERKLSPDMLLITEPDRIIALAGVMGGENTEVTEKTSR
                     ILLESATFDKQSIRKTARGLKLQSEASARFEKGLSYELAPIALKRATQLILEIAGGQA
                     ASGLIDVLPNKKERNGIVLSLAKVNQILGYEKEPPDACKIAKRLGFIWLPEYVPGMEE
                     FGYGATEDMVRIYPGYWRMDIETDIDMIEEVARIAGYHTIPCLPLDKAIPKIETPPLP
                     GMKRFLRQILSGYGFQELISYSFTSREMLSRVSSGAEPEFLAISNPMSSEQEVMRTSL
                     RPSLYASLAANRRFEKDGLRLYELGRVYLPKENKKQEEPEMLCAVIAGGSSQSRWQRN
                     TAGFDFFDVKGIVESMVSRLGLSADFVVSHEHGLSHGYQAGILVGDMPVGILGQVSPQ
                     IADIFDITEPVYMFEINLSKLITRAMVRRKFNPINRFPAVERDLALVIDRHITNRQVI
                     DILSEYDLVKNAELFDMYQGKQIAENKKSLAYHLLFQSDTHTLKDAEVDGVMSQILGR
                     LNTETGAVLRS"
     gene            356871..357506
                     /locus_tag="DEHABAV1_RS01895"
                     /old_locus_tag="DehaBAV1_0349"
     CDS             356871..357506
                     /locus_tag="DEHABAV1_RS01895"
                     /old_locus_tag="DehaBAV1_0349"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_011928804.1"
                     /db_xref="GI:500356026"
                     /translation="MLSDSSKKIKKEVEAINSEFKTIVGCGEAKCPKLKRLRLASTPD
                     ITLTVMIEIPKGSRNKYEYDKERKVIKFDRMLFSAVHYPSDYGFIVDTLAEDGDPLDA
                     LVLVWEPTFPGCMIETKPVGLFKMYDEKGPDAKLLCVPIGDPHFNFIRDLSDVPPHLL
                     KEIFHFFNIYKELESKKTGVEGWEDRESAIKTYWESHQRYLDTLKDTKQEK"
     gene            complement(357571..359280)
                     /locus_tag="DEHABAV1_RS01900"
                     /old_locus_tag="DehaBAV1_0350"
     CDS             complement(357571..359280)
                     /locus_tag="DEHABAV1_RS01900"
                     /old_locus_tag="DehaBAV1_0350"
                     /EC_number="6.1.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="WP_011928805.1"
                     /db_xref="GI:500356027"
                     /translation="MRYSRLFGKTQREIPSDAETISHQLLLRSGMIAQLTAGVYSFMP
                     LAWRSIQKIETIIRQEMNKAGCQELAMPVLQPVEIWQQSGREAPFGQTLFHLKDRKDR
                     NLVLGPTHEEVITDLASRYIQSYRDLPQRLYQIQAKFRDEPRPRGGLIRVREFIMKDM
                     YSFDASPEGLDDSYQTMKQAYESVYRRCGLESMVIDADSGAIGGKASHEFMIVAESGE
                     DSIIYCPKCSYAANAEKAVFKKKTLSKETLKDLEEVATPGQKAISDVARFLAVKPENT
                     LKAVFYMADGKFVMAVIRGDLDINEVKLKNLLKCNDLRLAEDGEVKAAGVVAGSASPV
                     GLKNILIVADDSVENGSNFVAGANKDGFHLKNVNCGRDFRADKMADIALAAEGSACPF
                     CDGTFASKRGVEVGHIFKLGTFLSERFGANFTDAEGVSHPIIMGCYGMGVGRLLAAAI
                     EQNHDEKGIIWPMPIAPYQVYICGLFLDNPVVRESAEKIYKELEAKSIEVLFDDRELT
                     AGVKFNDADLLGIPLRLTISPRNLDKGGVEFKLRRNKESELVPLDSIVERVIATIKSE
                     SDL"
     gene            complement(359374..360420)
                     /locus_tag="DEHABAV1_RS01905"
                     /old_locus_tag="DehaBAV1_0351"
     CDS             complement(359374..360420)
                     /locus_tag="DEHABAV1_RS01905"
                     /old_locus_tag="DehaBAV1_0351"
                     /EC_number="1.17.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FS85.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase (flavodoxin)"
                     /protein_id="WP_011928806.1"
                     /db_xref="GI:500356028"
                     /translation="MITRRQSTEIRLGNLTIGGSAPISVQSMTKTDTRNIPATIAQIK
                     ELEECGCEIIRLAIPDMEAASALKSIRPKVKIPIVADIHFDYRLALASLSAGVDGLRL
                     NPGNIGDPERVKAVVKSAKEREIPIRIGVNAGSLPKDLPPELTIAQKMVKAAMGHIKI
                     LEGLDFGLIKVSLKAFDVPTTIEAYTQIASLIPYPLHVGITETGTPKTGLVRSAVGIG
                     NLLYMGIGDTIRVSLTAPPHEEVFAAYEILKSLNLRQRGPILVSCPTCSRTEVDIVGI
                     ASQVQEALNKIDKPIRVAVMGCAVNGPGEAKEADLGIACGKGQGLLFRKGEKIAVVPE
                     DELVDALLREIASL"
     gene            complement(360456..361493)
                     /locus_tag="DEHABAV1_RS01910"
                     /old_locus_tag="DehaBAV1_0352"
     CDS             complement(360456..361493)
                     /locus_tag="DEHABAV1_RS01910"
                     /old_locus_tag="DehaBAV1_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011928807.1"
                     /db_xref="GI:500356029"
                     /translation="MLLTVVSFLIIFSIVVISHELGHFFTAKAIGVKVEEFGFGYPPR
                     IFGRKFGQTEYTLNWLPLGGFVKVEDDPVNNKGLSSKSAGKRLLFFSSGALVNAILPI
                     ILFAFALIVPHDVLVGRVNVEEVVPNSPAAEAGLVTGDTILSINDQEIRNTAEFSRAS
                     QLNLGQSIEITVLHADQTQSTVSLTPRWQPPAGEGPVGISLQTLDYQITSESESVLKA
                     IPLSVKQNFETLVLFKNSILGLIMGSVPFDVVGPVGLAQMTGDVARAGVGPLLEFTAF
                     LSLNLAIINLLPLPALDGGRIFFVFIEWIRGGRRISPKVENLIHMIGFFLLIGLMLTV
                     TFQDIIRIAGN"
     gene            complement(361494..362627)
                     /locus_tag="DEHABAV1_RS01915"
                     /old_locus_tag="DehaBAV1_0353"
     CDS             complement(361494..362627)
                     /locus_tag="DEHABAV1_RS01915"
                     /old_locus_tag="DehaBAV1_0353"
                     /EC_number="1.1.1.267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928808.1"
                     /note="catalyzes the NADP-dependent rearrangement and
                     reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to
                     2-C-methyl-D-erythritol 4-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="WP_011928808.1"
                     /db_xref="GI:500356030"
                     /translation="MVHSIKKVVILGSTGSIGRQTLEVIRSLPDHFKVLGLAGGANVN
                     LLKEQAGEFRPEYIYCRDCHKESACNSRFIPMEEMAALPEADVIVVATPGGAGLQPVL
                     AAAKASKVIALANKESLVSAGEIVTGIVRENKAKLLPVDSEHSAIWQCLSGEVTPPSR
                     IILTASGGPFRSLTKNEIDKVTPEQALKHPSWKMGLKVTIDSASLMNKGLEIIEARWL
                     FDMHIQNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQYALTYPERVANHTLP
                     RLNWAEVGKLDFEIPDMTRFPCLGLAISAGEEGKTFPAALCAADEVAVDLFLKGKISF
                     GQIPELIAKVLDAHQPVSKPDIDDILAADAWARQKVTELAGNL"
     gene            complement(362612..363415)
                     /locus_tag="DEHABAV1_RS01920"
                     /old_locus_tag="DehaBAV1_0354"
     CDS             complement(362612..363415)
                     /locus_tag="DEHABAV1_RS01920"
                     /old_locus_tag="DehaBAV1_0354"
                     /EC_number="2.7.7.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_011308897.1"
                     /db_xref="GI:499628163"
                     /translation="MLKKRILSGCLLALISLVVIWVDQPIAWLTLAMAVVVALALNEF
                     YNAVTVYLKSQPFKALGIFWGMLIVISPHLQIESILPFLLGSFSLTSLIYLLTLKDRT
                     DAFPRWAWTLSGVIYIGLLASFWVALRELPMGREWVLWTLILTSATDTMAFFIGSRFG
                     KQKMAPSISPNKSWQGAVGGAVFSIIVAPIFADLMDLPINMFIAMLLGLLVSVAGQTG
                     DIAESLFKRNMHCKDSGNLIPGHGGIMDRLDSLLFTGIVVYYYVIWFIQ"
     gene            complement(363419..364129)
                     /locus_tag="DEHABAV1_RS01925"
                     /old_locus_tag="DehaBAV1_0355"
     CDS             complement(363419..364129)
                     /locus_tag="DEHABAV1_RS01925"
                     /old_locus_tag="DehaBAV1_0355"
                     /EC_number="2.5.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate synthase"
                     /protein_id="WP_011928809.1"
                     /db_xref="GI:500356031"
                     /translation="MDTTATINNTPPDHIAIIMDGNGRWAERRGLSRLEGHKAGLENA
                     RRVIRHLSSLGVKYVTLYSFSTENWKRPDAEIKGLFGLINDVISSYIPELAGNNIRLR
                     HLGHLDKLPAMLKHKLESLLSETSQNSGLTLSLAFDYGGRDEIIQAVKKLVKDGIEPD
                     KISEELFAGYLFTTGIPEAGLIIRTGGEIRLSNFLLWQSAYSELYFSEVMWPDFGEKE
                     IDRAISAFNQRQRRFGGL"
     gene            complement(364194..364751)
                     /gene="frr"
                     /locus_tag="DEHABAV1_RS01930"
                     /old_locus_tag="DehaBAV1_0356"
     CDS             complement(364194..364751)
                     /gene="frr"
                     /locus_tag="DEHABAV1_RS01930"
                     /old_locus_tag="DehaBAV1_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZC4.1"
                     /note="Rrf; Frr; ribosome-recycling factor; release factor
                     4; RF4; recycles ribosomes upon translation termination
                     along with release factor RF-3 and elongation factor EF-G;
                     A GTPase-dependent process results in release of 50S from
                     70S; inhibited by release factor RF-1; essential for
                     viability; structurally similar to tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-recycling factor"
                     /protein_id="WP_011308899.1"
                     /db_xref="GI:499628165"
                     /translation="MINEILQKSEKKMSASLDVLLQELSGIRTGRSSPALVEHIRVEY
                     AGVPTPINHLANISAPDPRYITIQPWDRSCLSAIEKAIMKSDLGLMPNNDGNIIRLNI
                     PPLSEERRQEMIKIVNKRLEEDKIAMRNVRRDAMDEMKKLEKAKEISQDDLKRGSDQL
                     QKITDNFIAKADKLGADKEAELRQV"
     gene            complement(364753..365478)
                     /gene="pyrH"
                     /locus_tag="DEHABAV1_RS01935"
                     /old_locus_tag="DehaBAV1_0357"
     CDS             complement(364753..365478)
                     /gene="pyrH"
                     /locus_tag="DEHABAV1_RS01935"
                     /old_locus_tag="DehaBAV1_0357"
                     /EC_number="2.7.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZC3.1"
                     /note="Catalyzes the phosphorylation of UMP to UDP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridylate kinase"
                     /protein_id="WP_011308900.1"
                     /db_xref="GI:499628166"
                     /translation="MAEIKYKRILLKLSGEAFKGATGYGIDIPTVRNIAQEIKHICLM
                     GVEVAIVVGGGNIWRGATAAKEGIDRVSADYAGMLATIINAITLQDALEREGIVTRTQ
                     SALSVQQVAEPYIRRRAVRHLEKGRVVIFAGGTGNPYMTTDTAAALRAIEIEASVLLM
                     AKNKVDGVYTADPQKHPEATLFQHLTYMEAINKRLQVMDATALSLCLDNKLPIIVFDL
                     QSSESLVSAISGQPIGTLISSES"
     gene            complement(365493..365996)
                     /locus_tag="DEHABAV1_RS01940"
                     /old_locus_tag="DehaBAV1_0358"
     CDS             complement(365493..365996)
                     /locus_tag="DEHABAV1_RS01940"
                     /old_locus_tag="DehaBAV1_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="WP_011308901.1"
                     /db_xref="GI:499628167"
                     /translation="MAINAEQIKELREKCGAGVMECRNALVDANGNVEKAQEILREKG
                     LVKAAKKAERETVQGIVESYIHTQGRIGALVELNCETDFVARTDAFKELAHNLAMQVA
                     AMCPLYLSEEDRPAECEVEAENACLLLQPYIKDPSKTINGLIIETVAKVGENIRLKRF
                     ARFELGG"
     gene            complement(366021..366758)
                     /locus_tag="DEHABAV1_RS01945"
                     /old_locus_tag="DehaBAV1_0359"
     CDS             complement(366021..366758)
                     /locus_tag="DEHABAV1_RS01945"
                     /old_locus_tag="DehaBAV1_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S2"
                     /protein_id="WP_011308902.1"
                     /db_xref="GI:499628168"
                     /translation="MPTTNIKELLEAGAHFGHQTSRWHPRMKKYIFTKRNGIHIIDLE
                     KTVVMLDKACNYINQVVSDGGKVLFVGTKKQAQEILAEEAKRCGMYFINQRWTGGILT
                     NFHSIQSRIDYLVRLEDQQARGDFSRLPKKEAQKLGEEIARLNRTMGGFKEMTRLPDV
                     IFVVDPIKEKIAMAEAKRMGVPLVAMVDTNCNPDEVDYPVPSNDDAMRAIKLICSKMA
                     DAVIEAQNAMKVTEVETTGEAQAETAG"
     gene            complement(366944..367711)
                     /locus_tag="DEHABAV1_RS01950"
                     /old_locus_tag="DehaBAV1_0360"
     CDS             complement(366944..367711)
                     /locus_tag="DEHABAV1_RS01950"
                     /old_locus_tag="DehaBAV1_0360"
                     /EC_number="6.3.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_011308903.1"
                     /db_xref="GI:499628169"
                     /translation="MSKVKTLILRTPGTNCDVETSYAFELAGSETELVHINKLLAKPS
                     LLSEFQIMAFPGGFGYGDDLGAGRVLANEVRLKLGEKISRFHESGGLIIGICNGFQAL
                     VKTGILPGPMKDGQKITLTDNNSGRFECRWTYLSVNPFSTCVFTQGLDRLYLPVAHGE
                     GKLLGSPEVINKLNSAVYYTDKDGKRNAPYPANPAGTLMDIAGIADESGRIFALMPHP
                     ERFVRGSQHPRWTGEGLKKEGDGLKIFTNAVKWAREV"
     gene            complement(367718..370579)
                     /locus_tag="DEHABAV1_RS01955"
                     /old_locus_tag="DehaBAV1_0361"
     CDS             complement(367718..370579)
                     /locus_tag="DEHABAV1_RS01955"
                     /old_locus_tag="DehaBAV1_0361"
                     /EC_number="6.3.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_011928811.1"
                     /db_xref="GI:500356033"
                     /translation="MHRIEVSLKPEWPDPKGNGVCHDIQDLGITSVSEVRVIDVYWLE
                     GNLSDSEVLTISGELLSDQIIQTFKYDANCPLAEADGFSAIEVTYNAGVTDPVQETIL
                     KAISDLGIKGITAARTAKRYLLKGEISADELKTIGNKLLINPIVQHVVTSSSNPFPPN
                     PEYTFKLKKIDLLAEKLKDNMASLGKEYSLSHQELSVIYEHYLKLGRAPTDAELETLA
                     QTWSEHCCHKTFKAMLDYDGQIINNLLKQTIAKATAELNKPWCLSVFVDNSGVIEFDD
                     EWGVCFKAETHNHPSAVEPYGGAATGIGGVIRDILGTGLAAKPIANTDVFCFGPPDLA
                     EDKLPPGVLHPRRVFKGVRSGVADYGNRMGIPTVNGAVLFDERYTANPLVYCGTIGLI
                     PKKYALPGKQSTGDLVVLIGGRTGRDGIHGVTFASGELNDRSTELSFTAVQIGNAIVE
                     KRMLDTLLQARDRELFVRITDCGGGGLSSAVGEMAESTGVKIYLDKVPLKYSGLTYSE
                     IWISESQERMLLAVNKEKLGEILALFENEGVEASVIGEFTSDRHLKLFYQDHQVADLQ
                     MNFLHNGRPQLELRATHHKTRHPEADFDCPKDFETELKNILSHWNVCSREWIIRQYDH
                     EVQGGSVLKAMVGAENDGPGDAAVIRPVLGSKKAVVISNGINPSYADVDAYNMAASAI
                     DEALRQIIAVGGNLERVALLDNFSWGNASRPESLGDLVHACQACHDLSLVFGTPFISG
                     KDSLNNEFRYEDKLITIPHTLLISAIGVMEDGDKAISMDFKKSGNLIYIVGKTAEELG
                     GSHYFKNHRFIGNRAPAVNAKRAKENMQALSCATAGGLVAACHDLSEGGLGVTAAEMA
                     FSGKLGAHIRLADVPLAEKIEREDYILFSESNSRFLVEVAPKHQAEFEKLMSGCDFGL
                     VGEVMSEPSLEITGRDGKEILLNTPVSELKEAWQRPMRW"
     gene            complement(370583..371464)
                     /locus_tag="DEHABAV1_RS01960"
                     /old_locus_tag="DehaBAV1_0362"
     CDS             complement(370583..371464)
                     /locus_tag="DEHABAV1_RS01960"
                     /old_locus_tag="DehaBAV1_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal 5'-phosphate synthase subunit PdxS"
                     /protein_id="WP_011308905.1"
                     /db_xref="GI:499628171"
                     /translation="METGTFKVKSGLAQMLKGGVIMDVTTPEQAKIAEEAGACAVMAL
                     ERVPSDIRAAGGVARMADPTIIEQIMKVVSIPVMAKCRIGHFVEAQILESMGVDYIDE
                     SEVLTPADENFHVWKHDFKVPFVCGCRDLGEALRRIGEGAAMIRTKGEAGTGNIVEAV
                     RHMRSVMGSVRRVQSMSPDELSAYAKEINAPLELVLELHKTGKLPVVNFAAGGVATPA
                     DAALMMQLGADGVFVGSGIFKSSNPSAMAKAVVKAVTHYKDAQILAEISKGLGDAMPG
                     LDIKQIDPDKLISQRGW"
     gene            371649..372047
                     /locus_tag="DEHABAV1_RS01965"
                     /old_locus_tag="DehaBAV1_0363"
     CDS             371649..372047
                     /locus_tag="DEHABAV1_RS01965"
                     /old_locus_tag="DehaBAV1_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_011928812.1"
                     /db_xref="GI:500356034"
                     /translation="MNIFKAIMGMCDTSPLADDVWSLMDSQIALDLAKVPALSEKGGA
                     GYMAGKGLAKPVLVVRGQDNNLYAYENACPHGGRKIDPMQGEAKLRCCSVNHSTFDYN
                     GKVLSGPAQHKHELRRLLTSQADGKLLISV"
     gene            372125..372199
                     /locus_tag="DEHABAV1_RS01970"
                     /old_locus_tag="DehaBAV1_R0007"
     tRNA            372125..372199
                     /locus_tag="DEHABAV1_RS01970"
                     /old_locus_tag="DehaBAV1_R0007"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:372157..372159,aa:Thr,seq:cgt)
     gene            372228..372998
                     /locus_tag="DEHABAV1_RS01975"
                     /old_locus_tag="DehaBAV1_0364"
     CDS             372228..372998
                     /locus_tag="DEHABAV1_RS01975"
                     /old_locus_tag="DehaBAV1_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308907.1"
                     /db_xref="GI:499628173"
                     /translation="MSKFIDRLKNVSKGYVRPMGFNAVASAPQPKMLLAVELGIEDLT
                     AKEVFGGADVVLLSTGKTGAKKLKEAAGLLGDTVWGVMLGDKADEAEKMAKAGADFVV
                     FSPDAEVSPLTALEKTGKIIMLENNLTDFMIRAADCLSVGAVIVDGQPDALSLSWRKI
                     MLYQRFADILSKPFLVRVSANISLPELQALWALGIDGVLTNGSEGLSGLRTIIDGAEW
                     AAKRKRGHMSAIVPSIKMPASESVSPEEPEEPDEDDEE"
     gene            complement(373077..374222)
                     /locus_tag="DEHABAV1_RS01980"
                     /old_locus_tag="DehaBAV1_0365"
     CDS             complement(373077..374222)
                     /locus_tag="DEHABAV1_RS01980"
                     /old_locus_tag="DehaBAV1_0365"
                     /EC_number="1.1.1.205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406932.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine 5'-monophosphate dehydrogenase"
                     /protein_id="WP_011308908.1"
                     /db_xref="GI:499628174"
                     /translation="MTVPEFKTLRRTYGFDEVAIVPGGLTVNPEQVEVDFKIGDINFS
                     IPFIASAMDAVTNVDTAVAMSKMGGLSVLHLEGIYTRYENPQEILDQIISKPIDEVTS
                     FMQKVYTAEPIKEHLISKRVSEIKAKGGICAVSLMPANAKKLAPIAVEAGADIISVAS
                     TVTSARHVSKSSHGLVFEEFVKMIKVPVLVGNCVSYQACLELMRTGVHGVIIGVGPGA
                     ACTSREVLGIGVPQITASMDCAAARETYYKETGRYVPIITDGGFKKGGDVCKAICAGA
                     DAVMLGSPFAKATEAPGRGYHWGMSHPHPSLPRGTRIKVGTTGSLEQILFGPTSVTDG
                     TQNLVGALKTSMGVCGASNIREMQQVEMVIAPAITTEGKSYQLSKCQ"
     gene            374484..375308
                     /locus_tag="DEHABAV1_RS01985"
                     /old_locus_tag="DehaBAV1_0366"
     CDS             374484..375308
                     /locus_tag="DEHABAV1_RS01985"
                     /old_locus_tag="DehaBAV1_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011928813.1"
                     /db_xref="GI:500356035"
                     /translation="MALYVVATPIGNLEDITLRALRLLSEVKLIAAEDTRHTRKLLSA
                     HNIKTPLTSYFEHNRLSKLDYILEVLREGDVALVSDAGMPGISDPGYELIKAAHENGI
                     KVVPVPGASAVITAVAVSGLDSGSFSYLGFLPRQKSERRKALSEVEMLGASIVILEAP
                     HRLQGCLLDIKEVLGDRQISVCRELTKIYEEIFRGSISQSISHFSQPRGEFVLVVEGN
                     RQIPAQPELTGDIISELGLLKKQGKSAKESVALVSQKNGLSKKEIYRAWLKIDKAL"
     gene            375333..375548
                     /locus_tag="DEHABAV1_RS01990"
                     /old_locus_tag="DehaBAV1_0367"
     CDS             375333..375548
                     /locus_tag="DEHABAV1_RS01990"
                     /old_locus_tag="DehaBAV1_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308910.1"
                     /db_xref="GI:499628176"
                     /translation="MRRGCISLGEVVCTGCNNTVPYPERYLAVDEENGKEVDKGTTVH
                     YCVECALKKGYASYKEEKGERILTFLP"
     gene            375557..377218
                     /locus_tag="DEHABAV1_RS01995"
                     /old_locus_tag="DehaBAV1_0368"
     CDS             375557..377218
                     /locus_tag="DEHABAV1_RS01995"
                     /old_locus_tag="DehaBAV1_0368"
                     /EC_number="6.1.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407564.1"
                     /note="methionine--tRNA ligase; MetRS; adds methionine to
                     tRNA(Met) with cleavage of ATP to AMP and diphosphate;
                     some MetRS enzymes form dimers depending on a C-terminal
                     domain that is also found in other proteins such as
                     Trbp111 in Aquifex aeolicus and the cold-shock protein
                     CsaA from Bacillus subtilis while others do not; four
                     subfamilies exist based on sequence motifs and zinc
                     content; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine--tRNA ligase"
                     /protein_id="WP_011928814.1"
                     /db_xref="GI:500356036"
                     /translation="MSERIFIGVAWPYANSQLHLGHVAGAYLPADIFARYHRTRGDEV
                     LMVSGSDMHGTPITIRAEQEGITAAEVAERYHQRFMASWPKLGISWDFYTSTATANHA
                     RTAQEMFLSLYEKGYIYKNTVCQPFCSHCNRFLPDRYVEGTCPHCKYEGARGDQCDNC
                     GKPLNAAELLNFRCKNCGNPPEFRETEHFFLKLSAFEEELIRWVETKTHWRTNVLNFT
                     LRYLKEGLKDRAITRDLDWGVPLPLPGYEGKRLYVWFEAVIGYLSASKEWAASKGQPN
                     AWQKYWGVDTKSYYFIGKDNIPFHTIIWPAMLMGKGGLNLPYDVPSNEYLTTESQKFS
                     KSRNNAIWVDDVLSRYGVDTLRYLLSANMPESSDTDFSWREFVRRNNDELVATYGNLA
                     QRVLTMVCRNYDNKVPEYGELDERSLTLIEKTAAMLCETDKALYNCNFREAIRLAMAL
                     AQEANRYLDEKAPWKEIKVDKAAAARSLYVAMVALSGLRVAFYPFLPESSGRLSTYLG
                     FGSELEKEGWILKMPVVGQELTPPEPLFKKLEDSVVEEETARMGL"
     gene            377240..378214
                     /locus_tag="DEHABAV1_RS02000"
                     /old_locus_tag="DehaBAV1_0369"
     CDS             377240..378214
                     /locus_tag="DEHABAV1_RS02000"
                     /old_locus_tag="DehaBAV1_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heptaprenyl diphosphate synthase"
                     /protein_id="WP_011928815.1"
                     /db_xref="GI:500356037"
                     /translation="MLKLSSIYAPINEGLKGVEDEFKLVSESRKKSFPEMAEMLDYIL
                     VGGKVLRPALSMLSAMCFGAGIKKVLPLATSSEMLHIATLVHDDAIDKADTRRGRRTV
                     NAVWGLEKAILLGDFLFAHAAETAAETGNMGIVTLFSQTLQIIASGELKQAYASFNPD
                     QSYENYLERISGKTAALFVMATKGGAILADASPSDEEIMRSYGYNLGLSFQIVDDILD
                     FVGNAKDMGKPIGSDLNNGTVTLPALLLMDRYPDNNPIKDMLNATDRIPHVAKAVEMI
                     NSSDIIDLSYKEAKRYADLACRNLSQLPKTAARESLYQLAEFIVERKN"
     gene            complement(378429..380243)
                     /locus_tag="DEHABAV1_RS02005"
                     /old_locus_tag="DehaBAV1_0370"
     CDS             complement(378429..380243)
                     /locus_tag="DEHABAV1_RS02005"
                     /old_locus_tag="DehaBAV1_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_011928816.1"
                     /db_xref="GI:500356038"
                     /translation="MNSNWKRSTIIYVVMLVAIIAIFSFLVPNAQKPEEVPLSQIITL
                     SQEHKIAEITVDSETIEVTTTDGTKLSTVKEYIASIYEIEGLDLTDVKVNIQPAGGLD
                     WGTMILTYLPFLIFGGLLIFIFTQARGANNQAVSFGRSKAKLFNMDKPTITFANVAGV
                     DEAKQEVGEVVEFLKSREKFQALGARIPKGILLIGPPGTGKTLLAKAIAGEAGVPFFS
                     ISGSEFVEMFVGVGASRVRDLFDQAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQ
                     TLNQILVEMDGFDTDTSVIVVAATNRPDILDPALLRPGRFDRRVVLDKPDITGREAIL
                     KIHAKGKPLADTVNLENLGKQTVGFSGADLANLLNEAAILAARKNRKVIETEDLEESI
                     DRVIAGPERKSRRISTQEKEVTAYHETGHGLVLRLVQGADPVHKISIVARGMTLGHTR
                     QLPTEDRYLMTRSQFKGMMAGLLAGYVAEELTFKELSTGASDDLRRATDIAHKMVTSY
                     GMSDKLGPRTFGNKEEMVFLGREISEQKDYGEKIADMIDDEVHGLIEEAHQKARKILT
                     ENKNRLKFIAEKLVEKETLEGVELESLFTGELPIAEST"
     gene            complement(380315..381145)
                     /locus_tag="DEHABAV1_RS02010"
                     /old_locus_tag="DehaBAV1_0371"
     CDS             complement(380315..381145)
                     /locus_tag="DEHABAV1_RS02010"
                     /old_locus_tag="DehaBAV1_0371"
                     /EC_number="3.1.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928817.1"
                     /db_xref="GI:500356039"
                     /translation="MAGLLFGTAGIPYSTPKHTTQNGIHRVAELGLDGMEIEFVRGVY
                     MKAPDTNPVRILSELLRIKLSAHAPYYLNFNAVEENKVKMSQHLLYQSAKMAHLCGAG
                     SLVFHPGFYLTDSPSAAYESIRDNIRPVASRLQEEGFDITLRPEVSGKVTQFGDLKET
                     MALCSEIPGLLPTIDFSHYHARTGKYNSYSEFSFMLSTMADYLGENAVLNMHIHVSGI
                     DYSPRGEKQHLNLADSDFNYKELLLALRDRGCAGLVICESPNIEEDALLLKETYFSLA
                     "
     gene            381265..381609
                     /locus_tag="DEHABAV1_RS02015"
                     /old_locus_tag="DehaBAV1_0372"
     CDS             381265..381609
                     /locus_tag="DEHABAV1_RS02015"
                     /old_locus_tag="DehaBAV1_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein IOJAP"
                     /protein_id="WP_011928818.1"
                     /db_xref="GI:500356040"
                     /translation="MESIDIARQMVSMASEKQAEDIVLLDVRELVSYCDYFVLMSGAS
                     SRQLSAIADVVEKTLKPLKIGPRHREGDADSGWILLDFGGVIAHIFTPEIRSYYKLDR
                     LWENAPKLVAIQ"
     gene            complement(381610..382038)
                     /locus_tag="DEHABAV1_RS02020"
                     /old_locus_tag="DehaBAV1_0373"
     CDS             complement(381610..382038)
                     /locus_tag="DEHABAV1_RS02020"
                     /old_locus_tag="DehaBAV1_0373"
                     /EC_number="2.7.4.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZF6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="WP_011928819.1"
                     /db_xref="GI:500356041"
                     /translation="MERTLLLVKPDGVNRGLSGEILGRMEKLGLKLIGLRMLQMDAVL
                     ADKHYAPHRARPFFKDLVTYITSGPITAAVFEGENAVEKMRKAMGATDPAKSEKGTVR
                     GDLGIDIEQNTVHGSDSAENAKHEISLFFSESELVNYDRR"
     gene            complement(382048..383418)
                     /locus_tag="DEHABAV1_RS02025"
                     /old_locus_tag="DehaBAV1_0374"
     CDS             complement(382048..383418)
                     /locus_tag="DEHABAV1_RS02025"
                     /old_locus_tag="DehaBAV1_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_011928820.1"
                     /db_xref="GI:500356042"
                     /translation="MPVLIAIDTATPDTGLAILRDNEIVAQYNWLSHQNQTVELLPRL
                     DWLLESAGLSLKDATAIAVSIGPGSFNGLRIGLSTVKSLAYALDIPLCGIGTLELAAY
                     PYLASGLTVWALLPSGQQEYAAGAYVKDKEGLKEEIKPHITSLADLAAKITEPCVICG
                     PISQNVQTELKTLLGDKKTVFAPADIRPSRAVSLARLAKKRIEDGLTDNPAGLQPLYL
                     RRPQISPRKHPTGLPLSQNKAVIWDMDGVIADSAPLHFRAWQTTFTEMGYTFSEADFY
                     RTFGLRNDMIIYSVLGEKSEADIIHTLADRKEHLFREYAGQDIKIFPGVMDLLKSLKA
                     AGYRMAIASSAPLANIKLVMTKLGIGDYFLATISEKDVTKGKPNPQVFLLSAARLCTR
                     PEECLVIEDAPGGVEAAKKAGMKCLAVTNSQQPETLKEADLIVDTLGKIGVEDIAGFI
                     GSPGAK"
     gene            complement(383396..383887)
                     /locus_tag="DEHABAV1_RS02030"
                     /old_locus_tag="DehaBAV1_0375"
     CDS             complement(383396..383887)
                     /locus_tag="DEHABAV1_RS02030"
                     /old_locus_tag="DehaBAV1_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928821.1"
                     /db_xref="GI:500356043"
                     /translation="MNQLELVSHSTQQTQDLGKIIGELASAGDIIFLVGNLGAGKTNL
                     TQGLAKGLDITENALSPSFVLAREMYGRLPLYHIDLYRLDLSEEIEELGLEDYFYGSG
                     VTVVEWADKANELLPPENLQIEIAYLDDDTRKLTLSAWGIRYEELLNEIAQRVKDAGF
                     NSH"
     gene            complement(383884..384894)
                     /locus_tag="DEHABAV1_RS02035"
                     /old_locus_tag="DehaBAV1_0376"
     CDS             complement(383884..384894)
                     /locus_tag="DEHABAV1_RS02035"
                     /old_locus_tag="DehaBAV1_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="WP_011928822.1"
                     /db_xref="GI:500356044"
                     /translation="MKVSDIGECQLIDRLNILLHQKPDENTPARENLILDIGDDAAVF
                     LPQGYQLVTVDSLIENVHFNRSMLNWADLGYKALAINMSDIAAMGGLPQYAVVNIDLP
                     PDTLVSSVTDCYNAMYSLANKYQTVIIAGDTNQSSIINLAITLLGSAENPSCLLTRNA
                     AQAGQKIAVTGYLGNAAAGLDMLLNQTEVTDESRQIFYRSFYRPEPRINEARLLVKEG
                     VHCCIDISDGLVTDLGHILRQSRVSARIELDKLPLHPSLRLSYPLQAQNMALYGGEDY
                     ELLFTASAKVIEQISVQSHIPVTIIGEIIPGKPEELKLVDKDGRALQPEKNGWEHFKK
                     PK"
     gene            385186..385962
                     /locus_tag="DEHABAV1_RS02040"
                     /old_locus_tag="DehaBAV1_0377"
     CDS             385186..385962
                     /locus_tag="DEHABAV1_RS02040"
                     /old_locus_tag="DehaBAV1_0377"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011308920.1"
                     /db_xref="GI:499628186"
                     /translation="MSSLAEAPIQDPGFDSEEAHKRKQYMVDLFVVQAKNYDFHDDVF
                     GLYAHRFWMRTVLKIIGKFMKGRTSTKMLDLACGTGFVTFNTARNFENIDIDSFDISP
                     DMLAVAKERYEKYFKGRSIKFWQGDAEVPFGENKYDLITTSFAYRNFANKGLATENVF
                     RALKPGGLFIIQDLTKPEHHPMRGLYIFYMKYVLPLFTSILGTEKSAARWLYKSAMMM
                     PTNGQIAKLMESKGFEKCQYKSLSLGIACVIWGFKPEKSE"
     gene            385964..386731
                     /locus_tag="DEHABAV1_RS02045"
                     /old_locus_tag="DehaBAV1_0378"
     CDS             385964..386731
                     /locus_tag="DEHABAV1_RS02045"
                     /old_locus_tag="DehaBAV1_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011928823.1"
                     /db_xref="GI:500356045"
                     /translation="MSSINVSVKDPGFESEEAQARKRYMLQLFGFQAKHYDLHDDIMG
                     MGIHRRWGKEMVLEILTYTRNMPQVKMLDLACGTGFVTFNTLRYMKNVDIDAFDITPE
                     MVEVAKGRLKKNFADRSVKFWVGDAEIPYGDAKYDVIGTCFAFRNFANKNLAAANIFK
                     ALKPGGLLVLQDMTKPEKQPMRGIYLFALKNLMPVMARIIGTEKRSARYLANSVLAMP
                     SNAEITAILQNQGFINIKSRYQSGGMGTLTVAYKPEN"
     gene            386733..387827
                     /locus_tag="DEHABAV1_RS02050"
                     /old_locus_tag="DehaBAV1_0379"
     CDS             386733..387827
                     /locus_tag="DEHABAV1_RS02050"
                     /old_locus_tag="DehaBAV1_0379"
                     /EC_number="4.2.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_011928824.1"
                     /db_xref="GI:500356046"
                     /translation="MGKVDTLAYDIGNNRTRHVYIGSGILDSLPGYARELNADKFFII
                     TDSNLENILKDKIKNLLAGVAETHILAFPAGEASKTLSTLEDIGSKILDLRATKSSVI
                     VCLGGGVVGNLGGLTAALLFRGLRFFHIPTTMVAQIDSAIGQKQAVNYKMGKNLFGQY
                     YAPEFVFIDFDFLRTLPERQIRAGLAESVKHGLCQESTFFDYIEEHAGDYSPKVIDYI
                     SRHTIELKLELLKIDPFEGKLDPQLELGHTIGHAVEIIKNGQLLHGESIAIGMVAEAA
                     LSCEMGYMKPELAAKIERIFKKLGLPTRIPADVPLEGVLEALRYDNKRRTARTDFFLL
                     EDFTRFHKENGKIGTKVSEEVLKKVLESAY"
     gene            387811..388731
                     /locus_tag="DEHABAV1_RS02055"
                     /old_locus_tag="DehaBAV1_0380"
     CDS             387811..388731
                     /locus_tag="DEHABAV1_RS02055"
                     /old_locus_tag="DehaBAV1_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate prenyltransferase"
                     /protein_id="WP_011308923.1"
                     /db_xref="GI:499628189"
                     /translation="MKALTSERPGFQDWIQAARLKFLPQGVMPVVIAGALAFSEGTFN
                     VANFIVAFSAAAAVQIGLTMFNDTLDYVYGTDCKPIDAKNPFSGGSGVFTCGLIKPRQ
                     SLMVIFGLYLFALMCAIYMALDMGWGVMWIAIIGATISILYSAKPLRLAYHGLGELVM
                     LLGYGPVLTAWGYFVHTGMVSWDVLLIGVIPGLCMWTMILINEIPDYEEDRAAGKRNL
                     TYRLGPKNAKNLFIISLVVLYAYILALVFSGVMPPLSAIALGGIPLAVMAVRIAHRYY
                     DDPIKVAMANKLMVIIYSVTTATVAIGMLT"
     gene            388731..389333
                     /locus_tag="DEHABAV1_RS02060"
                     /old_locus_tag="DehaBAV1_0381"
     CDS             388731..389333
                     /locus_tag="DEHABAV1_RS02060"
                     /old_locus_tag="DehaBAV1_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011928825.1"
                     /db_xref="GI:500356047"
                     /translation="MVAPSFFEKVAPVYEFLTRMFMLGTFESARNRMLNEDTSEFSVL
                     DLCTGTGYIANKIEAKRIVGLDQSVQMMALNDRTKRPNKTLVRGNAYHLPFEDGEFER
                     IYCSSASHEFKLFGKVLAECFRTLKPGGKVAIYDIYQPKNKFYSLIVNTIYRYPVEHN
                     IMWVHTLDEWRKLLTEAGFEVEELEAVRGVFVFVRAVRPA"
     gene            389414..390193
                     /locus_tag="DEHABAV1_RS02065"
                     /old_locus_tag="DehaBAV1_0382"
     CDS             389414..390193
                     /locus_tag="DEHABAV1_RS02065"
                     /old_locus_tag="DehaBAV1_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ser/Thr protein phosphatase"
                     /protein_id="WP_011928826.1"
                     /db_xref="GI:500356048"
                     /translation="MDSAPLTNYALMVSLGMRYAVMADIHANLEALNAVLEDAYKRDA
                     TEIWCLGDIINYGPDPTACLEILMNHKHLAVAGNHDLAVAGKINHSLFELEAARCLAW
                     TRSQLSSDMIDYLAVLPEMLIVGDFSLVHGSLKRPVWDYITTPQLASENFGLMRTPYC
                     LVGHTHMPYVFTTGQNGICRGMPLMAGSMQPLRQTNLIINPGSVGQPRDGNPQASYGI
                     YNDEARTFCLYRVAYNIPATQKKMQKAKLPPFLSARLSKGR"
     gene            390213..391088
                     /locus_tag="DEHABAV1_RS02070"
                     /old_locus_tag="DehaBAV1_0383"
     CDS             390213..391088
                     /locus_tag="DEHABAV1_RS02070"
                     /old_locus_tag="DehaBAV1_0383"
                     /EC_number="2.1.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FS52.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase A"
                     /protein_id="WP_011928827.1"
                     /db_xref="GI:500356049"
                     /translation="MGKDVPLLVASAPSLMAQAKEMMEGYTLKARKGLGQHFLISQGV
                     LNKILAAADLKPTDTVIEVGPGLGVLTEELLKRAGQVIAVEVDDKLIDALTEKFKGYP
                     NFRLIHSDILKTSPEEILGQNVPYKLVANLPYYITSAVLRQFLEAKLKPESMVVMVQK
                     EVAKNIVAKTGDMGLLTLSIRFYGNPSLVSVVPGGAFYPPPEVDSAIVKIVIPQTTIM
                     EGVSEVDFFKLARAGFGTRRKTLLNALAQGLGISKPVILSLLNGAGIDPARRAETLSM
                     EEWKKLCLEYAGNPC"
     gene            391082..391936
                     /locus_tag="DEHABAV1_RS02075"
                     /old_locus_tag="DehaBAV1_0384"
     CDS             391082..391936
                     /locus_tag="DEHABAV1_RS02075"
                     /old_locus_tag="DehaBAV1_0384"
                     /EC_number="2.7.1.148"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z9E9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="WP_011308927.1"
                     /db_xref="GI:499628193"
                     /translation="MLTLLAPAKVNLSLEVLYRRKDGYHELRSIIQSLSLCDRLSFSP
                     SKTVHISSDSQDWQADLSLVSKAVELFSERCGQNTGVNLKIAKRIPLVSGLGGDSSCA
                     AAVLKGLNKLWGCGYPCWRLMEIGAELGSDVPFFIMGGTAMMEGRGETVTPLPTLTQM
                     WAVLLVPALDMPADKTAALYRNLRPDSFTSGEISDKLLESICQGKLSLSLCFNAFEKV
                     AFELFPELVKYRWQFLEAGAYQISLAGAGPTLFTLLKDKNTAEKIYHNLCQKGHQAYL
                     VSTLGPLD"
     gene            391992..392489
                     /locus_tag="DEHABAV1_RS02080"
                     /old_locus_tag="DehaBAV1_0385"
     CDS             391992..392489
                     /locus_tag="DEHABAV1_RS02080"
                     /old_locus_tag="DehaBAV1_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="WP_011928828.1"
                     /db_xref="GI:500356050"
                     /translation="MSSSENLKSAFAGESQANRKYLFFADKAEKEGFAHVARLFRAAA
                     EAETVHARNHFNVLKGVGNTAANLEEAVAGESYEFTSMYPSFIKEAETEGNSAALLSF
                     NHANKVEKIHHGLFEEVLKEVKFGTRAEDQVYYVCQVCGNTVPGAAPARCPICGAPAS
                     SFKLV"
     gene            complement(392569..392808)
                     /locus_tag="DEHABAV1_RS02085"
                     /old_locus_tag="DehaBAV1_0386"
     CDS             complement(392569..392808)
                     /locus_tag="DEHABAV1_RS02085"
                     /old_locus_tag="DehaBAV1_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012984176.1"
                     /db_xref="GI:502749192"
                     /translation="MQIKKDLALTNKLLSQGMVSTRDPETGFRYIICASCPNDGGDGT
                     VSRIDRKDNVVERVLFCCSTCGKEFVVKPEDIFLT"
     gene            complement(392895..393704)
                     /locus_tag="DEHABAV1_RS02090"
                     /old_locus_tag="DehaBAV1_0387"
     CDS             complement(392895..393704)
                     /locus_tag="DEHABAV1_RS02090"
                     /old_locus_tag="DehaBAV1_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_011928830.1"
                     /db_xref="GI:500356052"
                     /translation="MTKYNLMKKVHNLLTFGFDSQPRRFISWFIISLICLNVLAVILG
                     SVDTIGRDYHDLLFGFEIFSVAVFSLEYILRVWSYTVELKYSHPFTGRIRFALSPLAL
                     MDLLAILPFYLPFLIHVDLRFLRTLRLLRLFRLGHLKRFNETSRMILNVLRERREALI
                     ISFAIILLLIIFTSSLMYFVENPAQPEVFKNIPDSMWWAVMTMTTVGYGDIYPITALG
                     KLLASIISILGLATFALPTAILSAGLLEEFRNKKGIHEHICPACGQEIPKP"
     gene            complement(393697..394947)
                     /locus_tag="DEHABAV1_RS02095"
                     /old_locus_tag="DehaBAV1_0388"
     CDS             complement(393697..394947)
                     /locus_tag="DEHABAV1_RS02095"
                     /old_locus_tag="DehaBAV1_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="poly(A) polymerase"
                     /protein_id="WP_011928831.1"
                     /db_xref="GI:500356053"
                     /translation="MNAEELKSFLKNRLPPEINRLILHAAELAASQNLHLYLVGGLVR
                     DFLLNKTPNDADLVLATNAIKFGQGLLEGFNYKATLHPRFNNLSADINGFKLDISTAR
                     NEFYPDPGKLPEVLEGDIKADLFRRDFKINAMALSLSPQDFGCLVDPYNGLTDLKQHK
                     LSVLHPKSFRDDPSRIWRALRYSERLGFDISSETLTLLQRDAQLITLIGADRLRYEME
                     CIFKEAKPENILLKAEETGVLKNSLPFIKADNWLADKFAEARNMYGENVSPEIYLCLL
                     SVRLDKSQAEALITGLHLSKYISACLRDYQCLAEHLAELGRVDLKPSRLYGILAKCKK
                     EARQAFYIANDNLIVRKHLMLFQEELSSIKPCLKGTDLLTLGFAPGPDIKAVLAELLN
                     LKLDGKIPSRTDEIDYVKRRQADD"
     gene            395028..395945
                     /locus_tag="DEHABAV1_RS02100"
                     /old_locus_tag="DehaBAV1_0389"
     CDS             395028..395945
                     /locus_tag="DEHABAV1_RS02100"
                     /old_locus_tag="DehaBAV1_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011308932.1"
                     /db_xref="GI:499628198"
                     /translation="MNTHAIKVSNLVKRYKDCTALDGLSLEIEQGECFGLLGPNGAGK
                     TTLVRILTSLSPSDSGKVEVMGLDLSHHLRQIKAMFGVIPQLDNLDAELSVTENLVTF
                     ARFFDIKPADARQRAADILKLFKLEQKANSEVKALSGGMRRRLLLARGLINNPSIIIL
                     DEPSVGLDPQSKYLVWQKLKEFKANGITQLLTTQNMDEAAVLCDRIAIMHQGKVLDMD
                     TPKGLVDRHVGQCLIEIEVRSGEHETITAECIRRGLDFEDSGLIIQVFRCGEDNLLDE
                     LKALGWNVWQRIGTLEDVFLRLTGKGLVE"
     gene            395942..396709
                     /locus_tag="DEHABAV1_RS02105"
                     /old_locus_tag="DehaBAV1_0390"
     CDS             395942..396709
                     /locus_tag="DEHABAV1_RS02105"
                     /old_locus_tag="DehaBAV1_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011928832.1"
                     /db_xref="GI:500356054"
                     /translation="MNWPTYRAFYMWLRNYNVFIRLFWSIAPGFVIEPVVLLVALGFG
                     FGSFIGDINGQPYMEFIIPGVIASYAMTSATFECTYNVFFRMDYRKTYDSILATPMNV
                     SDVVTGEVLWGATRSIITACIILLVAALFGIIHSPWALLAPIFAVLEGIMFASIGIFF
                     ASIVPSIYSFNYYFTLFIGPMTFFSGAFFPVSSFPEAVQAISNVVPLTPAVSLIRGAV
                     SGDFSGVNVVISLLAVIGVSAAFYIATLFSMKRRVME"
     gene            396759..397310
                     /locus_tag="DEHABAV1_RS02110"
                     /old_locus_tag="DehaBAV1_0391"
     CDS             396759..397310
                     /locus_tag="DEHABAV1_RS02110"
                     /old_locus_tag="DehaBAV1_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase-like protein"
                     /protein_id="WP_011928833.1"
                     /db_xref="GI:500356055"
                     /translation="MKVVALVGMPGAGKTEASRMFSKNGFIRIRFGDVTDEKLRELGL
                     PLNEENERKVRESLRKQYGMEAYAVLNLSSIDENLKNDNVVVDGLYSWEEYKFLKSYY
                     KEKLIVVAISSSPSTRYSRLCERADRPLNYDNAVSRDYSEIENINKAGPIVMADITVL
                     NELDLKDLEKQVKKLGLELRADA"
     gene            397307..397780
                     /locus_tag="DEHABAV1_RS02115"
                     /old_locus_tag="DehaBAV1_0392"
     CDS             397307..397780
                     /locus_tag="DEHABAV1_RS02115"
                     /old_locus_tag="DehaBAV1_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_011308935.1"
                     /db_xref="GI:499628201"
                     /translation="MSRPNVDEYFLKIAAVVAERSTCVRHHVGAVAVRDKHILSSGYN
                     GAPAGLTDCLELGCLRDQNGIPSGTRHEICRAVHAEQNVIIQASLHGTSLEGATVYAT
                     HTPCVLCAKMLTNARIKRYVSYGKYADDSFIDMFKQAGIEVVIKDRPPCVVEYLD"
     gene            397868..398773
                     /locus_tag="DEHABAV1_RS02120"
                     /old_locus_tag="DehaBAV1_0393"
     CDS             397868..398773
                     /locus_tag="DEHABAV1_RS02120"
                     /old_locus_tag="DehaBAV1_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_011928834.1"
                     /db_xref="GI:500356056"
                     /translation="MVAKVIVNPVAGARSTEQKWPHISRLMRDMGFSYDFQYTESQGH
                     AIEIARTAALNGYPYLVAVGGDGTINEVVNGILTASQDQKTLMGVVDTGTGNDFVRSL
                     GLDGNYLHSCQHLLSSKHTQVDAGLVTFQKDGRKVSRFFVNGAGVGFDAEVAAATEHM
                     PKALGGTIPFVMALAKTLVGYRNKTIDIRLDTDDYTRRVLSVIVANGSYFGGGMKIAP
                     SALITDSRFDVITLGDVNKLEILQTFPKIYKGTHITHPKVKTEHAHFVSISSGEGLYL
                     QADGELLGKTPATFEVLPQALTMVF"
     gene            complement(398844..399356)
                     /locus_tag="DEHABAV1_RS02125"
                     /old_locus_tag="DehaBAV1_0394"
     CDS             complement(398844..399356)
                     /locus_tag="DEHABAV1_RS02125"
                     /old_locus_tag="DehaBAV1_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_011928835.1"
                     /db_xref="GI:500356057"
                     /translation="MSALAKEEILRLIKSAKPLLEDYPDLENQLQPNGFDLSLKQVRS
                     LEGEGVLPTDNARRRLPVNNPLEFDHNNQIKLMPGIYSVVYNEVVNIPKDVMALATPR
                     SSLLRSGCTVNTAVWDAGYSGRSESLLVVYNPAGLILERNTRLIQLVFFKLNAETGGY
                     CGIYQNENKN"
     gene            399570..399857
                     /locus_tag="DEHABAV1_RS02130"
                     /old_locus_tag="DehaBAV1_0395"
     CDS             399570..399857
                     /locus_tag="DEHABAV1_RS02130"
                     /old_locus_tag="DehaBAV1_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding protein"
                     /protein_id="WP_011308938.1"
                     /db_xref="GI:499628204"
                     /translation="MAQDKTLVCRDCGNEFIFTAGEQEFYASRGLKNEPKRCPTCRSA
                     RRSENRAEGGERRTYEVVCAACGVQTTVPFEPTEGRPVYCKDCYAKTKESE"
     gene            complement(399945..400706)
                     /locus_tag="DEHABAV1_RS02135"
                     /old_locus_tag="DehaBAV1_0396"
     CDS             complement(399945..400706)
                     /locus_tag="DEHABAV1_RS02135"
                     /old_locus_tag="DehaBAV1_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATPase"
                     /protein_id="WP_011928837.1"
                     /db_xref="GI:500356059"
                     /translation="MNKKQTSAEQPIIKIENIQKHFGRVQALRGVSLEVKKGEVVVII
                     GPSGSGKSTLLRCINRLEEYDSGKITVDGITLDTTENINHVRREVGMVFQSFNLFSHL
                     KVIDNITLAQCQVRKRTKEEAAENAADLLKKVGIPDKAHAFPLQLSGGQQQRVAIARA
                     LAMNPQIMLFDEPTSALDPEMIKEVLDVMTTLAKEGMTMVVVSHEMGFARAAADRVIF
                     MDEGLIVESAPPNEFFTNPKHERTKLFLSKILHNS"
     gene            complement(400706..401527)
                     /locus_tag="DEHABAV1_RS02140"
                     /old_locus_tag="DehaBAV1_0397"
     CDS             complement(400706..401527)
                     /locus_tag="DEHABAV1_RS02140"
                     /old_locus_tag="DehaBAV1_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_011928838.1"
                     /db_xref="GI:500356060"
                     /translation="MAENKIKPPEKIALIPGAEPSNRMDPWWWLVAGVFALAGGLMLF
                     QPDPFLDIFKYVWVGIGITVLVAVVSYFLMLILGLFGGLGRLSQNTLIRGIATFYVEI
                     VRGIPLLVQLIWWYFAFPVIIQTIGQALNFGPMLNYQANPIVMAIWGMTFCYGAYMSE
                     IYRAGIQSIPKGQMEAARSLGMSHTQAMRFIILPQALRVILPPMGNEFISLLKDTSLV
                     STVAVADMVRLGREFTATNFNPIEVWSMIALLYLILTLLSSRLINYIEKKTAFSR"
     gene            complement(401580..402353)
                     /locus_tag="DEHABAV1_RS02145"
                     /old_locus_tag="DehaBAV1_0398"
     CDS             complement(401580..402353)
                     /locus_tag="DEHABAV1_RS02145"
                     /old_locus_tag="DehaBAV1_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011308941.1"
                     /db_xref="GI:499628207"
                     /translation="MKRLSTILMTLLLSSALLFSGCQSSTDDTDDSTATLQITVVTDA
                     TWAPFEYVNEQTHAIEGFDIDLMKAIAEKANLEVTFQNVAWDALLAGMATGQYKVAIS
                     SITILPDRLEKWLFSEPYFNAGQMVCVQKTNTTILSHDDLTGKRVAAQTGTTGFFEAQ
                     KIANATVKSYDEIGLAFQDLINGQIDAVICDNPVAIDYVNANPDKLKKVGTAFTDEYY
                     GISVAKGQTEILSRINLGLAAVIADGTLDQLIAKWNLNP"
     gene            complement(402553..403392)
                     /locus_tag="DEHABAV1_RS02150"
                     /old_locus_tag="DehaBAV1_0399"
     CDS             complement(402553..403392)
                     /locus_tag="DEHABAV1_RS02150"
                     /old_locus_tag="DehaBAV1_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid-binding protein DegV"
                     /protein_id="WP_011928839.1"
                     /db_xref="GI:500356061"
                     /translation="MNIKIVTDSTADIPPQLAKSLGITIVPLYVRFGEKALKDGVEIT
                     QDQFFERLQTESVHPNTSQPSPQDFIDVYRELAPTCDGIVSIHISSKLSGTYDSAIQA
                     KKLLGKDAPPIEVIDSRSVSMGLGLLGLLGAEVASSGKNLKEVADTVRSSVEKIQMMG
                     FFDTLKYLALGGRIGKSKALLGSLLSVKPVLVVGNGELLPAGQVRSRSKGMEKLTEFT
                     AGVKNIAGLSVIYTTTPDEAVALADRLAEFFPRKQIVISRLGAALGVHAGPGTLFVAT
                     RSN"
     gene            complement(403848..403922)
                     /locus_tag="DEHABAV1_RS02155"
                     /old_locus_tag="DehaBAV1_R0008"
     tRNA            complement(403848..403922)
                     /locus_tag="DEHABAV1_RS02155"
                     /old_locus_tag="DehaBAV1_R0008"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(403888..403890),aa:Met,seq:cat)
     gene            404163..405113
                     /locus_tag="DEHABAV1_RS02160"
                     /old_locus_tag="DehaBAV1_0400"
     CDS             404163..405113
                     /locus_tag="DEHABAV1_RS02160"
                     /old_locus_tag="DehaBAV1_0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_011308945.1"
                     /db_xref="GI:499628211"
                     /translation="MALTQVKNNTSNIESITYGNLTWINIENPQEVDTEYLAANYPFH
                     PLDLDDVLSRRQRPKVDEYNEYLFFVLHFPFYNKELRTTVPAQLSVFIGGNYLITLHT
                     GNLKPLVKLYREMELDESSRPEYFDHGSGFLMYRIVDRLVDYCLPITVKLLDNLEEVE
                     DDIFAGSNSDLNIVKDIALLRRDIIATRRIIWPMRAVIGCLENKLRKFINQDMSVYFG
                     DMTDHMDKIWDTLDETKEVIEGLSSTFDSMSSHRTNRAMRILTIVATILLPFTMVASI
                     FGMNIPLPFQNSENAIYFVAVITAIIVSLMLYMFRRVRLI"
     gene            405135..405794
                     /locus_tag="DEHABAV1_RS02165"
                     /old_locus_tag="DehaBAV1_0401"
     CDS             405135..405794
                     /locus_tag="DEHABAV1_RS02165"
                     /old_locus_tag="DehaBAV1_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_011928840.1"
                     /db_xref="GI:500356062"
                     /translation="MNVSSRLLIVSGLYITCLITANLIAVKIIALGDVFLPAAVIVFP
                     FSYIFGDVLTEVYGFHWARRIIWLGFICNLIFVVFVALGQVLPGAPFWEGQAAYETIL
                     GYTPRILLASFLGYLVGEFVNSFIMAKLKLRTKGRYLWLRTIGSTLAGQGLDTSIFIM
                     VAFLGTPVFVPMMILYHWGSKVLIEAAATPLTYRLVNYLKKAENSDHFDTATNFSPFK
                     L"
     gene            405815..406591
                     /locus_tag="DEHABAV1_RS02170"
                     /old_locus_tag="DehaBAV1_0402"
     CDS             405815..406591
                     /locus_tag="DEHABAV1_RS02170"
                     /old_locus_tag="DehaBAV1_0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactamase"
                     /protein_id="WP_011308947.1"
                     /db_xref="GI:499628213"
                     /translation="MEIVFLGAHNCETKTTRPSCLMLSGGVVLDAGAITGSLTLDELY
                     SLKAVILSHAHYDHIKDVPLLAMNLAYGLKSVDIYGSQAVEEVVTKPPFSGGFYPDFF
                     TRPPSAPALRFNKITPGLEFDCQGYRILPVSVPHSRDTTGFWVKDLNGHSFFYTSDTG
                     SGLGAVWEQVNPELLIIELTMPNKLTELALTSKHLSPELLETELLLFREMKGYLPQIV
                     TLHTTPLFEEEIKTEIQAVADRLAADIFMASEGLKLRLGE"
     gene            406594..407097
                     /locus_tag="DEHABAV1_RS02175"
                     /old_locus_tag="DehaBAV1_0403"
     CDS             406594..407097
                     /locus_tag="DEHABAV1_RS02175"
                     /old_locus_tag="DehaBAV1_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928841.1"
                     /db_xref="GI:500356063"
                     /translation="MFAVSEPPRFLVDQNVGKLAVYLRMLGFDARRFGNGSDRQLLSE
                     ALAEGRVILTRDHLLRERRLVKKGNLKVMLFEIEVAEDQLRQLLSDMALHSFILPFSR
                     CIECNYPLYPVMKETLSEKVPPYVYQNQTEFKECHHCGRVFWKGSHWQAMQEVLNRLG
                     VDNNPSC"
     gene            407134..408672
                     /locus_tag="DEHABAV1_RS02180"
                     /old_locus_tag="DehaBAV1_0404"
     CDS             407134..408672
                     /locus_tag="DEHABAV1_RS02180"
                     /old_locus_tag="DehaBAV1_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_011928842.1"
                     /db_xref="GI:500356064"
                     /translation="MEIISSVQMRQIEDACLKQGISTETLMENAGRAVAVFARHLLEE
                     QNGCRVLILAGAGNNGGDGLVAGRYLRSWGEKVSIFVPFIDTPKGKTVQGCLEASGDI
                     FAGLAELEEHLADADLVIDALLGTGVNRPLEGIYKEALQMTANVRNTRPEMQVLAVDL
                     PSGLNADTGQADDACLKADFTLSLGIAKQGLFTHRGLELSGAVSVADIGIPPELTTDI
                     QAVLIEKDWAKSVLPVRSPHANKGNFGRVMIVAGSDRYIGAAILAGSAAMRVGAGLVT
                     LALPESLTGAVASRIPEATYLPLPEVSSGTADNSAARFVLSELGKYDVLLIGPGLGQT
                     GYSARLVTEVLSNLPVGLKVIIDADALNILSAITDWWLEYKFDAVLTPHPGEMARLAK
                     TTTEAVQSDRFGLCQKFACKWGKTLILKGAGTIVTSPQGETLCNPAANPVLASAGTGD
                     VLAGIIGGLLGQGVSLFEAAGLGVYLHSLAAEALRSEIGDAGVLASDLLLKLPVIIKG
                     LKQG"
     gene            408676..409467
                     /locus_tag="DEHABAV1_RS02185"
                     /old_locus_tag="DehaBAV1_0405"
     CDS             408676..409467
                     /locus_tag="DEHABAV1_RS02185"
                     /old_locus_tag="DehaBAV1_0405"
                     /EC_number="2.7.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase"
                     /protein_id="WP_011928843.1"
                     /db_xref="GI:500356065"
                     /translation="MNKQAATEKLVAVDIGNTSVNIGIFEGEQLLANWHLGSVAQRMA
                     DEYASLLLGLLQHAGIQAGELNRVIMCSVVPPLTTTFEEVFKTYFKATPLVVGAGIKS
                     GVKIRMDNPREVGADRIVNAAAARVLYPGACIIVDMGTATTFDTLSESGEYIGGAIAP
                     GIATSAQAIVEKTSKLPKIEIIHPAKAIGSNTVSAMQSGVYFGYIGLVEELVRRIQAE
                     LGQKARVVATGGYASLIAEGSRIFDIVRSDLTLQGLRFIYQMNKV"
     gene            409570..410751
                     /locus_tag="DEHABAV1_RS02190"
                     /old_locus_tag="DehaBAV1_0406"
     CDS             409570..410751
                     /locus_tag="DEHABAV1_RS02190"
                     /old_locus_tag="DehaBAV1_0406"
                     /EC_number="6.3.2.5"
                     /EC_number="4.1.1.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase ClpP"
                     /protein_id="WP_011928844.1"
                     /db_xref="GI:500356066"
                     /translation="MNKEQTVVLGITGSISAYKAGDIASKLLAEGYTVKAVMTEDACR
                     FISPLTIRTLSHQPVVTSMWDINSEYSVEHVSLAEEADVILVAPATANIIAKLACGLA
                     NDMLSATILACKSPVIIAPAMNDNMYSNPVTQQNISKLKERGFIFVEPEYGRLASGKT
                     GQGRLASLDKILGSVTQVLAKNGPLAGKKLVISAGGTREPVDPVRYVGNRSSGKMGYA
                     LAEEAVRRGASVRLVSGVTDRPVSFGVDIMYTETALEMFAALREAVKGADALIMTAAV
                     ADYRPERLAADKIKKGAEGLDLHLVANPDILASLQGDFVKVGFAAESRDLMINALKKM
                     TDKNLDIIAANDISQPDSTFGSDTTRLTLFFKNGRVEELPLLKKQEAAARLLDEISGL
                     L"
     gene            410839..413481
                     /locus_tag="DEHABAV1_RS02195"
                     /old_locus_tag="DehaBAV1_0407"
     CDS             410839..413481
                     /locus_tag="DEHABAV1_RS02195"
                     /old_locus_tag="DehaBAV1_0407"
                     /EC_number="6.1.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZG9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="WP_011928845.1"
                     /db_xref="GI:500356067"
                     /translation="MAQCSDLPEMAKAYEAAEVEKKWYQYWMEKGYFKPNPNSDKKPF
                     VIIMPPPNVTGELHLGHALTATLEDIMIRWHRMQGEPTLWLPGVDHAGIAAQVVVERE
                     LAKQGKTRQQLGRELFLEKMWEWVNPCREKIRHQHMRLGASCDWDRETFTLDAGPVKA
                     VREIFTNLYEKGLIYKGERIINWCPRCGTAVSDLEVDHKDLAGHIWHLRYPLEDGSGF
                     VTVATTRPETMLGDTAVAIHPDDTRYAGMVGKNVVLPIMNRRIPVIADEAVDMAFGTG
                     AVKVTPAHDPNDFEMGLRHNLPMITIQNRDTTMNENAGPCSGMTAKACREYVVSEMKS
                     LGLLLKIEDYTHSVGHCQRCSAVIEPMVSKQWFVKMEPLAKPALEAVNSGRIQILPER
                     FNKVYQNWMENIRDWCISRQLWWGHRIPVWYCPCGEMIVAKVDPTVCPKCGGTELEQD
                     PDVLDTWFSSGLWPHSTLGWPDQTEDLKRFYPGTVMETAYDIIFFWVARMIVMGMEDM
                     NEVPFRTVYLHGLIRDDKGEKMSKTKGNVIDPLKVIDQYGTDALRFAVTFGTSPGNDS
                     KLGQTKLEAARNFANKLWNASRFVIMNLGEAKELTPEAELPLEDRWIISRMNRVTADV
                     TRLMEEFQFGEAQRVLQDFIWGEFCDWYIELAKVRLRDEASVSPRPVLVRVLSSILRL
                     LHPYMPFITEELWSYLRPYLPESLRETDIIVAPYPAADKTCFDEQAESVMGSLVEIVR
                     SLRNLRAEHNVEISRYIQANIYAGDKASVLGNYLGAVETLSRARPVNILPGHYSGAST
                     ATEVVLVLNGIEVVVPMSTMVDLEVEAKRVKAEISELEIQIERLSTRLSDEQFLAKAP
                     QAVVDKERIKLEGYIEKVSRLKSA"
     gene            complement(413478..414551)
                     /locus_tag="DEHABAV1_RS02200"
                     /old_locus_tag="DehaBAV1_0408"
     CDS             complement(413478..414551)
                     /locus_tag="DEHABAV1_RS02200"
                     /old_locus_tag="DehaBAV1_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011308953.1"
                     /db_xref="GI:499628219"
                     /translation="MTETRFKPPALCHRCLFENASDAIWFYDRKGHIVYANRASAELT
                     GYTRTELKQKNLKDLLTTASEYDQIMDMNSRIAVGEEVKMPYEQKIRRHDGSVAVLRM
                     ATTLVKSADEVLGFQNIARDITEELRRQQNMKSFVQDVIRAQEAERKRISRELHDEVA
                     PLLLLLMQKIDNLSKQSERDIADCKPQLDALRTQSEEALESLRRIAQDLRPRILDDLG
                     LIPALEWLTEKLAQDGQIHTESNVKGREVELTAEIQLLIFRIAQEAFNNIRKHSLATW
                     VRLELEFKPKAILLTIQDNGKGFNLSEQTDNLAQNGKLGLAGMHERAQLIGGHIHILT
                     HPGQGTTVIAEVPTTNPDTKPAS"
     gene            complement(414532..415230)
                     /locus_tag="DEHABAV1_RS02205"
                     /old_locus_tag="DehaBAV1_0409"
     CDS             complement(414532..415230)
                     /locus_tag="DEHABAV1_RS02205"
                     /old_locus_tag="DehaBAV1_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011308954.1"
                     /db_xref="GI:499628220"
                     /translation="MAKTKVLIADDHAVLREGMSRLLSQEKDIEVIGEAGDGQEAVDM
                     VAQLKPDVVLMDIVMPRLTGVEATKLIKKNNPSTCILILTAYSDIRYILGLLEAGASG
                     YLLKSAKSDEIVGAIRAIKAGESVLDSVATRKLLERVVNVSKESDEDKVRGQLSPREI
                     EILQLASKGLSNREIADKLTLSMRTVKAHLSNIFNKMRCSCRTEAIVKGFREGYVMLE
                     DVPQGIDGYDRNTL"
     gene            complement(415333..416016)
                     /locus_tag="DEHABAV1_RS02210"
                     /old_locus_tag="DehaBAV1_0410"
     CDS             complement(415333..416016)
                     /locus_tag="DEHABAV1_RS02210"
                     /old_locus_tag="DehaBAV1_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308955.1"
                     /db_xref="GI:499628221"
                     /translation="MTEILNGQTPELVIARLRAAIEKGQAWYPALLEAVAVWPLDSEE
                     YDGRHYQYLIGGEALDLILLFERFSRELEDLIPAQERDNLLFKGIAPQELTADELLAF
                     LGEVRYRQYLNYFYGITVEEALLVVTQSEVRKEHRSLGVRREGTVIDEAFVQLYERTH
                     DEMLDQFRREKRYSKTGTIKIHQLKEFTYWLFKYRLLHSEKARVASDTNKSLNYLKKY
                     ARRLQQKSN"
     gene            complement(416041..418899)
                     /locus_tag="DEHABAV1_RS02215"
                     /old_locus_tag="DehaBAV1_0411"
     CDS             complement(416041..418899)
                     /locus_tag="DEHABAV1_RS02215"
                     /old_locus_tag="DehaBAV1_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FS29.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecA"
                     /protein_id="WP_011928846.1"
                     /db_xref="GI:500356068"
                     /translation="MFKFFSSFGDSNEKEIRALEPLVDKINQLENSFTTLSDEALKAK
                     TIEFRARLKDTFETTTAGIQEDITSTTAELAEAQKIADNSKQSRLKAKLESLNKDLSA
                     KETTALNGILPEAFAAVREASRRTIGLRHYDVQLIGGMVLHHGKIAEMRTGEGKTLVA
                     TLPLYLNSLLGKGVHLVTVNDYLARRDAYWMGPVYHALGVSVSSIYPMQTPTEELPSR
                     LFDPDYTSEIPGDPWTHFRPISRQEAYKADITYGTSTEFGFDYLRDNLRPDLAQCVQR
                     DMNYAIVDEIDNLLIDEARTPLIISAPDTEAGKLYDVFARLSPRLVAVKDYEINEKDR
                     NAELTEDGWANVEKLLSREGVMKGNSLYDPQNAPLIRHLRNALSAKEFYKKDHQYVVK
                     EGEIIIIDEFTGRMMLGRRYSEGLHQAIEAKEHVKVQQESKTYATVTIQNLFRMYRKL
                     CGMTGTAATEAEEFSKIYKLEVVIIPTNKPAVREDYGDQIYKDQSAKFKAVVNEIDEM
                     RKLGRPVLVGTVSIENSEMLSNMLKRQGIEHKVLNAKQHEKEAQVVAEAGKPGAVTVA
                     TNMAGRGVDILLGGKEPTKDDAKVYNEWQAHHQQVLEAGGLHVIGTERHESRRIDNQL
                     RGRSGRQGDPGSSRFYVALDDDIMRRFGSERIQGIMEWAGMDENTPIENGLVSRTLEN
                     AQKRVEGYHFDVRKHLVEYDDVVNKHREVIYAERRKILSGADLKSNILDMIREEIITQ
                     TAEHTRGYDSSEWNLDGLVTHLNGIFTLPAEINAEALAKLSQEEITDLLTRTAEELYQ
                     KKEDETGAGSMRLLERIIMLHTLDSLWVEHLTIMENLRREIGLQAFAQRDPLIAYKNE
                     GHVRFQELLETIKHDVVHNIYRIGIQIQHQTESATAKAASSPVQQQKPLPAAPAAAIP
                     GVSAKAATQSTTPAAKEIGRNDPCPCGSGKKYKKCCGK"
     gene            complement(418903..419877)
                     /locus_tag="DEHABAV1_RS02220"
                     /old_locus_tag="DehaBAV1_0412"
     CDS             complement(418903..419877)
                     /locus_tag="DEHABAV1_RS02220"
                     /old_locus_tag="DehaBAV1_0412"
                     /EC_number="2.7.6.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881706.1"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-phosphate from D-ribose 5-phosphate and ATP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_011308957.1"
                     /db_xref="GI:499628223"
                     /translation="MLVNGNLTEELKIFTGNANPDLAKAVAEYLKVQMGKCEVFQFSN
                     ENIFVRIQESVRQKDVYVIQPTCSPVNQSIMELLIMMDALKRASSERITAVLPYYGYG
                     RTDKKDQPRVPITARLVADLLTTAGASRILTVDLHAPQIQGFFNMPVDELTAENLLAN
                     YFKKKNIKDLVVVATDVGISKKARDFAAKLDAPLAIIEKRRMGNNDITRTINIIGDVE
                     GKNALTFDDEIDTAGSLVGNVNILISKGVKEVYSCATHPVLSGPAIQRIATSPIKELV
                     VTDSIPLTPQKKIDKITVLSIAPLIGEAIYRIHTGNSIGEMYDQMQME"
     gene            complement(419893..421140)
                     /gene="glyA"
                     /locus_tag="DEHABAV1_RS02225"
                     /old_locus_tag="DehaBAV1_0413"
     CDS             complement(419893..421140)
                     /gene="glyA"
                     /locus_tag="DEHABAV1_RS02225"
                     /old_locus_tag="DehaBAV1_0413"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407584.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_011928847.1"
                     /db_xref="GI:500356069"
                     /translation="MSFLKTSDPAVYNAIMQETTRLKETIDLIASENYTSKAVLEAQG
                     SVFTNKYAEGYPGKRYYAGCEYADAVEELAIDRAKTLFHAEHANVQPHSGAQANMAAY
                     FAMVKPGDTIMGLTLSHGGHLTHGSKVNFTGKLYHVIEYGLNAETERIDYDNLEKLAM
                     EHRPRMIVTGASAYPRILDFERFRAICDKVDAKLMVDIAHIAGLVAAGLHPSPVPYAD
                     VVTSTSHKTLRGPRGGFILCKEQYAKAIDQAVFPVMQGGPLMQVVAAKAVAFQEAMQP
                     GFVTYQKKTLENTQVMAEELRKLGLRLVSGGTDNHLVLVDLSPIGVNGYDAQLALRRA
                     GIVINRNTVPFAENQTANVPAGIRLGCPAATSRGFGPAEIRQTVGWIGKILKNIGNED
                     VEKQVLAEVIHLCRKFPVPGIDI"
     gene            421274..421894
                     /locus_tag="DEHABAV1_RS02230"
                     /old_locus_tag="DehaBAV1_0414"
     CDS             421274..421894
                     /locus_tag="DEHABAV1_RS02230"
                     /old_locus_tag="DehaBAV1_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_011928848.1"
                     /db_xref="GI:500356071"
                     /translation="MHDKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFI
                     GEAPGFNEDQQGRPFVGAAGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEI
                     SACCNFLDRQIEIIKPKIIVTLGRFSMARYFTGITISKIHGQPMRRDGIIYYPMYHPA
                     AALHQGGLRKEIEQDMLRIPGLLEELKCAEALLVPKEPPARQVGLF"
     gene            421901..423556
                     /locus_tag="DEHABAV1_RS02235"
                     /old_locus_tag="DehaBAV1_0415"
     CDS             421901..423556
                     /locus_tag="DEHABAV1_RS02235"
                     /old_locus_tag="DehaBAV1_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease J"
                     /protein_id="WP_011308960.1"
                     /db_xref="GI:499628226"
                     /translation="MAKPKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEM
                     LGIDLVIPDISYVLENREKVRGIVITHGHEDHIGALPYILPQINVPIYCTKLTQGLIS
                     VKLKEAKLLHQTKINVIPSDGTFKLGKLKVDFYPVCHSLPDSVGLVIQTPIGAVVHSG
                     DFKLDYTPVDGKPTNLSRLAMLGARGVLLLMSDSTHVELPGYTPSETVVGENIDRIIG
                     AATGRVLVTTFASLISRQQQVIDAAAKYGRKLFFAGRSMTEIHKMATDLGYLKVPEGL
                     VCNIEQLQRVPPEKVVLMTTGSQGEPTSALVRIANRDFRHVHIMKGDTVIISASPIPG
                     NESLVSRTIDSLFRQGAKVFYDRIAKVHVHGHASQEELKLVLNLVKPKYFVPVHGEYR
                     HLTMHAELARTMGVAPENAFVMEDGDILELNTKSGRITGKVPSGNVYVDGLSVGDVGG
                     VVLRNRRMLSQDGIVVAIVAINKQTGMLVGRPDIVSRGFVDPDESKAMLDASRDLIIK
                     LLDHDGKDIPEGAMYNDVKETLNKFYYEQTKRRPMVIPVMVKV"
     gene            423576..426026
                     /locus_tag="DEHABAV1_RS02240"
                     /old_locus_tag="DehaBAV1_0416"
     CDS             423576..426026
                     /locus_tag="DEHABAV1_RS02240"
                     /old_locus_tag="DehaBAV1_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="WP_011928849.1"
                     /db_xref="GI:500356073"
                     /translation="MPKKEDPRETLRNARPRAKTPAKITASKRKKPAPVSSKTKKIAS
                     KKAFSSTPAKGGASWLWVMLVASAMAFVVWQWEGVMDFFANFGSGTAGLFGWGLLLVL
                     LGIIIAIVALRFDQMSEWAHRYRLNLWNKWLGGVVLILAAWGMLGMMDAGGDIGLGIL
                     GGKTDVNGFMRVLALIVLGVILIAPGAVWTSLSGLFKGIFRPSRRSNMPEVARLDRTV
                     VSRPVFGGHEDSISPDMGEPVRRLANTKPASKIELPSIKLPSFGKTESRVIEIKNPLA
                     AKTAPQTELPNMPAENTSREPKPADDRSDADRRQVASEVWKKYGEAEGLVEMDGWKLP
                     PIEMLDKTTEIGFSEADNLQRARAIEDALASYGVEGKVIQINAGPTVTQFGVEPGWDR
                     KFKEIKERDKDGETTSRQVEVSKTRVKVDRIASLANDLALALAAPSLRIEAPVPGKSI
                     VGIEVPNTSFGVVSMRSVMETNTFQKILARSPLALALGKGAGGEAVSGDLTKMPHLLI
                     AGATGSGKTVCLNSIICCMLLNNTPASVKFIMIDPKRVELTPFNGLPHLATPVIVDVE
                     KALSALRWLAAEMDRRYQTLAAAGSRNIEGYNKTRVGSDRMAFIVLIIDELADLMMAG
                     FDEVEHILCRLAQMARAVGIHLVVATQRPSVDVITGLIKANFPTRISFAVTSQVDSRT
                     ILDMVGAEKLLGRGDMLYMPTEAAKPKRLQGCYVSDAESERLIYFWTNQKDISPSEAL
                     KVEEITAPPPAQKSRTKDPLFDEAMALISEHNNIISASFLQRKMHIGYPRAARLADEL
                     REAIEGDDGKAEVPKDEY"
     gene            complement(426211..428205)
                     /locus_tag="DEHABAV1_RS02245"
                     /old_locus_tag="DehaBAV1_0418"
     CDS             complement(426211..428205)
                     /locus_tag="DEHABAV1_RS02245"
                     /old_locus_tag="DehaBAV1_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZK7.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. The beta-hairpin of the
                     Uvr-B subunit is inserted between the strands, where it
                     probes for the presence of a lesion; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="WP_011928851.1"
                     /db_xref="GI:500356319"
                     /translation="MPSFKIVSDFALTGDQPQAVEKLAEGLVRGLTDQTLLGVTGSGK
                     TFTMANVIARVNRPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYYDYYQPEAYVP
                     QKDMYIEKDSDINEEIDKLRHAATRALFERRDVVIVASVSCIYGLGEPEEYRSFVLPL
                     KKGQSFRRDLILRRLVDMQYERNDLDFSRGKFRLRGDTLEIQPAYEELALRVEFFGDE
                     IERIVSLDPVSGELLADIEEINIYPAKHFVTSAEKMAEAIKSIQAELEDRLKELEAEG
                     KMLEAARLKQRTNYDLEMMEQAGYCSGVENYSRHLAGRKAGSAPWTLLDYFPEDFLLI
                     VDESHMSLPQIRGMYAGDSARKKTLVDYGFRLPSAMDNRPLSFDEFKARVKQAIYVSA
                     TPGPYEKEHSLQVVEQLVRPTGLLEPVMTVKPTVGQIDDLLEEVKKRVAKNERVLITT
                     LTKKMSEKLADYLVEMGVKTHYLHSEVDTLERIEILRDLRLGVYDVIVGINLLREGLD
                     LPEVSLVAILDADKEGYLRSEQALIQTMGRAARHVDGQVIMYADKITGSMQRAMDEII
                     RRRKIQEDYNRLHNITPQGIRKAIKDINERIRSVTAEVSGPEFRPTPTLREDIARLIK
                     ELESQMKKAAKNLEFERAALIRDRVVELRAALEIDPLGRK"
     gene            complement(428251..428835)
                     /gene="ruvA"
                     /locus_tag="DEHABAV1_RS02250"
                     /old_locus_tag="DehaBAV1_0419"
     CDS             complement(428251..428835)
                     /gene="ruvA"
                     /locus_tag="DEHABAV1_RS02250"
                     /old_locus_tag="DehaBAV1_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406946.1"
                     /note="plays an essential role in ATP-dependent branch
                     migration of the Holliday junction; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="WP_011928852.1"
                     /db_xref="GI:500356337"
                     /translation="MISSLNGILEASGKDWAVINVSGVGFRCHMPATSSALIGGLGQR
                     VRVFTHLHVREDALSLFGFATTEELSLFETLIDVSGIGPKLGLAMLSVMNAEALASAI
                     ISGNAELLSTIPGIGKKTSSRIILELKDKIAKNWEAGVLSQVTEANSDILATLTALGY
                     SSSEAAKAISSLGDNGDLPLEERIKLALNYFNNK"
     gene            complement(428832..429335)
                     /locus_tag="DEHABAV1_RS02255"
                     /old_locus_tag="DehaBAV1_0420"
     CDS             complement(428832..429335)
                     /locus_tag="DEHABAV1_RS02255"
                     /old_locus_tag="DehaBAV1_0420"
                     /EC_number="3.1.22.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="WP_011928853.1"
                     /db_xref="GI:500356438"
                     /translation="MRILGIDPGTLVVGYGIIETANDELTLVGFSSLTPPACAPIPQR
                     LAYIYKGLVEVIELYQPDEVAVESPFADKNIKSALAIGKAQAVALLAAANHSLPVTEY
                     SPACIKSRVAGSGNASKEQIQEMVRLLLNLAEIPQPNDAADALAVAICHHSQRAFTNI
                     ISQGDLT"
     gene            complement(429339..430094)
                     /locus_tag="DEHABAV1_RS02260"
                     /old_locus_tag="DehaBAV1_0421"
     CDS             complement(429339..430094)
                     /locus_tag="DEHABAV1_RS02260"
                     /old_locus_tag="DehaBAV1_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011928854.1"
                     /db_xref="GI:500356621"
                     /translation="MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPE
                     GNARLRLAIQKAKDSRMPSDNIERAIKKGSGELEGTTVIEMILEGYGPGGVAVLVNGM
                     SDNRNRTVSDVRHMFSKGGGSLAESGAVSWIFEAKGVIGVETARLDTDELSLKAIDMG
                     AEDVNTDEGYMEIYTAMPDMEKIRQQLETQGVTIDSAEINMVPKNTVKLDEETAMQVL
                     KLLDKLEELDDVQTVSSNADFDPEVVEKYHSQA"
     gene            complement(430211..430570)
                     /gene="acpS"
                     /locus_tag="DEHABAV1_RS02265"
                     /old_locus_tag="DehaBAV1_0422"
     CDS             complement(430211..430570)
                     /gene="acpS"
                     /locus_tag="DEHABAV1_RS02265"
                     /old_locus_tag="DehaBAV1_0422"
                     /EC_number="2.7.8.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407590.1"
                     /note="Catalyzes the formation of holo-ACP, which mediates
                     the essential transfer of acyl fatty acid intermediates
                     during the biosynthesis of fatty acids and lipids; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holo-[acyl-carrier-protein] synthase"
                     /protein_id="WP_011308967.1"
                     /db_xref="GI:499628233"
                     /translation="MLYTGTDIIEIRRIKAAEARWGEHFLNRIFTPAELSLCKDRFPS
                     LAARFAAKEAVIKVLSLPKNQSYTEIETLNLPEGQPSVNLYGQARDKANILGIKHLSI
                     SLSHCREYAIAMVVAQD"
     gene            complement(430612..431076)
                     /locus_tag="DEHABAV1_RS02270"
                     /old_locus_tag="DehaBAV1_0423"
     CDS             complement(430612..431076)
                     /locus_tag="DEHABAV1_RS02270"
                     /old_locus_tag="DehaBAV1_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron hydrogenase"
                     /protein_id="WP_011308968.1"
                     /db_xref="GI:499628234"
                     /translation="MDKPVNKTYTPVLSLYEAKKENLIPILLAFQRNFSYLSRDMMQK
                     VAAYVGVPESSVYNIATFYSQFRLEPPGIHRVHVCRGTACHVMGAERLLRNIEKRLGI
                     KAGETTLDNEISLDTINCAGICGLAPTLEVDGKLYTRLNGSSLNRILGKKKR"
     gene            431313..432863
                     /locus_tag="DEHABAV1_RS02275"
                     /old_locus_tag="DehaBAV1_0424"
     CDS             431313..432863
                     /locus_tag="DEHABAV1_RS02275"
                     /old_locus_tag="DehaBAV1_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA carboxyltransferase"
                     /protein_id="WP_011308969.1"
                     /db_xref="GI:499628235"
                     /translation="MAVQDQLDNLNRLKKQAEMGGGEAKIEAQHKRGKLTARERIELL
                     FDKGTFNELGAFASHRCRDFGLEKQRNAGDAVVTGSGLVNGRLVFTYSQDFTVLGGSI
                     SEVVGQKVAQVIDMAIRAGAPLIAINDSGGARIQEGVASLSGVGDILLRNTIASGVIP
                     QISIVVGPSAGGAVYAPALTDFIFAVKGISQMYITGPDVIKTVTGEDISHEALGGAEI
                     HAKKSGVAHFLCENEKECFEQVRELMGFLPQSNREKPPRGKNKDNEERKTRDLRDIIP
                     DNPKRAYDMKKVITEVADEKEFFEVHKNYAQNIIVGFVRMGGQPAGIVAQQPSHMAGV
                     IDINASLKAARFIRFCDAFEIPLVSFVDVPGFMPGTDQEHSGIIKHGAKLIYAYAEAT
                     VPKITVITRKAYGGAYIVMSSKHLRGDVNYAWPASEVAVMGAEGAVNIVSRKAITESA
                     NPEETRQKLLEEYREHFANPYQAAQLGYIDDVIDPADTRSKIIKALRSLENKILVNPP
                     KKHGNIPL"
     gene            432886..434139
                     /locus_tag="DEHABAV1_RS02280"
                     /old_locus_tag="DehaBAV1_0425"
     CDS             432886..434139
                     /locus_tag="DEHABAV1_RS02280"
                     /old_locus_tag="DehaBAV1_0425"
                     /EC_number="4.2.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984198.1"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="WP_042377633.1"
                     /db_xref="GI:755024683"
                     /translation="MGKTLAEKILSLKSGSDASAGDIVVSMVDLAFVQDTTGPLTVRE
                     FWDNGFTKLANPLRTALFLDHAAPSPQRQLSTDHILLRKFARDTGALIFDVGEGVCHQ
                     LVAEKLARPGDVIVGADSHTVTAGGLCAFATGMGSSDIAVAFALGKTWFRVPETIKVV
                     VSGRFKHGLYAKDLILHLIGLIGADGATYKALEFSGNVVNNMTVAERLTIANMAVEAG
                     AKVGLFPSDRQTLEYLRSVGREADYQPLAADADAVYERVIEIDATALEPTISKPHTVD
                     NTATARELKGTKLDQVFIGTCTGGRLDDLAVAAAIFKNRKRHPQTRLIVTPASQKIYL
                     EAIRLGYIEILVQAGANIMPPGCGACLGVHQGVLGDGEVCLSTANRNFKGRMGNPEGF
                     IYLASAATAAASAIKGEISDPREVM"
     gene            434139..434642
                     /locus_tag="DEHABAV1_RS02285"
                     /old_locus_tag="DehaBAV1_0426"
     CDS             434139..434642
                     /locus_tag="DEHABAV1_RS02285"
                     /old_locus_tag="DehaBAV1_0426"
                     /EC_number="4.2.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_011928856.1"
                     /db_xref="GI:500357471"
                     /translation="MLKGKAFKFGDSISTDHIAPGRLVHLRSNLPELAKHVLEDADPT
                     FAQRVKPGDFVVAGNNFGLGSSREHAPLIIKMAGVSAVMAKSVARIFFRNAINLGLPI
                     LICDTDKIAEGDELEVDLDGGKIYDRTNGAELTFGKIPPAMLKILDEGGVMPYIKKYG
                     DFKLNEV"
     gene            434657..435736
                     /locus_tag="DEHABAV1_RS02290"
                     /old_locus_tag="DehaBAV1_0427"
     CDS             434657..435736
                     /locus_tag="DEHABAV1_RS02290"
                     /old_locus_tag="DehaBAV1_0427"
                     /EC_number="1.1.1.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase"
                     /protein_id="WP_011928857.1"
                     /db_xref="GI:500357472"
                     /translation="MYHNVTLIPGDGIGPEISEATRRVLEATGVKFNWEVVNAGADVV
                     AEYGTPLPDIVLESIRKNKVAIKGPVTTPVGSGFRSVNVGMRKALNLYTCLRPCKTYP
                     GVPSRYDNVDIVIVRENMEDLYAGIEFEKGSAEALRLIEFIKENKKVEIRTDSGISIK
                     PISVFGTERIFRWAFKYAKDNNRKKVTAVHKANIMKYSDGLFLAVGRKVAEEYPEIEF
                     EDRIVDNMTMQLVKTPTQFDILVCPNLYGDILSDLCAGLVGGLGVAPGANIGDEYALF
                     EPTHGSAPKYKGLNKVNPMAMMLSGVLMLRYLKEEKAADKLENAIAAVIAEGKSVTYD
                     MLSPDKQAVAVGTSQVADAIIAKMK"
     gene            435816..436739
                     /locus_tag="DEHABAV1_RS02295"
                     /old_locus_tag="DehaBAV1_0428"
     CDS             435816..436739
                     /locus_tag="DEHABAV1_RS02295"
                     /old_locus_tag="DehaBAV1_0428"
                     /EC_number="1.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_011928858.1"
                     /db_xref="GI:500357473"
                     /translation="MPKISVIGAGNVGATLAQRLIEKDFADVVMLDVVEGIPQGKALD
                     ISQSASVLGFRHAITGSNDYAETAGSEIVVITAGIARKPGMTREELLAINQKIMTDVV
                     SNCLKYSPEATLVVVSNPVDTMTYLAWKLSGLPRKRVVGLSGVLDGGRLATFVARELG
                     VNPSAVSPCVMGEHGGSMVVMPRFTLVNGKPLSELVSPEKADELAKRAVNGGAEIVAF
                     LKTGSAFYAPSASVAAMVEAIFLGSGKVMNCAAVLDGEYGLRNIVLGVPVKLGKGGIK
                     EIITLPLDGQENARLQVSAEMVKAQIASLSL"
     gene            436762..437133
                     /locus_tag="DEHABAV1_RS02300"
                     /old_locus_tag="DehaBAV1_0429"
     CDS             436762..437133
                     /locus_tag="DEHABAV1_RS02300"
                     /old_locus_tag="DehaBAV1_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011308974.1"
                     /db_xref="GI:499628240"
                     /translation="MSKDKEFLDAFLKLKTELDDTVYKLEDVVINGNLEEKIAALKEA
                     EESLPPALERFDTLPEPEAENVKNARDSYKKAMHLYQQACSHYVKLLTEQNREEGKEG
                     AYKMKQAGDLFVKASEYLEGK"
     gene            437134..437976
                     /locus_tag="DEHABAV1_RS02305"
                     /old_locus_tag="DehaBAV1_0430"
     CDS             437134..437976
                     /locus_tag="DEHABAV1_RS02305"
                     /old_locus_tag="DehaBAV1_0430"
                     /EC_number="4.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308975.1"
                     /note="Catalyzes the reversible hydration of fumaric acid
                     to yield I-malic acid; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="WP_011928859.1"
                     /db_xref="GI:500357474"
                     /translation="MREIAASRISAVLAELIVKISTELGEDILTALHKAYEAEESPAG
                     RDILQSLLENARIAKEKKIPLCQDTGTAIVFAEVGQEVHVTGNFTDAINLGVRQGYEQ
                     AYLRKSIVSHPFSKRINTNDNTPAVIHTEIVPGDRLKISFMAKGSGAENMSRLFMLKP
                     GVGREGVIEAVLETVEKAGGSPCPPIIIGLGVGATAEKAMFMAKKALLRPLGITHTDP
                     EAAALETEVLKQVNKLGIGPLGLGGRVTALGVMAETAPTHIASLPVAVNLQCHSARHG
                     EAVL"
     gene            437976..438545
                     /locus_tag="DEHABAV1_RS02310"
                     /old_locus_tag="DehaBAV1_0431"
     CDS             437976..438545
                     /locus_tag="DEHABAV1_RS02310"
                     /old_locus_tag="DehaBAV1_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="WP_011928860.1"
                     /db_xref="GI:500357475"
                     /translation="MSSIKLNSPFDPSELEKLQAGDSVLISGVIYTARDAAHKRLVET
                     LKQGKKLPFDLKGQTIYYMGPSPAKPGEVIGSAGPTTSSRMDPYTPELLDAGLRAIIG
                     KGNRSAEVSRAIVNKKVVYFISIGGAGALLSQCIKESRMVAYPELGAEAILALTVENF
                     PAIVAIDSQGNNAFTLGQSLYRVVGTKEA"
     gene            438547..438888
                     /locus_tag="DEHABAV1_RS02315"
                     /old_locus_tag="DehaBAV1_0432"
     CDS             438547..438888
                     /locus_tag="DEHABAV1_RS02315"
                     /old_locus_tag="DehaBAV1_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family hydrolase"
                     /protein_id="WP_011308977.1"
                     /db_xref="GI:499628243"
                     /translation="MGCLFCAIAKGEIPAQIVYKDEDLVAFKDINPQSPVHILIIPRR
                     HIANLTDLDEADTELAGKMILLAGKLAREMDIAESGYRLVINSGREGGQVVQHLHLHL
                     LGGRQLGGQLG"
     gene            complement(438885..439415)
                     /locus_tag="DEHABAV1_RS02320"
                     /old_locus_tag="DehaBAV1_0433"
     CDS             complement(438885..439415)
                     /locus_tag="DEHABAV1_RS02320"
                     /old_locus_tag="DehaBAV1_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_011928861.1"
                     /db_xref="GI:500357476"
                     /translation="MVEKILSSHYIYCGNLVKLRKVTVELPSGKTAPRELVEHNPCVV
                     VVALDTDGKLLMVKQYRLAAAQDMLELVAGSMDSGETPEESTRRELREEAGYKPNTLR
                     RLGGFYSSPGFLTEYLYVLVATDLEYAPLTAEDTEDIEVFRYTPAEVKAMIANQQITD
                     SKTLAGLMLYFSQTPG"
     gene            complement(439432..439908)
                     /locus_tag="DEHABAV1_RS02325"
                     /old_locus_tag="DehaBAV1_0434"
     CDS             complement(439432..439908)
                     /locus_tag="DEHABAV1_RS02325"
                     /old_locus_tag="DehaBAV1_0434"
                     /EC_number="2.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011308979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011308979.1"
                     /db_xref="GI:499628245"
                     /translation="MYTIDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFY
                     VIRGDNGEVIACAALHISWADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKALRIPT
                     VFCLTYKPAFFLKCGFHEVEKNALPHKIWGECYRCPKFPNCDETAMMLSLAEVNSV"
     gene            complement(439892..440746)
                     /locus_tag="DEHABAV1_RS02330"
                     /old_locus_tag="DehaBAV1_0435"
     CDS             complement(439892..440746)
                     /locus_tag="DEHABAV1_RS02330"
                     /old_locus_tag="DehaBAV1_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406952.1"
                     /note="catalyzes the phosphorylation of NAD to NADP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD kinase"
                     /protein_id="WP_011928862.1"
                     /db_xref="GI:500357477"
                     /translation="MYKKIGIIYHPLNPAACDLAIKLAAKLDSLGIENWSDSAWQADK
                     LTPKMQNTQLILTTGGDGTILRTAHAILPLEIPILSVNLGKVGFMTELSPEDAISGLE
                     KVLAGDGWIDERSLLEAEYLPHDSAQSRQFFVMNDAVVARGQVARVICVSVDINSQPF
                     TTYKADGAIVSTATGSTGYSYAAGGPVLQPNSADIILTPILPHLGRGYSLVLPSDSIV
                     DLKVNTWHEATLSIDGFINMQVSSGDTLRLRQSSKKIQFIRLRPENYFYKGLDTKLKG
                     NNESVYDR"
     gene            complement(440818..441141)
                     /locus_tag="DEHABAV1_RS02335"
                     /old_locus_tag="DehaBAV1_0436"
     CDS             complement(440818..441141)
                     /locus_tag="DEHABAV1_RS02335"
                     /old_locus_tag="DehaBAV1_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928863.1"
                     /db_xref="GI:500357478"
                     /translation="MRIGPIEILLIGGLIAIVWAVSKFGKLGKKSDTTEDAKSKPARV
                     APKAPPRSHTSYRLQYLGIIVLFGGLLLGGISFLLVKQLAYGIVWGVAIAGIGLLLLF
                     FSRRK"
     gene            complement(441231..442097)
                     /locus_tag="DEHABAV1_RS02340"
                     /old_locus_tag="DehaBAV1_0437"
     CDS             complement(441231..442097)
                     /locus_tag="DEHABAV1_RS02340"
                     /old_locus_tag="DehaBAV1_0437"
                     /EC_number="1.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="WP_011928864.1"
                     /db_xref="GI:500357479"
                     /translation="MKIGILGGSGKMGQWFGRFLTENGHQVWLWGRNPSKLAPIATRL
                     GAQAATQPDMLGDMDCLIISVPIDAFEDTLRELAPFTKPDQLVFDLCSVKERPVELMH
                     QYLPHCRTLGTHPVFGPGAESLKGYNFILTPTTAPETDLAQGVKTWLEKQGGNVSLIS
                     PEEHDRLMSVVLGLAHFIAIVSADTLLGQNLPGISSAGGTTFRLLDTLTKSVLTEDPG
                     LYASLQVNMPKLPKLEADFIKRATEWAELVKNGDKAEFARRMQTLKDNLARTEPGFEK
                     AYQAMYHLNQPR"
     gene            complement(442094..443170)
                     /locus_tag="DEHABAV1_RS02345"
                     /old_locus_tag="DehaBAV1_0438"
     CDS             complement(442094..443170)
                     /locus_tag="DEHABAV1_RS02345"
                     /old_locus_tag="DehaBAV1_0438"
                     /EC_number="5.4.99.5"
                     /EC_number="4.2.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="WP_011928865.1"
                     /db_xref="GI:500357480"
                     /translation="MNLSDLRKQIDNLDTELVKLMAKRLEVSDQIGKIKEETNSPVQD
                     LSRESEVLNRVQSLAQSLGLDPQDIESLYQEILFISKKQQRFTVSFQGAAGAYSEETA
                     LKIFGPNTLTLPCEQLDATFEAVEKGMARFAVVPVENSLEGSISRTYDLLLDSNLMVA
                     AEHELRVSHCLIANPATNLEAVKTIYSHPQALGQCQSFLKHLRAELIPTYDTAGSVKM
                     IKEKGLLNGAAIASERAAVIYNMKVLEREIEDNINNYTRFFVLAKQDSAPTGSDKTSV
                     VFAVKHQAGALYDFIKELASRGINMTKLESRPTRLKPWEYNFYLDIEGHRQDENVKQA
                     LAKADDHVIFMKVLGSYPKMKKHI"
     gene            complement(443167..444261)
                     /locus_tag="DEHABAV1_RS02350"
                     /old_locus_tag="DehaBAV1_0439"
     CDS             complement(443167..444261)
                     /locus_tag="DEHABAV1_RS02350"
                     /old_locus_tag="DehaBAV1_0439"
                     /EC_number="4.2.3.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FS06.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_011928866.1"
                     /db_xref="GI:500357481"
                     /translation="MSNSLGKLFQITSFGESHGDCVGVVIDGVPAGLAINVDEIQIEV
                     DKRKSGAKAHTTPRREDDRIEIFSGIFNNFTTGAPICLVIWNKNIDSSEYERTRSKIR
                     PGHADFTGFMKYGGFNDYRGGGRFSGRITAGHVMAGAIARKLISTIGIEVIGYTAELG
                     GITAKLPKHKDIRQNISQSDVNCPDLAASKQMVALIQQAAEEGDSLGGVVECIGLNLP
                     VGLGEPVFDTLEGELAKAIFAIPAVKGVEFGAGFGASRLRGSKNNDPFNIQSDQIRTT
                     SNNCGGILGGISDGMPLHIRVAVKPTPSISLSQPTVNLDTMTNTSLEIRGRHDTCIVP
                     RAVSVVEAMTCIVLADLALRAGIIPRVIKQ"
     gene            complement(444254..445516)
                     /locus_tag="DEHABAV1_RS02355"
                     /old_locus_tag="DehaBAV1_0440"
     CDS             complement(444254..445516)
                     /locus_tag="DEHABAV1_RS02355"
                     /old_locus_tag="DehaBAV1_0440"
                     /EC_number="2.5.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="WP_011928867.1"
                     /db_xref="GI:500357482"
                     /translation="MKIHLDKSLPGGNIAVPSSKSYTIRGLIAAAQANGQSHIISPLI
                     ADDTLATRQVLSGLGININTDTGSESWEITGNTFKAPSGNLFCRESAATLRFMSAVCA
                     RLPFECHLLAGHSLMRRPMLPLIQALHQLGIEIETRGNTTVINGQVITRSKVSLPGNI
                     SSQYVSALMLMAPACTHGLEIHLATPPASLPYLKMTKQTLGSFGIKVHSSIDWQEISI
                     PPQPYLPARYRVEGDWSSASSFLALGAIAAPVFISNLDTDSFQADRIMIKFLAEMGAE
                     IESGQNWVKVNPKPLSGINADLTHSIDLLPALAVAAACAKGQSILSGVRQARIKESNR
                     IRAVSQGLSAMGINIIEEDDRLIIEGGQPKGAEIDSFGDHRIAMAFGILGSVVGETHI
                     SDAECVTKTYPDFWKNLESLGGKVTQDV"
     gene            complement(445497..446027)
                     /locus_tag="DEHABAV1_RS02360"
                     /old_locus_tag="DehaBAV1_0441"
     CDS             complement(445497..446027)
                     /locus_tag="DEHABAV1_RS02360"
                     /old_locus_tag="DehaBAV1_0441"
                     /EC_number="2.7.1.71"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZK9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="WP_011308986.1"
                     /db_xref="GI:499628252"
                     /translation="MKTKNNIALIGFMGAGKSSISKLLSEKLGKPLVSTDACIETREG
                     LSISHIFKENGEDYFRQMESKVLEDICQNPNQIIDCGGGIVTRPHNLSIMRLNCLVVY
                     LESRPEDLENRLKNHTNRPLFNAERSDKMLKLLESRLPLYRDAADITVSTHNKSCHEV
                     CEEIEDSLRKYENTSG"
     gene            complement(446011..446871)
                     /locus_tag="DEHABAV1_RS02365"
                     /old_locus_tag="DehaBAV1_0442"
     CDS             complement(446011..446871)
                     /locus_tag="DEHABAV1_RS02365"
                     /old_locus_tag="DehaBAV1_0442"
                     /EC_number="1.1.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase (NADP(+))"
                     /protein_id="WP_011928868.1"
                     /db_xref="GI:500357483"
                     /translation="MQTIPDALFGIIGYPVSHSVSPAMQNAAFKHCKLNYLYLTIAAK
                     PEDLQNVIASMRPLNIRGLNVTIPHKIEVIKYIDTLDPAAKKIGAVNTIVNENGQMKG
                     YNTDFGGFVRLLEHNRIAPAKHRFALLGAGGSAHAISLAICTLGGHLTVLARQEEKAK
                     DLAAKMCLRFKGKAQGLELNEANLEETLAESDIIVNCTPIGMGNLAGQSLISPRLLRP
                     DLTVIDAIYNPCKTRLLEDAEKKGAKIINGLEMLVWQGAMSFEIWTSQKAPFRVMMKE
                     AEMALDENEK"
     gene            complement(446855..447523)
                     /locus_tag="DEHABAV1_RS02370"
                     /old_locus_tag="DehaBAV1_0443"
     CDS             complement(446855..447523)
                     /locus_tag="DEHABAV1_RS02370"
                     /old_locus_tag="DehaBAV1_0443"
                     /EC_number="4.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_011308988.1"
                     /db_xref="GI:499628254"
                     /translation="MKIPPICCVITQLPQAETLKKSEGAAFYELRLDLLGENWRETAV
                     LLNKPFMATCRRSAEGGSFKGNEAERINRLEKAASAGAFMLDIEYSTPNLEEVLGRLR
                     PQAKCLLSHHNFTDTPSAAKLKTLLKDMLTHQADIYKVITTATSINDNINLLNLTKEI
                     PDKKIVAFAMGEPGILSRILCPLAGSPFTYASLNDGNKSASGQMTLAQMIEIYRSVNY
                     ANHT"
     gene            complement(447520..448599)
                     /locus_tag="DEHABAV1_RS02375"
                     /old_locus_tag="DehaBAV1_0444"
     CDS             complement(447520..448599)
                     /locus_tag="DEHABAV1_RS02375"
                     /old_locus_tag="DehaBAV1_0444"
                     /EC_number="4.2.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRZ7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_011928869.1"
                     /db_xref="GI:500357484"
                     /translation="MKSIGLNLSGREYKILIGSDLLSETATLLREAIPCDRVVVITNI
                     DINRIYGKKLKKHLESKGIESLFLELPEGEIHKTLDMAAHIYPQLINHFAERNTPILA
                     LGGGVIGDLSGFVAATYQRGVPLIHLPTSLLSQVDSSIGGKVAVNHGGVKNIVGSFYQ
                     PRLVIADTGCLKTLPEKEFACGMAEIIKSAAIGSSELFRMLETNTQAVKDRSPEVMED
                     IISQTAAIKAGIVCQDETDRGIRNILNFGHTLGHALESTSSFSQSHGAAVAIGMCFAA
                     RLSVRLGLCENETALRLEKLIADFGLPTNPKDIDPDKIIEAMHHDKKVSDGRIRFILL
                     KRPGEALIAENILKPDVLSVLEEMK"
     gene            complement(448619..449674)
                     /locus_tag="DEHABAV1_RS02380"
                     /old_locus_tag="DehaBAV1_0445"
     CDS             complement(448619..449674)
                     /locus_tag="DEHABAV1_RS02380"
                     /old_locus_tag="DehaBAV1_0445"
                     /EC_number="2.5.1.54"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="WP_011308990.1"
                     /db_xref="GI:499628256"
                     /translation="MIIMKKDASQEELENVIAEVRRCGLKTDVSKGAFRTIIGLIGDE
                     KSIPFAYFSSLPGVKEARMVETPYKLISREYSNLWQAEGMTREIKVKDIIIGGDEPVF
                     IAGPCAVESKEALMKIAEGAKMAGAQILRGGVYKPRSSVHSFQGLGSAGKDEATEALS
                     WLKEAGERFEMAVMTEVRGESQADLVAEFVDILQVGSRNMYDQDLLATVARKGKPVMY
                     KRHFGASMEEFLSFAEYIAAEGNKDIILCERGIVPVGKGKSFTRYNLDLAAVPIALKE
                     TYLPIMVDPSHATGRRDLIYSMSCAAMAAGANGLMVEVHTNPAEALVDASQMITPPEL
                     KELIDTCRQINKLVKKH"
     gene            450195..450629
                     /locus_tag="DEHABAV1_RS02385"
                     /old_locus_tag="DehaBAV1_0447"
     CDS             450195..450629
                     /locus_tag="DEHABAV1_RS02385"
                     /old_locus_tag="DehaBAV1_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZM8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_011308992.1"
                     /db_xref="GI:499628258"
                     /translation="MPTVNQLVRKGRTSAAKKYKAPALHYSFNSLRNKVAFGDGSPQK
                     RGVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVP
                     DLPGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK"
     gene            450643..451113
                     /locus_tag="DEHABAV1_RS02390"
                     /old_locus_tag="DehaBAV1_0448"
     CDS             450643..451113
                     /locus_tag="DEHABAV1_RS02390"
                     /old_locus_tag="DehaBAV1_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_011308993.1"
                     /db_xref="GI:499628259"
                     /translation="MPRRARKFKRAVAPDSRYNSLMLSNFINKLMMHGQKATAQRIVY
                     DAIDIMGKQENKEGLAVFEQGLKNATPFIEVKPRRVGGATYQVPIEVRPDRAQTMAMR
                     WIIKAARKRTGKSMAERLASEMLEASREQGAAVKKREETHKMAEANRAFAHYRW"
     gene            451169..453250
                     /gene="fusA"
                     /locus_tag="DEHABAV1_RS02395"
                     /old_locus_tag="DehaBAV1_0449"
     CDS             451169..453250
                     /gene="fusA"
                     /locus_tag="DEHABAV1_RS02395"
                     /old_locus_tag="DehaBAV1_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZM6.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011308994.1"
                     /db_xref="GI:499628260"
                     /translation="MSDRKYPLERVRNIGIIAHIDAGKTTTTERILYLTKRTHKIGNI
                     DEGTTVMDWMEQEKARGITITSAATSAYWNGHHLNIIDTPGHVDFTAEVERSLRVLDG
                     GVVVFDGVAGVEAQSETVWRQASRYGVPRICFINKMDRTGANYERTLGMIAERLKAKY
                     LPLQIPIGCAETFRGNCDLLDFKCYGMDNSPEEPVETFDLPAAEKERAVKFRNMMIER
                     LAEEDDEVMEAYLAGEELPIEKLKAAIRRVCLANKAIPIFCGTSLRNKGVKRLLDAVC
                     DYLPSPLDIPAMKGTDPKTGESIERHTSDTEPFSALAFKIVSDPFVGRLVYFRIYSGS
                     ISAGSGAYNSTRGERERIGRLIRMHANDREEIEYADAGEIVASLGLRNTFTGDTLCDQ
                     NAPILLENIKFPEPVINLAIEPKTRSDQDKMTEGLQKLAEEDPTFKVKFDDETGQTVI
                     YGMGELHLDVLVSRLLSEFKVNAGVGKPRVAYREAITAHAKAQGKFVRQSGGRGQYGD
                     VTIEIEPRERGAGYEFVDNVKGGAIPRNFLMAAESGIRDTLETGVYAGYPMVDVKVIA
                     TDGSYHDVDSNENAFKMAGSMAIKAAVAKAKPILLEPIMKLEAVTPEEYMGDVIGDLN
                     SRRGQIISVEPSPETTVITGTVPLAESFGYTTDLRSVTKGRATFSMEFESYREMPGEL
                     ATQVVEAAGKK"
     gene            453275..453583
                     /gene="rpsJ"
                     /locus_tag="DEHABAV1_RS02400"
                     /old_locus_tag="DehaBAV1_0450"
                     /gene_synonym="nusE"
     CDS             453275..453583
                     /gene="rpsJ"
                     /locus_tag="DEHABAV1_RS02400"
                     /old_locus_tag="DehaBAV1_0450"
                     /gene_synonym="nusE"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZM5.1"
                     /note="NusE; involved in assembly of the 30S subunit; in
                     the ribosome, this protein is involved in the binding of
                     tRNA; in Escherichia coli this protein was also found to
                     be involved in transcription antitermination; NusB/S10
                     heterodimers bind boxA sequences in the leader RNA of rrn
                     operons which is required for antitermination; binding of
                     NusB/S10 to boxA nucleates assembly of the antitermination
                     complex; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_011308995.1"
                     /db_xref="GI:499628261"
                     /translation="MAKQKIRIKLKGFDHKILDQSALQIVEALERTGATISGPVPLPT
                     RIQRYSVIRASFIDKDSQEQFEIRTHKRLIDIVETTSKTIDALTNLNLPAGVSIDIKL
                     "
     gene            453592..454209
                     /locus_tag="DEHABAV1_RS02405"
                     /old_locus_tag="DehaBAV1_0451"
     CDS             453592..454209
                     /locus_tag="DEHABAV1_RS02405"
                     /old_locus_tag="DehaBAV1_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZM4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_011308996.1"
                     /db_xref="GI:499628262"
                     /translation="MIQGIIGKKIGMTQIFQEDGKAQPVTLVEAGPCVVVQVKTEKQD
                     GYEAVQLGYGKAKHITSAVKGQCRGFGEFKVLREVDVDDIAAVSVGDQITVSDFKDGE
                     KIDASGVSRGRGFSGVVKRWHFAGGPKTHGQSDRHRAPGSIGSTTTPGRIYKGKHMAG
                     HMGNEAVTIRNLVVLKTDAEKNLLMVKGAIPGGKNTIILIKKTGK"
     gene            454212..454844
                     /locus_tag="DEHABAV1_RS02410"
                     /old_locus_tag="DehaBAV1_0452"
     CDS             454212..454844
                     /locus_tag="DEHABAV1_RS02410"
                     /old_locus_tag="DehaBAV1_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_011308997.1"
                     /db_xref="GI:499628263"
                     /translation="MEIPVYNASGEIVKNINISEDVFGVPFNEALVHQAFVAQQANAR
                     QGTQSTKTRGEVQGSSRKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPK
                     KMRRQAIRCVLSFKLESGELKVIDQLSFDEPKTRDMAKILTALQVISPTLIAVDNPDT
                     NFIKSARNIPAVKTTPANLLNISDMLKNKQLVMTEEAVRQVEELWGQRSG"
     gene            454857..455141
                     /locus_tag="DEHABAV1_RS02415"
                     /old_locus_tag="DehaBAV1_0453"
     CDS             454857..455141
                     /locus_tag="DEHABAV1_RS02415"
                     /old_locus_tag="DehaBAV1_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZM2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_011308998.1"
                     /db_xref="GI:499628264"
                     /translation="MNLYEVLRRPLISEKNSVHATQNKYAFEIAKGANKRMVKLAVEQ
                     AFNVTVEDVNMLHIPGKQKRMGRNLIQTAGLRKAIITLKEGDKITLFEGV"
     gene            455167..455991
                     /gene="rplB"
                     /locus_tag="DEHABAV1_RS02420"
                     /old_locus_tag="DehaBAV1_0454"
     CDS             455167..455991
                     /gene="rplB"
                     /locus_tag="DEHABAV1_RS02420"
                     /old_locus_tag="DehaBAV1_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZM1.1"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_011308999.1"
                     /db_xref="GI:499628265"
                     /translation="MAIKIYRPTSPGRRHHSVSSFEEITKSRPERALLVSVKNDSGRN
                     NQGRVTVRHRGGGSKTQIRVIDFKRNKLDVPGRVAAIEYDPNRTARIALVFYTDGEKR
                     YILAPSDLKVGDVIMAGENAEPKSGNALPLSSIPTGTFIHNIEIIKGKGGIMVRSAGA
                     AAQLMAKEDDYALVRLPSGEMRKVRSDCSATVGQIGNIEHGTLEIGKAGRNRHLGWRP
                     TVRGSAMSPNNHPHGGGECRCPIGMTGPKTPWGKPALGYRTRKAKYSDKLIVKRRG"
     gene            455998..456279
                     /locus_tag="DEHABAV1_RS02425"
                     /old_locus_tag="DehaBAV1_0455"
     CDS             455998..456279
                     /locus_tag="DEHABAV1_RS02425"
                     /old_locus_tag="DehaBAV1_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_011309000.1"
                     /db_xref="GI:499628266"
                     /translation="MSRSVKKGPALCPKLMKKVEVASATNQKSIIKTWARWSTITPLM
                     VGLNVGVHDGRRHVPIYITENMVGHKLGEFTTTRNFRGHAKAEKVSQVK"
     gene            456310..456639
                     /locus_tag="DEHABAV1_RS02430"
                     /old_locus_tag="DehaBAV1_0456"
     CDS             456310..456639
                     /locus_tag="DEHABAV1_RS02430"
                     /old_locus_tag="DehaBAV1_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_011309001.1"
                     /db_xref="GI:499628267"
                     /translation="MEVKAIVKDTGYSALKVRLCVDLVRGKKVSEAITLLRFMTSPTA
                     KVVSKVIKSAAANAENNFQMNPADLKISQIYADEARMLKRMRPQARGRVSPILKRSSH
                     ITVVVAD"
     gene            456648..457484
                     /locus_tag="DEHABAV1_RS02435"
                     /old_locus_tag="DehaBAV1_0457"
     CDS             456648..457484
                     /locus_tag="DEHABAV1_RS02435"
                     /old_locus_tag="DehaBAV1_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_011928870.1"
                     /db_xref="GI:500357485"
                     /translation="MGRKVHPIGFRLGIIKDWSAKWHASDKNFAECLTEDLKLRKAIS
                     KKYVDAAISQVDIERQSNKVTVSVRTARPGIVIGRGGQRVDEMRHFLEDLIGKKVQLN
                     IVEISQAELDAFLVARSVAEQIERRVAYRRAMKQAIFRSMQAGAKGIKICASGRLGGV
                     EIARREVMHEGRVPLHTLRADIDYGCTRAHTALGDVGIKVWVYRGDILPEAKEKSESA
                     VTEMAAVMADAPAAVVTETKVADIAAKPKRVVKKAEAEIPAEEKPKRVVKKAENITKE
                     EE"
     gene            457486..457935
                     /locus_tag="DEHABAV1_RS02440"
                     /old_locus_tag="DehaBAV1_0458"
     CDS             457486..457935
                     /locus_tag="DEHABAV1_RS02440"
                     /old_locus_tag="DehaBAV1_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZL7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_011309003.1"
                     /db_xref="GI:499628269"
                     /translation="MLQPKRVKFRKVQRGRRDGAAHKGNTVAFGEFALQSLEAGWITA
                     RQIEATRRAITRYIRRGGQVWIRIFPDKPITKKPAETRQGGGKGAPEEWVAVVRRGRI
                     MFEIGGVTPEAAKEAMRLASYKMPVKTRFVARDIPVVAGETEVEEAE"
     gene            457937..458134
                     /locus_tag="DEHABAV1_RS02445"
                     /old_locus_tag="DehaBAV1_0459"
     CDS             457937..458134
                     /locus_tag="DEHABAV1_RS02445"
                     /old_locus_tag="DehaBAV1_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZL6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_011309004.1"
                     /db_xref="GI:499628270"
                     /translation="MNISDIRGLSDTEIKKKLEDSHKELFELRLKLSTRQLVNHRELP
                     RVKNDIARILTVMRERELQIR"
     gene            458142..458414
                     /locus_tag="DEHABAV1_RS02450"
                     /old_locus_tag="DehaBAV1_0460"
     CDS             458142..458414
                     /locus_tag="DEHABAV1_RS02450"
                     /old_locus_tag="DehaBAV1_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZL5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_011309005.1"
                     /db_xref="GI:499628271"
                     /translation="MEIKNKTRIGHVISDKMEKTIVVGIDVVKRHPLYKKTYRRTMKY
                     LVHDEKNEAKIGDMIEIVECRPISKGKYWRLSKIITKGHIVAAQEA"
     gene            458430..458798
                     /locus_tag="DEHABAV1_RS02455"
                     /old_locus_tag="DehaBAV1_0461"
     CDS             458430..458798
                     /locus_tag="DEHABAV1_RS02455"
                     /old_locus_tag="DehaBAV1_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZL4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_011309006.1"
                     /db_xref="GI:499628272"
                     /translation="MVQQYTRLNVADNTGAKKIMCINVLGGSHKIQAKVGDVIVAAVK
                     KSSPDAQAKSGTVVKAVVVRITKPYARPDGSYIKFDDNAAVILNDKMEPKGTRIFGPV
                     ARELRDKKFTKILSLAPEVL"
     gene            458809..459120
                     /locus_tag="DEHABAV1_RS02460"
                     /old_locus_tag="DehaBAV1_0462"
     CDS             458809..459120
                     /locus_tag="DEHABAV1_RS02460"
                     /old_locus_tag="DehaBAV1_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZL3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_011309007.1"
                     /db_xref="GI:499628273"
                     /translation="MRLKKNDNVLVIAGKDKGKTGKVRYAYPRTDRVLVEGVNMIKRH
                     SRAKGQAKQAGIIEREAPLHVSNLMLLCSKCNKPARIGSRELADGKSVRYCKSCNEVI
                     D"
     gene            459120..459659
                     /locus_tag="DEHABAV1_RS02465"
                     /old_locus_tag="DehaBAV1_0463"
     CDS             459120..459659
                     /locus_tag="DEHABAV1_RS02465"
                     /old_locus_tag="DehaBAV1_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_011309008.1"
                     /db_xref="GI:499628274"
                     /translation="MLKVEERYTNAVPELQKFFNYGNIMQVPKLVKVVINTGVGEAVS
                     NSKAMETAEADIVAIAGQHPVVTRAKRSVANFKLRAGMPIGLKVTLRGQRMYDFLNKL
                     FFITLPRVRDFQGVPNTAFDERGNYTLGFKDHSVFPEIDFNKIEKPRGLEICIVTTAN
                     TPEEGKKLLELLGMPFSKD"
     gene            459887..460282
                     /locus_tag="DEHABAV1_RS02470"
                     /old_locus_tag="DehaBAV1_0465"
     CDS             459887..460282
                     /locus_tag="DEHABAV1_RS02470"
                     /old_locus_tag="DehaBAV1_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZL0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_011309009.1"
                     /db_xref="GI:499628275"
                     /translation="MISDPIADMLTRIRNGVMARHEVVIMPASRMKQYLAKVMKQEGF
                     IAGYEVIGAKPKRQLKIVLRYDEGGASFVSGLERISKPGLRVYVQRGEIPRVYGGLGV
                     AIVSTSKGVMTGSQAWRQGLGGELLCKVW"
     gene            460298..460846
                     /locus_tag="DEHABAV1_RS02475"
                     /old_locus_tag="DehaBAV1_0466"
     CDS             460298..460846
                     /locus_tag="DEHABAV1_RS02475"
                     /old_locus_tag="DehaBAV1_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRX6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_011928871.1"
                     /db_xref="GI:500357486"
                     /translation="MSRIGKMPIKVPLGIKVDINGNDVTVKGPKGTLSRSFRPEVTIN
                     REGDYLVVAPVGTDKATRAFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGDK
                     VVFKVGFSHSVTVAPPAGITLSVDGTTKVKVSGINKEDVGQMAAEIRSIRKPDHYMGK
                     GIRYAGEYVRIKPGKAIGKGAK"
     gene            460846..461211
                     /locus_tag="DEHABAV1_RS02480"
                     /old_locus_tag="DehaBAV1_0467"
     CDS             460846..461211
                     /locus_tag="DEHABAV1_RS02480"
                     /old_locus_tag="DehaBAV1_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_010936267.1"
                     /db_xref="GI:499238727"
                     /translation="MAKVNAREARIVRHERLRKKVSGTEARPRLCVFRSIENIYTQVI
                     NDNCGSTLVQASTKDAELKAELDGKTKTEQAVVIGNLIAKRSLEAGISEVVFDRGGYK
                     YHGRVKALAEAARSGGLKF"
     gene            461228..461746
                     /locus_tag="DEHABAV1_RS02485"
                     /old_locus_tag="DehaBAV1_0468"
     CDS             461228..461746
                     /locus_tag="DEHABAV1_RS02485"
                     /old_locus_tag="DehaBAV1_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZQ7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_011309011.1"
                     /db_xref="GI:499628277"
                     /translation="MLAKVERIDPSELELNDKLIFINRVTKVVKGGKRMGFAALVVTG
                     DGKNHVGIGVGKAKEVPSAISKASANAKRNLSRILLNGTTVPHEIVFKYGAAQVLLKP
                     AAPGTGIIAGGSVRAVLESTGIKDVLTKSMGCSNKANVAKATLGGLTAMRDPKATVTK
                     RRSSLKEEATGG"
     gene            461739..461921
                     /locus_tag="DEHABAV1_RS02490"
                     /old_locus_tag="DehaBAV1_0469"
     CDS             461739..461921
                     /locus_tag="DEHABAV1_RS02490"
                     /old_locus_tag="DehaBAV1_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRW2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_011928872.1"
                     /db_xref="GI:500357487"
                     /translation="MAKIKITWVKSTIGYKFDQAATIKALGFKKLNQSVIQDDSSAIR
                     GMILKVRHLVVLEEVI"
     gene            461921..462382
                     /locus_tag="DEHABAV1_RS02495"
                     /old_locus_tag="DehaBAV1_0470"
     CDS             461921..462382
                     /locus_tag="DEHABAV1_RS02495"
                     /old_locus_tag="DehaBAV1_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZQ5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_011309013.1"
                     /db_xref="GI:499628279"
                     /translation="MRLHELSPAPGSRKDRKRVGRGDAGRGNYSGRGMKGQKARSGGA
                     TRPGFEGGQLPIYLRLPRKRGFFNPFRIKYAVVNIEQLNMFEAGTEVTPETLLAAGLI
                     RNFVKPVKILSSGHIDRALEVSAHKFSQAAKAQIEAAGGKVQEIDYAAEIE"
     gene            462363..463679
                     /locus_tag="DEHABAV1_RS02500"
                     /old_locus_tag="DehaBAV1_0471"
     CDS             462363..463679
                     /locus_tag="DEHABAV1_RS02500"
                     /old_locus_tag="DehaBAV1_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_011928873.1"
                     /db_xref="GI:500357488"
                     /translation="MRQKSSRPRLLQAMIDAFSLPDLRRRLLITLGILIAARFIAHVP
                     LPGVDSVALQELFDQNGALGMLDLFSGGAMRYFSVAALGVYPYITASIIMTLLTPVIP
                     KLSALSKEGDAGRNKINTITHWLAVPTAALAGYSQLLLLQREGAVAQTEPLAAIAIVL
                     SIVAGTMFMVWLGEQITSYGIGNGISLIIFAGIVAGLPDMIGRGLMASDQFAGLAVYA
                     FMALLTTVLIVIFTEAHRRIPVQYAQTVIRSGKMYRRGGESHIPLRVNSAGMIPLIFA
                     SALVMLPGLVASYFMAGSTAEPNFWNSVYTIFSSTASMPGGLVYWSLYFFMTIIFAFF
                     YTMVTFEQQDIPVTLQRQGGFVPGIRPGKMTDQYLSGVIGRITWAGALFLGFVAIMPF
                     LAREVTGIQVIQLSSFGMLIVVGVALDTMKQLEAQLVMRRYEGFIK"
     gene            463689..464339
                     /locus_tag="DEHABAV1_RS02505"
                     /old_locus_tag="DehaBAV1_0472"
     CDS             463689..464339
                     /locus_tag="DEHABAV1_RS02505"
                     /old_locus_tag="DehaBAV1_0472"
                     /EC_number="2.7.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRW5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_011928874.1"
                     /db_xref="GI:500357489"
                     /translation="MYNVIFLGAPGSGKGTQGEVVAKELKLAHMATGDLFRKAIECGD
                     ELGDTVKSYMERGELVPDEITISVVLKHLAGLKDVTGIILDGFPRSLRQAEALDEALV
                     QQGQGIGRVIYINVPEDELVRRLSGRWVCRSCQSPYQSGCAEVTKGKCSRCQGELYQR
                     PDDTPETVKERLKVYFSKTAPLIEYYRSKGKLSEIDGMAEISEVTKRIISAIKCGK"
     gene            464347..465102
                     /locus_tag="DEHABAV1_RS02510"
                     /old_locus_tag="DehaBAV1_0473"
     CDS             464347..465102
                     /locus_tag="DEHABAV1_RS02510"
                     /old_locus_tag="DehaBAV1_0473"
                     /EC_number="3.4.11.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_011928875.1"
                     /db_xref="GI:500357490"
                     /translation="MAIILKTEKEIAIMRRAGHILAVALEEVKKNVRPGITTRELDEI
                     AERELLRRGTTPSFKGYQGFPASLCASVNEEIVHGIPGGRVLKEGDIISLDIGNILEG
                     FQADMAVTVGVGEISPAAQRLISATQAALTVGIVQARAGGHLGDIGAAVEEYAQSRGY
                     GVVREYTGHGIGRNMHEDPQIPNFGRRGKGPELKKGMTLAIEPMLNIGTEKTKVAPDC
                     WTVYTADGSLSAHFEHTVAITDGEPEILTLIEE"
     gene            465112..465333
                     /gene="infA"
                     /locus_tag="DEHABAV1_RS02515"
                     /old_locus_tag="DehaBAV1_0474"
     CDS             465112..465333
                     /gene="infA"
                     /locus_tag="DEHABAV1_RS02515"
                     /old_locus_tag="DehaBAV1_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013218518.1"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_010936274.1"
                     /db_xref="GI:499238734"
                     /translation="MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHY
                     IRILPGDRVLVELSPYDLTRGRVTYRFKS"
     gene            465485..465874
                     /locus_tag="DEHABAV1_RS02520"
                     /old_locus_tag="DehaBAV1_0476"
     CDS             465485..465874
                     /locus_tag="DEHABAV1_RS02520"
                     /old_locus_tag="DehaBAV1_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_011309017.1"
                     /db_xref="GI:499628283"
                     /translation="MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLVQAGVDKTIR
                     VNKLTDEEINRLREIIDKEYRVEGDLRKEITLNIKRLIDIGCYRGIRHKHNLPVRGQR
                     TKTNARTRRGPRKTVAGRGQKRGATKK"
     gene            465900..466292
                     /locus_tag="DEHABAV1_RS02525"
                     /old_locus_tag="DehaBAV1_0477"
     CDS             465900..466292
                     /locus_tag="DEHABAV1_RS02525"
                     /old_locus_tag="DehaBAV1_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_011309018.1"
                     /db_xref="GI:499628284"
                     /translation="MAVKKRAGAKKKEKKVIPVGKAYVQATFNNTIVTLTDLQGNVIA
                     WASCGTAGFKGSRKGTPYAAQMAAQTAARKAAESGLRQVEVLVKGPGSGREAAIRSLQ
                     ASGINVTAIRDVTPIPHNGCRPPKRRRV"
     gene            466302..466925
                     /locus_tag="DEHABAV1_RS02530"
                     /old_locus_tag="DehaBAV1_0478"
     CDS             466302..466925
                     /locus_tag="DEHABAV1_RS02530"
                     /old_locus_tag="DehaBAV1_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZP7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_011309019.1"
                     /db_xref="GI:499628285"
                     /translation="MSRETGAVCRMCRRSGDKLFLKGDKCVTKCVFEKRPKPPGPQLG
                     RPRRLSDRGQQLRQKQSIRWSYGMTERQFRRFFGLANAQPGVTGDNMMILLERRLDNV
                     LFRLGFGTSRAQARQIVMHGHILVNGQKTDIPSYLIKEGQEITVRETSKATAYFKTLA
                     ENIEAKAIPGWLSLDRKTLSGKVISLPNAGDIDARFDAQTVVEYYSR"
     gene            466946..467938
                     /locus_tag="DEHABAV1_RS02535"
                     /old_locus_tag="DehaBAV1_0479"
     CDS             466946..467938
                     /locus_tag="DEHABAV1_RS02535"
                     /old_locus_tag="DehaBAV1_0479"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_011309020.1"
                     /db_xref="GI:499628286"
                     /translation="MSDLAIPTISCTESDGKYGRFVVEPLEKGFGTTMGNSLRRILLS
                     YLDGVAITRVRIDGIQHEFCALPKAKEDTLDFLLNLKNIRVESLSGLEGILYLRASGS
                     KVVTAADIEPSNDFEVVNPELYLLTLDSDDAVLNVELEVELGRGYRPPESAENTPIGT
                     IPVDAIFTPIRKVNFTTEPMHVGRETSLERLVLEVWTDGTVEPATAVSRSADILVKQF
                     ASLVSHSKVVAEIEASEPVKYTIPEEKYNMPIEQLDLSVRAVNCLRHAGITTVGEVIN
                     RGTKELLTLRNFGLKSLTELEDRLKTIGLSLNPEDELFEEAENNKKKNKGIDED"
     gene            467969..468322
                     /locus_tag="DEHABAV1_RS02540"
                     /old_locus_tag="DehaBAV1_0480"
     CDS             467969..468322
                     /locus_tag="DEHABAV1_RS02540"
                     /old_locus_tag="DehaBAV1_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_011309021.1"
                     /db_xref="GI:499628287"
                     /translation="MRHKVSGRRFDRPTGQRMSLYRNLVTDLLNYEEITISEPRAKEI
                     RSMAEKMITLGKKGTLASRRRALAFVYMPGIVEKVFEDLSKRYAERPGGYTRMTKLGP
                     RQGDGAEMVKLELIK"
     gene            468359..469099
                     /locus_tag="DEHABAV1_RS02545"
                     /old_locus_tag="DehaBAV1_0481"
     CDS             468359..469099
                     /locus_tag="DEHABAV1_RS02545"
                     /old_locus_tag="DehaBAV1_0481"
                     /EC_number="5.4.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_011928877.1"
                     /db_xref="GI:500357492"
                     /translation="MVIEYEGTRYSGFQIQDKGATIQGELETAIRKLTSEQTRVSGSG
                     RTDAGVHAAYQVVSYLTESSLGLEKIKGGLNYYLPPDIAVKEVHFVAENFDVRRRAIS
                     REYSYHILNSKTRSPLARLQAWQVPYKLDIKLMEQAFKMLEGEHDFIAFASGLGPEIK
                     KTVRRVNWTRLDIAEDRLILRIEANSFLTHQVRNTIGVLVELGRGTISMGEFGALFEA
                     KTPGLAGPAAPACGLSLVRVNYREPFGS"
     gene            469101..469532
                     /locus_tag="DEHABAV1_RS02550"
                     /old_locus_tag="DehaBAV1_0482"
     CDS             469101..469532
                     /locus_tag="DEHABAV1_RS02550"
                     /old_locus_tag="DehaBAV1_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRV8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_011928878.1"
                     /db_xref="GI:500357493"
                     /translation="MNTYTVKASDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMF
                     CRNLDCGDYVVIVNAKKITVTGNKLDQKMYYRHSGFPGGFRQEKLGDLLKTKPLFVIE
                     HAVKGMIPRNTLGAQILAKLKVYEGAEHPHASQTGVVSKES"
     gene            469545..469943
                     /locus_tag="DEHABAV1_RS02555"
                     /old_locus_tag="DehaBAV1_0483"
     CDS             469545..469943
                     /locus_tag="DEHABAV1_RS02555"
                     /old_locus_tag="DehaBAV1_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_011928879.1"
                     /db_xref="GI:500357494"
                     /translation="MVEKNTYFIGVGRRKTAVATVKLMSGNGVIVIDGKPIEERFTRI
                     QERNVILNPMMVTDTMGKFNAVIKVLGGGVTGQSGAIAHGIARALEKTDEKLRATLKS
                     NGLLTRDDRTKERKKPGLKRARKAPQYTKR"
     gene            complement(470019..470213)
                     /locus_tag="DEHABAV1_RS02560"
                     /old_locus_tag="DehaBAV1_0484"
     CDS             complement(470019..470213)
                     /locus_tag="DEHABAV1_RS02560"
                     /old_locus_tag="DehaBAV1_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309025.1"
                     /db_xref="GI:499628291"
                     /translation="MKTSLFYLGLGIVMIGIGIFTYLQPTDIDSLSFSQTVLGILCMA
                     IGLLTAIIGVVRYFRDERGN"
     gene            complement(470610..471677)
                     /locus_tag="DEHABAV1_RS02565"
                     /old_locus_tag="DehaBAV1_0485"
     CDS             complement(470610..471677)
                     /locus_tag="DEHABAV1_RS02565"
                     /old_locus_tag="DehaBAV1_0485"
                     /EC_number="5.3.1.8"
                     /EC_number="5.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate starvation-inducible protein PsiE"
                     /protein_id="WP_011928880.1"
                     /db_xref="GI:500357495"
                     /translation="MDIINLDDLNIYEKLDPHHMLDELKRMPLLCKQSWETAEALSLP
                     EDYRTIKQVVILGMGTSGVGAQLAERIVRDECKIPIYLHQDYLLPAYVSADTLVIASS
                     SSGSTEEVVSCFNQALNRHAKLLVLTTGGQLKEMATAHNIPGLIYDYTYRPSTAIAYG
                     VLPILSILHQLGFIPNKSAEVSESLIVLSQIAERLSEKHQTTNNSAKQLAGKLEGRAV
                     MAFGSGVTFPAARRFKTQLNENAKCFSFAEEIPEMNHNSVVGYELPRSSGRYWAAVMF
                     KTTYLSKRIHQRMRITTDMLHLAKIPVFSIDGYGFSPLCQTLSLILQGDFVSLYLAFL
                     TGVDPYPIDAVDYFKRKLAES"
     gene            complement(471702..473117)
                     /locus_tag="DEHABAV1_RS02570"
                     /old_locus_tag="DehaBAV1_0486"
     CDS             complement(471702..473117)
                     /locus_tag="DEHABAV1_RS02570"
                     /old_locus_tag="DehaBAV1_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="WP_042377659.1"
                     /db_xref="GI:755024709"
                     /translation="MKFGTDGWRGIIAKDFTFENVSICAQATAAYLKNTSPDNLSLVI
                     GYDTRFASADFARLVAEVMAASGIKTYFGSCPTPTPVISHGVVNLKAAGAVIITASHN
                     PAIWNGFKVKSADGASAPTYMITAIETEIAKLGDNPSVSRLDFDTAVSRGLIELTDLA
                     PAYFEQISKLVDIEKLREAGFNIAIDSMYGAGIGYFKHLLEGGCNRLNEINAEPNPNF
                     PDMLQPEPIAPNLNKLMRLVKDIRSDIGLATDGDSDRLGVVDEMGNFLNQLQVFSLLA
                     LYILEVKGLRGPLVKTITNSSMIDKLGKLYNVPVFETKVGFKYVSPVMIEQNALIGGE
                     ESGGYGFAGHVPERDAILAGAYFLDFMITTGKSPAKMLEYLYSKVGPHYYNRVDYTFD
                     EARREEIMNHLANQKPDSLAETKVSSTDRLDGFRYKLEDGSWLLIRFSGTEPLLRIYA
                     ESPSQDKTAALLENGRRLSGI"
     gene            complement(473113..473316)
                     /locus_tag="DEHABAV1_RS02575"
                     /old_locus_tag="DehaBAV1_0487"
     CDS             complement(473113..473316)
                     /locus_tag="DEHABAV1_RS02575"
                     /old_locus_tag="DehaBAV1_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928882.1"
                     /db_xref="GI:500357497"
                     /translation="MIKTLLLAFFGAIVVELAVIMLATVMGLAGLTFVIIVLFLPVVL
                     ILGAIIFMLSKFFKGDSRNNKPN"
     gene            complement(473347..474567)
                     /locus_tag="DEHABAV1_RS02580"
                     /old_locus_tag="DehaBAV1_0488"
     CDS             complement(473347..474567)
                     /locus_tag="DEHABAV1_RS02580"
                     /old_locus_tag="DehaBAV1_0488"
                     /EC_number="2.5.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881773.1"
                     /note="catalyzes the formation of S-adenosylmethionine
                     from methionine and ATP; methionine adenosyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase"
                     /protein_id="WP_011928883.1"
                     /db_xref="GI:500357498"
                     /translation="MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPT
                     AHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYIKPEYGFDDRTCGVLTS
                     INRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHR
                     LSKRLAEVRKNGTLPYLRPDGKSQVTVEYHNGKAKRISSVVIGAQHDPDITTEKIQAD
                     IIRNVIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGG
                     GAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNT
                     ARMNHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKV
                     DAIKATIESLSVSK"
     gene            complement(474577..475833)
                     /locus_tag="DEHABAV1_RS02585"
                     /old_locus_tag="DehaBAV1_0489"
     CDS             complement(474577..475833)
                     /locus_tag="DEHABAV1_RS02585"
                     /old_locus_tag="DehaBAV1_0489"
                     /EC_number="3.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-homocysteine hydrolase"
                     /protein_id="WP_011309030.1"
                     /db_xref="GI:499628296"
                     /translation="MPNFDVKDMSLAALGKKRVDWAGREMKTLSLIKERFEKEKPFKG
                     IRIAACLHITTETANLGLVLKAGGADLTLCASNPLSTQDETAAALVEHGINTFAIHGE
                     NNESYYRHIAAALDAKPQLTVDDGADLVATLHSQRTELLNGILGGTEETTTGVIRLRA
                     LADSGKLRYPIIAVNDAKTKYMFDNRYGTGQSTLDGITRATNFLWASKTVVVVGYGWC
                     GHGVAMRAKGMGAHIIVTEVDPVKALEAVMDGFSVMPMAEAAKLGDIFITVTGDKHVI
                     DKDHFKVMKDGATLANSGHFNSEINIPALESLSCGKDTIRPSVEEYKMKDGRRIYLLG
                     EGRLINLAAAEGHPAAVMDMSFANQALSLEYLVKNHTKLEKKVYAVPEEIDRAVAATK
                     LASLNISIDTLSAEQIKYLSSWQEGT"
     gene            complement(475841..477403)
                     /locus_tag="DEHABAV1_RS02590"
                     /old_locus_tag="DehaBAV1_0490"
     CDS             complement(475841..477403)
                     /locus_tag="DEHABAV1_RS02590"
                     /old_locus_tag="DehaBAV1_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928884.1"
                     /db_xref="GI:500357499"
                     /translation="MSDLPLYAQAMLRPDFYPEPTTKVELVQTQMSFVFLTDHFAYKT
                     KKAVNLGYLDYSELSGRKALSEKELLLNRRLCDYAYLEVLPIIKNEGGYSLGGCGEVV
                     EYTLKMRRLPEGRMLVNLLSTGSVSSGMLEKLAEKLAIFHQTARTDAEVQKYGNLEAI
                     KYNTEENFEQTGSKVGITVSPQEYARISSFTRSFISKNQTMFNERVNRGKIRDCHGDL
                     HAAHICFMDNICIYDCIEFNDRFRYGDVASEVAFLAMDLDHYGRADLSRQFINSYIKK
                     SGDKDLFKLLRFYKCYRAYIRGKVEGFKLDDPYISEAEKDKYAQKSKNYYHLADFYAR
                     SKPTLFITMGFCGCGKSTLAQSLAKISGSVVISSDIVRKGLAGIDCCQHRFEDTDQGI
                     YSPEMTQNTYQAMYDQAEDALKEGYSVILDATFLKEHQRKQAEECARRNNAGFVILEV
                     KLTPELAQKRLEKRLDKPSVSDGRWEVYLKQIKALEPLAVQPNHVIIDSSKSTDKQLS
                     DILEFFKSNQGE"
     gene            complement(477403..477603)
                     /locus_tag="DEHABAV1_RS02595"
                     /old_locus_tag="DehaBAV1_0491"
     CDS             complement(477403..477603)
                     /locus_tag="DEHABAV1_RS02595"
                     /old_locus_tag="DehaBAV1_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928885.1"
                     /db_xref="GI:500357500"
                     /translation="MNCATELNKINCNCTYEPCERKGKCCRCISYHLAMDELPACAFP
                     DNVEKTYDRSFKCFARMVSKES"
     gene            complement(477600..478631)
                     /locus_tag="DEHABAV1_RS02600"
                     /old_locus_tag="DehaBAV1_0492"
     CDS             complement(477600..478631)
                     /locus_tag="DEHABAV1_RS02600"
                     /old_locus_tag="DehaBAV1_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_011928886.1"
                     /db_xref="GI:500357501"
                     /translation="MTKTDFYFLPTMIGSMPHTDPKAAVDIITHYLRDIPVWPQLPRR
                     SYLEGMSAQFSQGLPGVNINQDKMWIEPNSGFEGELESLYQAYLDNDFNKFPIGVEYA
                     AGLYELASRSNLSPKLVKGHITGPLTYCMSIKDPSGKDILYDEVLSDAATKLLKLKAS
                     WQEHFLKKICRNTIIFVDEPAMSAYGSAYLPLSREQVTGMFEEVFSGISGLKGVHCCG
                     NTDWSILMDTSVDIINFDTYAYADSLAIYTDALKAFIKRGGAVAWGIVPTDEKALKEE
                     TAASLKDRLEAAMSHFDSKGLPFAELARHSLITPACGLGLKSLDAAERAPELLAELSA
                     LLRRKHGTV"
     gene            complement(478624..479508)
                     /locus_tag="DEHABAV1_RS02605"
                     /old_locus_tag="DehaBAV1_0493"
     CDS             complement(478624..479508)
                     /locus_tag="DEHABAV1_RS02605"
                     /old_locus_tag="DehaBAV1_0493"
                     /EC_number="2.4.2.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-methyl-5'-thioadenosine phosphorylase"
                     /protein_id="WP_011928887.1"
                     /db_xref="GI:500357502"
                     /translation="MTHYAKIGVIGGTGLYDIEGLTDIREHTLDTPFGKPSDIIVTGN
                     LNGVGVAFLPRHGRGHRILPSEIPSRANIYALKSLGVEHIIAINSVGSFKKEVKPGHL
                     LIPNQLIDRTSQRTNTFFGKGIVAHIAFSQPFCPNLRKLLFECAKEAGANVHNGGTYV
                     VMEGPAFSTQAESRLHISWGADVIGMTALPEAKLAREAEICYAIIACATDYDAWHEEE
                     EAVTVDKVIATLRGNINLSKEIIKLAIGRISSTRNCECSTALSHAIMTSPEAVPNTRK
                     HELALIIDKYMPAVSEND"
     gene            complement(479583..480581)
                     /locus_tag="DEHABAV1_RS02610"
                     /old_locus_tag="DehaBAV1_0494"
     CDS             complement(479583..480581)
                     /locus_tag="DEHABAV1_RS02610"
                     /old_locus_tag="DehaBAV1_0494"
                     /EC_number="5.3.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylthioribose-1-phosphate isomerase"
                     /protein_id="WP_011928888.1"
                     /db_xref="GI:500357503"
                     /translation="MKAIEWRNNRLIILDQTLLPLEEKYLELNDYHAVAEAIKTLRVR
                     GAPSIGVAAAYGIAFGALSIETRYCSEFLPLYQQISAEIASTRPTAKNLFMAVERMDH
                     VVASGTDVLQVKISLVDEAVKIHREEEEASRKISTFGADLIQPGWTVLTHCNAGPLAT
                     AGYGTALGVIIAAHQQNKGISAFATETRPLLQGARLTALELKEAGVPFKLITDSMAGH
                     FMKKGVINAVVVGADRIARNGDTANKIGTYSLAVLALAHGIPFYVAAPSSTFDKSIES
                     GNDIVIEERKPEEITYLRGQRIAPENIDVANPAFDVTPANLIAAFITENGIIRRGE"
     gene            complement(480583..481680)
                     /locus_tag="DEHABAV1_RS02615"
                     /old_locus_tag="DehaBAV1_0495"
     CDS             complement(480583..481680)
                     /locus_tag="DEHABAV1_RS02615"
                     /old_locus_tag="DehaBAV1_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011928889.1"
                     /db_xref="GI:500357504"
                     /translation="MRFWELGIRALKETYRDPMALGFLLGFPLMFMLLFGFAFSGGGS
                     ASYQIGVVDNDQTPLSSAFADEALSEVPSYEIIYINTPEEALTQLKQSDIRAYIIIPA
                     GFGQEVSKLWAGTGGNIYLDVTYDESDIQAASEILSQLNVVTRAFAKIEIPLNVNAQP
                     VNIENKITNIDFISPGIIVFGLLILIPTSARIIVRDKEKGFMSRMLTTPSRPVDFILG
                     YSLSMTLICIIQIIFFMLLGYLFGMDIMGNIALAFLIFFLTGLSSIGIGMVIAGFSKS
                     ENQSESISWFFSMPLAIVSGTWFSIQFMPDILKGLGYAFPYSHAIEASRLVILRGADF
                     SAVSGEVGILAIWTVAVFALGTIIFGRTMRS"
     gene            complement(481677..482627)
                     /locus_tag="DEHABAV1_RS02620"
                     /old_locus_tag="DehaBAV1_0496"
     CDS             complement(481677..482627)
                     /locus_tag="DEHABAV1_RS02620"
                     /old_locus_tag="DehaBAV1_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="daunorubicin ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_011928890.1"
                     /db_xref="GI:500357505"
                     /translation="MAATSKAQPDIPAIETLDLSRSYGQLLAVDKLNLNIRKGELFAL
                     LGPNGAGKSTTINMLCCLLKPTSGTARVMGFDINTQGYQVKSIIGSSPQETAISDHLT
                     PVENLELFGKLNHIDPAKLKEWIPRFLGIMGLEDRAKSQVRTFSGGMKRRLSIMMALI
                     HNPDVVFLDEPTLGLDPQVRHAMWEYIESLKGKKTILLTTHYMEEADHLADRIGIMDQ
                     GRIVALGTPVELKQSLIKEPTMRVQAFNISQRMVADLKNFYPKVEFSGGTLSISAEHL
                     EFNEIVNRLQNAGATIRSAQIKGPSLEDVYLKLTGKELRE"
     gene            482721..483143
                     /locus_tag="DEHABAV1_RS02625"
                     /old_locus_tag="DehaBAV1_0497"
     CDS             482721..483143
                     /locus_tag="DEHABAV1_RS02625"
                     /old_locus_tag="DehaBAV1_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928891.1"
                     /db_xref="GI:500357506"
                     /translation="MPNIKYTLEDLRANPGLKLPPFNLVIERGLVDRFCRATGDDGAN
                     WQNEAPPVLALTLGFGQMLEAISADDITVLHGSSELESFRTIEIGQEVMVETSLLSLR
                     ERPGKMGLSSFLNFEMQVTNKQGELLARVCQLAIVYSA"
     gene            483140..483553
                     /locus_tag="DEHABAV1_RS02630"
                     /old_locus_tag="DehaBAV1_0498"
     CDS             483140..483553
                     /locus_tag="DEHABAV1_RS02630"
                     /old_locus_tag="DehaBAV1_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_011928892.1"
                     /db_xref="GI:500357507"
                     /translation="MTSVFENITEGQEIASQTLILSSRDLVIWAGASGDYNPIHYDKD
                     LALKKGLPGVVVPGQLAGAMLGKLASGFARPSGRLAKLSLSYKKMMPLGESLVLKGIV
                     SSKTDTPESKTLGLKLWAEDTAGDKTVTASAVIVY"
     gene            complement(483540..484100)
                     /locus_tag="DEHABAV1_RS02635"
                     /old_locus_tag="DehaBAV1_0499"
     CDS             complement(483540..484100)
                     /locus_tag="DEHABAV1_RS02635"
                     /old_locus_tag="DehaBAV1_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011309040.1"
                     /db_xref="GI:499628306"
                     /translation="MIHTQGKLTRLRDKRLEDASLDYAWQTDPELSHLDAAEPLTISF
                     RTFLGEYIFVLENSLSLRVQFGIETLRGEYIGYCACYNLDIAASEAEVGIMIGQKEYW
                     GKGYGNDALGLMIDYVFEKTSLKRLHLKTLQSNIRAQQSFRKCGFKPCGEKESGLHRF
                     MLMGLSKADWLKHKSLQAEDCPANKL"
     gene            complement(484104..485054)
                     /locus_tag="DEHABAV1_RS02640"
                     /old_locus_tag="DehaBAV1_0500"
     CDS             complement(484104..485054)
                     /locus_tag="DEHABAV1_RS02640"
                     /old_locus_tag="DehaBAV1_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PBS lyase"
                     /protein_id="WP_011928893.1"
                     /db_xref="GI:500357508"
                     /translation="MSQENPEISELFERLADENTSLKHTDLALLSDLNNQEIAAFKDF
                     WTGMSPERRLDIVSRLGELAEDDVSLDFDSIFVRTMHDPNPEVRAKSVDGLWECNRPS
                     LVDHLLSLSSEDPSMEVRIAATAALGRYSMMGEFGQLPEKTSQLLQTSLLAIFKNTNL
                     PVELRRRALESVSPFGQPQVITAISQAHNSPEHLLRVGAVYAMGQNASDQWESVITSE
                     LNNDNNDLRYEAAVAAGELGLERFIPKLVSMIEDPDMEVQLASIQALAKIGGQDAKKG
                     LTENLESTSSQAIREMITTALTDIEADESAAGMPAISPEE"
     gene            complement(485054..485884)
                     /locus_tag="DEHABAV1_RS02645"
                     /old_locus_tag="DehaBAV1_0501"
     CDS             complement(485054..485884)
                     /locus_tag="DEHABAV1_RS02645"
                     /old_locus_tag="DehaBAV1_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309042.1"
                     /db_xref="GI:499628308"
                     /translation="MDKKYKLNSRPKLKSPCLLAAWPGISNVALIVATYLVRKLEFKE
                     LAEIDSPSFFDPIGVLVKDGVVEEPQFPQNRFYYLKNKQDNDIILFIGEDQPSTKSYE
                     LANLILDVGQRFGVKRIYTFAAALTRIHHSEQPRAWAVGTNTQVANELIERGLSGSGN
                     LQISGLNGLLLGVAKERNMDGVCLLGEVPSYASRLQNPMAALVIVQILSKLLQLGVDV
                     TELEQIASEAKQHVSQIAAEAMEDYIDYFTEPIWESGEEDDDDDLDTDDDDNEEASNN
                     "
     gene            complement(485898..487199)
                     /locus_tag="DEHABAV1_RS02650"
                     /old_locus_tag="DehaBAV1_0502"
     CDS             complement(485898..487199)
                     /locus_tag="DEHABAV1_RS02650"
                     /old_locus_tag="DehaBAV1_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C69 family peptidase"
                     /protein_id="WP_011928894.1"
                     /db_xref="GI:500357509"
                     /translation="MLEKILEQAKKVAEQAECFMVESESTPIHFESNQLKNIESKQSL
                     SLALRIVKDGKIGYAASSNPADWPRLVNMALETAAYGQTAHFQFPAAQTYPEVKIFDP
                     EIETVSLEEMVNLGKEMVAGLLEINSELICSSSLTKSTRKVSLLNTSGADISFKKSLF
                     SMGLEGTLVRGTDMLFVGDEFSSCHPIRSSLEAVNLVSKQLKRARQNVPLQSREMPVI
                     FTPHGVASTIIPALSAALNGKLVQEKASPLAGKLGEQMFDPAFNLVDDPTQSFSPNSR
                     PFDDEGTASQITPMVENGVIKNFIYDLRTAALAKAKSTGNAERHGGQPAPGFSALMIK
                     PGTLSFEEMVSDIKEGLVVEFMMGAEQGNVLGGDFSGNVLLGYKIENGQITGRVKDTM
                     LSGNIYSALKTINAIGSDGRWLDGELFTPSMYFPNLSVAAK"
     gene            complement(487201..488577)
                     /locus_tag="DEHABAV1_RS02655"
                     /old_locus_tag="DehaBAV1_0503"
     CDS             complement(487201..488577)
                     /locus_tag="DEHABAV1_RS02655"
                     /old_locus_tag="DehaBAV1_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C69 family peptidase"
                     /protein_id="WP_011928895.1"
                     /db_xref="GI:500357510"
                     /translation="MTELRNIAHELSQQLYHYRADYLEIHLEESTSSYISYRGQNLDT
                     AGRGSDLGGNVRALVNGGWGFVSFNSLDDIRKRIDLAIHQASLAGSTQSQFASTPSVT
                     YAQTDELSQSSVERPLEDKKRILDEYKDLIWQTKGIKTSFIRFSDGYRRRFYVNSRGS
                     VIEQSRSDINFNATAIASGDGELQQSNISVGSRGNYNAITGLHSQIKDMTEHAVKLLS
                     APKVKGGEYTVILDPILAGVFVHEAFGHLSEADHIYENPQMREVMVLGKKFGPKILNI
                     IDNPTMPDLRGSYKYDDEGVAATKNYLIREGKLTGRLHSRETAAKMNEPLSGNARAIS
                     YRYAPIVRMSNTYIEPGVSTLEEMLDGVKEGIYVKNWYGGTTSMEMFTFSSGEAYMIR
                     DGKIAEALRPVVLSGNVFDTLHNIDMIGNDLDMNQGGGCGKSGQSPLPVSNGSPHIRI
                     QKCLVGGA"
     gene            488715..490007
                     /locus_tag="DEHABAV1_RS02660"
                     /old_locus_tag="DehaBAV1_0504"
     CDS             488715..490007
                     /locus_tag="DEHABAV1_RS02660"
                     /old_locus_tag="DehaBAV1_0504"
                     /EC_number="5.4.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_011928896.1"
                     /db_xref="GI:500357511"
                     /translation="MGLFGTSGIRRVVDDRLMEIALKVGFSVGKRYRRVVLAGDSRTS
                     TPAIKRILSGALVAAGADVIDIGLVPTPTLAFIARDFDTGLMVTASHNPAEYNGIKFL
                     NPDGSAFSYLQQQEITKDVESSRSPSLKWDSFGQINAFPCTVEKHMEHILNYLPDKCR
                     LKVVVDCGGGAASVITPWLLQRMGSRVISLNDTTHGFFPHPPEPLAENLTGLIQTVRE
                     SDADLGIAHDGDADRMVAVDKHGNFISGDKMLVVFARAAKADKVVTTLDASMSVEEMG
                     FKVIRTAIGDNYVSEELKRQGNFGGEPCGAWVFPESSLCPDGIYAAARLLNLVSRQPL
                     AELISDIPEYSMKRGSVAGGGLNLSLVEESLQCLNPLSSSLLDGIKLNLKDGWLLIRP
                     SGTEPKIRLTAEAKTPEQCETIYQTGLKCLKSCLSREK"
     gene            490009..491211
                     /locus_tag="DEHABAV1_RS02665"
                     /old_locus_tag="DehaBAV1_0505"
     CDS             490009..491211
                     /locus_tag="DEHABAV1_RS02665"
                     /old_locus_tag="DehaBAV1_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="WP_011928897.1"
                     /db_xref="GI:500357512"
                     /translation="MKAVILAAGEGSRMRPLTFTRPKVMLPIAGKPILEHLLMEVSAA
                     GIKEFVLVVGYRDEQVRSYFADGAKWGVKISYCQQTRQLGTAHALKQLENQLEGNFLV
                     MNGDILAESADISALAAGSETTLSVLEVSDPSSLGVLETDGDRVRCIHEKSANPPTNL
                     ANAGLYLFTPRIFKAISGTPLSPRGEYEITSSIQLLIDNGTEVGYRRLVYWQDVSYPW
                     DLLDVNASMLKNLAPCVYGTVEENVVIKGTVEIGEGSLVRSGAYIEGPVLIGKNCDIG
                     PNCYIRPSTSIGDNCRVGASVEIKNSIIMDNTKIPHLNYVGDSVIGQNCNLGAGTKLA
                     NLRFDGADIIAGGVNTRRRKLGAVLGDGVETGINVSLNPGVLIGSGSRIGPGAVVSGL
                     VEPNSYIG"
     gene            491229..492410
                     /locus_tag="DEHABAV1_RS02670"
                     /old_locus_tag="DehaBAV1_0506"
     CDS             491229..492410
                     /locus_tag="DEHABAV1_RS02670"
                     /old_locus_tag="DehaBAV1_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="WP_011928898.1"
                     /db_xref="GI:500357513"
                     /translation="MKQAVILAAGEGQRLRPFTASKSKVMLSIAGKPLLEYVIESLAQ
                     NGIRDIILVVGYKRERIFDYFGQGGRFGVQISYVQQPNQLGTAHALRQVKDKIKGDFL
                     VLNGDQLIKPSTISGFVKQPPQAVMVKAINGEDPSRYGVVTSSGGLLTSIEEKPSIAK
                     SNFINTGIYSFSMAVFDYIGEHLDIPVVLQSMLKDGLDIHVAESQGAWLDIVYPWDML
                     KLNAVVSAELKPGVAGTIESGVVMKGPVRIGKNTVIRSNSYIVGPVIIGEGCDIGPSV
                     CIYPSTSIADNVTVAPFSQIKNSLIYSGNSIGVASVIEDSVIDRGCVICGQFSAPSAE
                     IETRINDGLHKIKVGTMMGEGCTVGNAVVLQSGTVVGNSTRIAPLRTLSGNIPDGSLV
                     V"
     gene            492411..494192
                     /locus_tag="DEHABAV1_RS02675"
                     /old_locus_tag="DehaBAV1_0507"
     CDS             492411..494192
                     /locus_tag="DEHABAV1_RS02675"
                     /old_locus_tag="DehaBAV1_0507"
                     /EC_number="2.6.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--fructose-6-phosphate
                     aminotransferase"
                     /protein_id="WP_011928899.1"
                     /db_xref="GI:500357514"
                     /translation="MCGIVGYTGKRQAQGVLYDCLCRLEYRGYDSCGIAVNTPEVQVF
                     KDAGKVHDILQNAPLFKGTAGLGHTRWATCGEPTQINAHPHTDCTGKICLVHNGVINN
                     YSQLLKRLEGNGHKIVSDTDTELIAHLIEEYDKGDLEEAVRLAVKEIEGSYALVVMRS
                     GENTLVVVRQDSPLVIGVGDGEYLVASDVPAILGYTNRVIYLDEGDIGTISPDSLKIR
                     RNGGYIVPLVEKVNWTQDESQKAGYSHYMLKEIHEQPRVIQNTLINMPLPESFNKSEI
                     LEQSRKTGILFLACGSSYHAALTARYLVEEHLNIPVRLEVASEFNYMHRLLPCKLAVV
                     LTQSGETADVLRAMRRLKQAGCMVVAITNVAGSTAARLADHTIYTQAGPEIGVAATKS
                     FIAQLIVLYALCFAGASAANIRYQDYLSTMRLLPSVVQSILGSHQNIKDAAVEVAKSK
                     SAFFIGRGINYPIALEGALKLKEISYIHAEGYAAGELKHGPFALLSPETPVLALVSRD
                     QTYEAMLTGLREIKVRRAPLIVIGEAGDEQLGQLADRVISLPSFNRLFNPILFTVVLQ
                     LLAYYVALELGCSIDTPRNLAKSVTVE"
     gene            complement(494200..494652)
                     /locus_tag="DEHABAV1_RS02680"
                     /old_locus_tag="DehaBAV1_0508"
     CDS             complement(494200..494652)
                     /locus_tag="DEHABAV1_RS02680"
                     /old_locus_tag="DehaBAV1_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylethanolamine-binding protein"
                     /protein_id="WP_011309049.1"
                     /db_xref="GI:499628315"
                     /translation="MLLGSSAFACGEYIPRRFSGLGSNISPPVHWMQLPPDTKSLALV
                     LEDPDTSKAFTHWLIYNIPPNRVGLPEAVPTEPNLPDGVRQGLNSEGETGYTGPYPPP
                     NRVHHYHFRLFALDTELKLKASCHQADLLKAMEGHIIDQTDLTGLFVV"
     gene            complement(494664..495368)
                     /locus_tag="DEHABAV1_RS02685"
                     /old_locus_tag="DehaBAV1_0509"
     CDS             complement(494664..495368)
                     /locus_tag="DEHABAV1_RS02685"
                     /old_locus_tag="DehaBAV1_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_011928900.1"
                     /db_xref="GI:500357515"
                     /translation="MIKGVFFDLYNTLIGYQPSREEMTVKLLADMNYPINENDLYLPM
                     NKADEYFYLQNAQNPISLREKPEQFAVWSHYYRIILEEIGIEAKPELINTLISRWKNL
                     KWEMILYEDVIPCLKNLKSRNLKIGLISNADRDMSELFNKTGLNTYLETVVISQEVGV
                     TKPNPLIFQAALRKSGLTAKEVLYIGDQYQVDYIGAMNVGLNPVLLDRRNCYLDLNDC
                     RRITGLGELEYCIDNT"
     gene            495507..496811
                     /locus_tag="DEHABAV1_RS02690"
                     /old_locus_tag="DehaBAV1_0510"
     CDS             495507..496811
                     /locus_tag="DEHABAV1_RS02690"
                     /old_locus_tag="DehaBAV1_0510"
                     /EC_number="4.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="WP_011928901.1"
                     /db_xref="GI:500357516"
                     /translation="MEPRIQVFPKNTEVKNNHLIIGGVDVAGLCAKYGTPLYIFDELT
                     IRQNCRDFKREFSRRYADSSVSYASKAFLHPALLKILAEEGMSLDVVSGGELSVANNA
                     GFPMDMVYLHGNNKSAEELRLALRLHVGRIVVDSFDEIKLLSKLADESGHIPDILLRI
                     TPGVDAHTHHYITTGKLDSKFGFPLFQAAEAVGLAMAQASLNLVGFHFHIGSQIFETQ
                     PFLDAIDLVLDFAAQVQERYGFDIEELDIGGGYGVQYEVDKPAPPISAYAEAIGAKVV
                     SKCRSLKLTPPSLNIEPGRAIIAQAGVALYTVGVIKDIPGIRLYASVDGGMGDNIRPA
                     LYEAKYEAVVANNVQSAEKEKVTIAGKFCESGDILIRDIELPSLRTGDILAVPCCGAY
                     CLPMSSNYNGYHRPAVVMLKNGEDRLIRRRETVEDLSRLDSV"
     gene            496825..497856
                     /locus_tag="DEHABAV1_RS02695"
                     /old_locus_tag="DehaBAV1_0511"
     CDS             496825..497856
                     /locus_tag="DEHABAV1_RS02695"
                     /old_locus_tag="DehaBAV1_0511"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="WP_011928902.1"
                     /db_xref="GI:500357517"
                     /translation="MWRIIGQDKVVSFLSNSLSQDKLSHAYVFHGPSGVGKKRMALTF
                     AQALNCQASPPPCQECSVCGRILSRNHPDIIHLELLSAEDASDGKAKAEIGVKQIEDI
                     QHAASLPPFEGKYKVFIIHQAEKLSLESSNRLLKTLEETGSQNIFILLTADKSLLLPT
                     VISRCQILELRYVEINLIREALLKQGLDAEKAELLSHLSHGRVGWAMEVASSPEILEE
                     RKANIEKIIWILGQDEEERFDYASDLSNLFGQNRTAAEAILDMWLDVFRDMLLLKADA
                     NQNMTNIDYKDILYMASDKLGLTDIRIAIDNILKTEDRLRANANPRLCLEVLMLSLPF
                     VKEGTVKNG"
     gene            497849..498682
                     /locus_tag="DEHABAV1_RS02700"
                     /old_locus_tag="DehaBAV1_0512"
     CDS             497849..498682
                     /locus_tag="DEHABAV1_RS02700"
                     /old_locus_tag="DehaBAV1_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928903.1"
                     /db_xref="GI:500357518"
                     /translation="MVDIVKIRYKQAGKIYYFDPAGFELYPYDCVVLETSRGEELGWV
                     VASPSQVEESSLEQPLKPVIRLATAEDMNRERQLEEKNQSAVAECIELVSKLNLPMKL
                     IRAEYSLDENHVTIYFSAEDRVDFRELVREISRKLRVRVELRQIGPRDEAKMVGGYGR
                     CGRELCCCSFLSEFDPVSIKMAKEQNLPLNPQKISGVCGRLLCCLDYEYETYKAAKAK
                     MPKDGLKVSTPMGKGEVVGGNPLEEMVFVLLESGANAEVALKDIRPDKEGRRPDAPLH
                     H"
     gene            complement(498671..499201)
                     /locus_tag="DEHABAV1_RS02705"
                     /old_locus_tag="DehaBAV1_0513"
     CDS             complement(498671..499201)
                     /locus_tag="DEHABAV1_RS02705"
                     /old_locus_tag="DehaBAV1_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH nuclease"
                     /protein_id="WP_011928904.1"
                     /db_xref="GI:500357519"
                     /translation="MDNHQVLVLNQDYQPLNVCHIRRAVLLVYQSKAEMLEDGLGFWH
                     SEKDHFALPSVIRLSCLIKHPPLRPKLNRAEIFSRDKHTCQYCGRKDLELTIDHVNPK
                     HQGGPHVWENVVAACLHCNRHKAGRTPEQAHMKLMCTPGVPQYRYGYSLPRANANIRH
                     EWRPYLGLRDEPKLVV"
     gene            complement(499273..500682)
                     /locus_tag="DEHABAV1_RS02710"
                     /old_locus_tag="DehaBAV1_0514"
     CDS             complement(499273..500682)
                     /locus_tag="DEHABAV1_RS02710"
                     /old_locus_tag="DehaBAV1_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication protein DnaC"
                     /protein_id="WP_011928905.1"
                     /db_xref="GI:500357520"
                     /translation="MEHIKEILGKQINTRANCTTTSSKDKAVKAAEENLCPLCKGAKF
                     VYPVSAEGVTDFSRVVPCQCTQSESGADREKRLLTYSCLGGLHKYTFEKLNSLGKTDE
                     PHSQDTFKQAYEAALDFASNPAGWLVFTGPSGAGKTHLAAAIANRRLSTGQPVLYKRA
                     SELIDDLKKSFEPDSDAGYSQSFDILKNAPLLVIDDLTVQSGSEWSKEKLDQLLTYRF
                     SQELPTIITLSTPINELDPRIQSRLLDKSISKIYTVAPNPEDSLEYRWDNALALQKKM
                     TFENYDHKRSNLTPEQRQNIDAAYNLALDFSRNPESWLVFQGETGCGKTHLASAIVNE
                     RYRQGKPAMFVVVPEFLDHLRSTFSPESKTSYDQMFDAVKNAKLLVLDDFGEQSSTPW
                     AQEKLYQVINYRYNRRLATVITTRCQLSEIEVAISSRFVDPQISMVFNITAPNFRCDS
                     TGPQKQRPVSRMRTTRPQR"
     gene            complement(500606..501316)
                     /locus_tag="DEHABAV1_RS02715"
                     /old_locus_tag="DehaBAV1_0515"
     CDS             complement(500606..501316)
                     /locus_tag="DEHABAV1_RS02715"
                     /old_locus_tag="DehaBAV1_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA damage-inducible protein DnaD"
                     /protein_id="WP_011928906.1"
                     /db_xref="GI:500357521"
                     /translation="MSNPPPVPVRQEFTPVSRYFIHRVAPLIADPAELKVSLAVFSLV
                     QAKKGYPRYTTLAELGAEETLMNALGKTPNESLQSLEKALKMAVERRTLLGLELKSGK
                     HNHQLYFINTETDTAVVEKIKNGSLALPGLKEVTAEVITGKTGQPNIFKLYEQNIGLL
                     TPMLADNLKEAEKLYPEEWIAEAIKEAVSLNKHNWRYIERILENWSSQGKNSGTHKGN
                     TGETDKYKGQLYDHLVQR"
     gene            complement(501313..502689)
                     /locus_tag="DEHABAV1_RS02720"
                     /old_locus_tag="DehaBAV1_0516"
     CDS             complement(501313..502689)
                     /locus_tag="DEHABAV1_RS02720"
                     /old_locus_tag="DehaBAV1_0516"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_011309057.1"
                     /db_xref="GI:499628323"
                     /translation="MLDSKLPPYDVDAEESVSGSLLIDGQAIFDIIPILKPQDFFTEP
                     NRLIFEACMSLYGRSDAINQVTVAQELERLGKLEKCGGSAYLSHVVSVVPTSLDIEHY
                     ARIVYRLSVMRQLIDAGQKISELGFKADPDVSDSLGKAEDLLFRLRHERSSLGFTHIK
                     NILDKYFEPVPAPGSEGYQAIPHVLTGLTGMDTFLGGLQRSDLIIMAGRPSMGKTSLA
                     LNIARNAAVEQRACTAIFSLEMSRESLVQRLLSNEAAVNSRSIRLNESNPDEERKIMD
                     AIGVLSEAPIFIDDSPQIRVAEIRSKALRLRYEQNIDLIIVDYLQLIQGEGNTKENRV
                     QEISYISRSLKGIARELNVPVIAISQLSRAPEFRSSHQPQLSDLRESGSIEQDADIVV
                     FIYRDEFYYKEEEWANLHPDQEYPREIADIIIAKHRNGPIGTVKCRFRHDLTRFENLG
                     SSTEPSFL"
     gene            complement(502690..503145)
                     /locus_tag="DEHABAV1_RS02725"
                     /old_locus_tag="DehaBAV1_0517"
     CDS             complement(502690..503145)
                     /locus_tag="DEHABAV1_RS02725"
                     /old_locus_tag="DehaBAV1_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_011309058.1"
                     /db_xref="GI:499628324"
                     /translation="MKVVFLKDVPGRGKTGDIKEVNDGYARNYLIPNKLAMPASAAVK
                     SEIAAKQAAEERRKAKAEAEMVELAKNLDGAKVNLKAKTGAKDKLYGQITTTVIAAEI
                     EKQTGKTIDKRKLELAEPIRQLGNYEVVIRFNKDLSSKINLAVTAEENT"
     gene            complement(503215..504135)
                     /locus_tag="DEHABAV1_RS02730"
                     /old_locus_tag="DehaBAV1_0518"
     CDS             complement(503215..504135)
                     /locus_tag="DEHABAV1_RS02730"
                     /old_locus_tag="DehaBAV1_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="WP_011928907.1"
                     /db_xref="GI:500357522"
                     /translation="MSTLLYDVIIIGGGPAGLTAALYTGRSKLKTLVIERAFVGGQIT
                     RSEKVDNYPGFPEGITGFDLTQQMQIQAEKYGVEITSAEVNAIHKTKDHFEVVTETGG
                     LSGRCIIICGGTERNKLEVPGEEEFSGRGVSYCATCDAPFYNDKVVAVVGGGNMAFYE
                     ALHLSEFAKKVYLIHRRQGFRADAVLMDKAKNKSNIELVLDTVVTSINGQDSIQSLSL
                     NNLKTLKTSTLPIDGLFVAVGLQPNTTYLKGVVDMDKNGSILVNNQMETSVSGILSAG
                     DIRSGSIRQVISAAGDGAVAALSAKRYLDL"
     gene            complement(504116..505159)
                     /locus_tag="DEHABAV1_RS02735"
                     /old_locus_tag="DehaBAV1_0519"
     CDS             complement(504116..505159)
                     /locus_tag="DEHABAV1_RS02735"
                     /old_locus_tag="DehaBAV1_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acyltransferase"
                     /protein_id="WP_011928908.1"
                     /db_xref="GI:500357523"
                     /translation="MIIAVDVDGGDYAPKEIIKGALKAAQEYKIGLILLGKKEVIHVH
                     AGHYLKKLPIEIVHCPQTVTFNEHAVEAIKGKPQSAIVIGTSLVKQGKADAFISAGNT
                     GAVLAAAFFILGKIDGVERPALGAIITTRPHIPSLLIDAGANAECRPNHLDEFAHLGN
                     IYAKQVLGLENPRIGLLNNGEEEAKGTKLTLETHQLLKKSKLNFIGNIEGHDISLNKA
                     DVIVTDGFTGNIVLKTLEGLGDALLKVRKVGHAIDSAAHLRGRALLADVGLGSMVKGM
                     DFEECGGACLLGVKGTIIVAHGRSHARAIKNAIGLAKRTAEKGVDKLIAEDIKSRTKA
                     GTEGDPKNVNTPV"
     gene            complement(505199..506050)
                     /locus_tag="DEHABAV1_RS02740"
                     /old_locus_tag="DehaBAV1_0520"
     CDS             complement(505199..506050)
                     /locus_tag="DEHABAV1_RS02740"
                     /old_locus_tag="DehaBAV1_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011928909.1"
                     /db_xref="GI:500357524"
                     /translation="MNIFLGIDSGSVSTKVICLSQSAELTDWVYLPTAGEPLNTLRLA
                     LRQLQSRLPESTRVLGVAVTGSARELVAETVGADMLKNEISSQAKAAAHLIPEVKTVI
                     EIGGQDSKLILLENGFVVDFAMNTICAAGTGSFLEHQSRRLDLSLEDMGQLAQFSQNP
                     IELKGRCTVFVESDMIHFQQTGSSRPDIVYGLCKALARNYLNDLGLHKEIRQPVVFQG
                     GVARNPAMKKAFEEELGFSLIVPPRPEITGAWGVALLLRQDTNINTTAKPTNFRGFDT
                     PFLREKV"
     gene            complement(506076..507269)
                     /locus_tag="DEHABAV1_RS02745"
                     /old_locus_tag="DehaBAV1_0521"
     CDS             complement(506076..507269)
                     /locus_tag="DEHABAV1_RS02745"
                     /old_locus_tag="DehaBAV1_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="WP_011928910.1"
                     /db_xref="GI:500357525"
                     /translation="MSDNNLADIKSAIIKMINTEKGSLEELSLKLHANPELGYQEHKA
                     VEWICEYLSSQNFSIEKNIGGLNTAFKATFGHGTPVIGFLAEYDALPQLGHACGHNLI
                     ATSAAGAAVASCLAAKLCGGTVCLIGTPAEELSGGKIQMVEKGIFKELDAALIAHPGN
                     EDIATTQALACVTLNVEYFGKEAHAAAHPDKGINALDAIVLAYTSLNSLRQHIEPSAR
                     IHGIITDGGKTANIVPGHSAGTFLIRSQTMPYLKELMDRVLDCFKSAAQATGARLEYR
                     FDKSIYAPMNNNMALANLYVKNMDLLGRKTLLENSDMNFGSTDMGNVSQILPSLHGYY
                     AITRKEVSGHTEEFASAACSVNGLKGALDAAKAMAMTAADLFSNSTNLDKVKTEFQKS
                     TRPSA"
     gene            507483..510317
                     /locus_tag="DEHABAV1_RS02750"
                     /old_locus_tag="DehaBAV1_0522"
     CDS             507483..510317
                     /locus_tag="DEHABAV1_RS02750"
                     /old_locus_tag="DehaBAV1_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="WP_011928911.1"
                     /db_xref="GI:500357526"
                     /translation="MAQEYIKIKGAREHNLKNIDVQIPRDKLVVVTGLSGSGKSSLAF
                     DTVYAEGQRRYMESLSSYARQFLGRMEKPDVDHIEGLSPAIAIDQKGVSHNPRSTVGT
                     VTEIYDYLRLLFARTGHPHCPECGKEISAQSVEQITDAVQLLPEGAKILILGPLVRGR
                     KGEYTQMFKDLRKSGYARVRVDGQIKDLSEDIELDKNKKHDIEAVVDRLVVGQAGSQG
                     RVADSVETALKLGGGLVVISVVDGQDMLFSEKFSCADCGVSLGEIEPRTFSFNTPHGA
                     CQTCMGLGAKMELDPELIIPDKNQSLADGAISPYQNQNWYFGQVEDLARRAGFSLNKP
                     VSTFTPEQMQLLLYGEGGDIHKYRNRYGRVREYTSGFEGVIPRLDRLYRDSESQGVRE
                     SIEKYMLASPCQACGGKRLRKEALSVKIGERNIADVAGMSVDEQFKWANELAGKNTLF
                     SKREQLIAAQILKEIRSRLGFLNNVGLEYLTIDRIAGTLSGGEAQRIRLASQIGSGLM
                     GVLYVCDEPTIGLHPADDTRLVETLQKLRDLGNTILVVEHDESVMRAADYIIDMGPGA
                     GEHGGRVVATGNISEIMQNPASLTGQYLSGAKVIPVPEKRRDGNGQELLIQGARQNNL
                     KNIDVHIPLGKLVCVSGVSGSGKSTLVTDILFKHLAQVFYGAKDRAGGSDSITGTEHI
                     DKIIEINQSPIGRTPRSNPATYTGAFTNIRELFASVPESKVKGYGPGRFSFNIKGGRC
                     ETCGGEGYIQIEMQFLPDVTVPCEVCHGARYNREVLEIKFKDKNIADVLDMTVDRALE
                     FFENFPKISSKLQTMQDVGLGYIRIGQPAPTLSGGEAQRIKLATELSKRATGRTLYIL
                     DEPTTGLSFEDVAALLRVLQRLVDSGNTVVVIEHQLDVIKNADWIIDLGPGAGIKGGQ
                     IVAEGIPEDVALNKASVTGKYLRRVLPKLK"
     gene            510391..510942
                     /locus_tag="DEHABAV1_RS02755"
                     /old_locus_tag="DehaBAV1_0523"
     CDS             510391..510942
                     /locus_tag="DEHABAV1_RS02755"
                     /old_locus_tag="DehaBAV1_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_011928912.1"
                     /db_xref="GI:500357527"
                     /translation="MDRQLALVEVEKRVDNKNLVKHMLATEAVMKGLAGYFGENQDEW
                     AMAGLIHDIDLGEVKDDMSLHSKRSAEIAASLGAGKAVCQAILVHNSAHGIIPDSRME
                     KALFCADPITGLITAAALVRPDKKLACVEAKSVAKRFKEKSFAAGANREQIASCSSLG
                     LELDEFIRLSLSAMQSVSSDLGL"
     gene            511051..511254
                     /locus_tag="DEHABAV1_RS02760"
                     /old_locus_tag="DehaBAV1_0524"
     CDS             511051..511254
                     /locus_tag="DEHABAV1_RS02760"
                     /old_locus_tag="DehaBAV1_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011309065.1"
                     /db_xref="GI:499628331"
                     /translation="MILRTRIKELRARYNLTQSELAETVGVSRQTMLYLEKGKYNPSL
                     ILAHKVAKALHADIEDVFILRDV"
     gene            complement(511251..513830)
                     /locus_tag="DEHABAV1_RS02765"
                     /old_locus_tag="DehaBAV1_0525"
     CDS             complement(511251..513830)
                     /locus_tag="DEHABAV1_RS02765"
                     /old_locus_tag="DehaBAV1_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease SbcC"
                     /protein_id="WP_011928913.1"
                     /db_xref="GI:500357528"
                     /translation="MIPVKLKIKNFMCYRGEIPPFSFNGIHTACICGQNGAGKSALID
                     AITWALWGKSRAKSDDDVISLNEQEAEVSLDFEISGELYQVIRQRQRPKKAGTNGQSL
                     LSLFSLQDEKPRNITGDTLTQTEKKIISILHMDYDTFINSAFLRQGHANQFTQQPPGK
                     RKEVLANILGLEIYDQLEDLARQAVREAETKNLQIEQSIEDGKESLKSRPELEEALNH
                     TRQDLAEGEGKLKIQLAELEIMRHKKHSFDTKQNTCRQLDNDLKDISKDQSRWIQTLQ
                     EIKQRISTFETLSAQKEAIFKGFQEYSVCQSLYDKHNRILAKLRQLENTKKPLEDAVY
                     KEENNLKNTLGKYQERLKFRQDTAQTLVILEKEKTQSDQLKTRLETEEAELKIQQNKL
                     LNLQSSLARLETEHAVAVKEVNALEEKLNLLAEAGENRCNCPLCETELGQDKLKLVFG
                     KYKTEQDTQKTLQADLQEKLSQMQSDIQALLKYIETETNRLSHSHKQYERQISLLDKG
                     IAEAKEAEIKAAEGRNLIAGIEKQLNERSYAAAEQASLAVVEKEIQGLNFDNAEYTRN
                     QQNLADLTPFEEKKRKLDEAINRLPLENDSLKKASSALAELTARRDNKLNEQQTLLKE
                     LAELPVLEKELGEAETEYKSLSQRQDALRQQLGSLSQKAEQINELEKKLKKQAQEKDQ
                     TTQEINYFGKLVRAFGKKDGIQTMLIEDTLPELENGADLLLSRMTDGRMHLSIETQRS
                     TKKGDQTETLDINISDELGTRNYETFSGGEAFRIDFAIRIALSHLLANRLGAPLRTLI
                     IDEGFGTQDTTGIERLKEAINSIQNEFDKILVITHIDDLKDSFPTRIEIDKTPSGSAI
                     RLN"
     gene            complement(514001..515563)
                     /locus_tag="DEHABAV1_RS02770"
                     /old_locus_tag="DehaBAV1_0526"
     CDS             complement(514001..515563)
                     /locus_tag="DEHABAV1_RS02770"
                     /old_locus_tag="DehaBAV1_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma70"
                     /protein_id="WP_011309067.1"
                     /db_xref="GI:499628333"
                     /translation="MPAEKDKKEFSPDDIDDDKDAEQGLANIHDEQDAEAEGDKLAEP
                     DLKDIADTDIPAELTEEELAAEADLIPDTDEEISPLNIDLDIPLEQIDTQGIVDDPVR
                     MYLHEIGRVPLLSAEDEKTLAKKMEEGKRIREIRQECLEKRGRYPSAAESFLCMLREL
                     AQATEVLFQLGQELGMDTSASLKTIIHNPKLRTAIDHEIDQQLTKNISDNTGKSMAEI
                     EQSFINLAINSSLLPKVVLDAIPEKMTIPEISDHTYDTTFINHLERHEASLKYYLDNL
                     EIDAKRAERHLIQANLRLVVSVAKKHIGRGMPLLDLIQEGNIGLIRAVEKFDFHRGFK
                     FSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLLSISRQLSQKLGREPTPDEIA
                     LEMDLPPEKVREIAKVSQLPVSLESPIGEEEDSHLGDFIEDQNALAPPDAASRQLLKE
                     QIDTVLGSLTPRERRVLQLRFGLEDGRSRTLEEVGKEFNVTRERIRQIEAKALRKLRH
                     PSRSRKLKDYLE"
     gene            complement(515564..517330)
                     /locus_tag="DEHABAV1_RS02775"
                     /old_locus_tag="DehaBAV1_0527"
     CDS             complement(515564..517330)
                     /locus_tag="DEHABAV1_RS02775"
                     /old_locus_tag="DehaBAV1_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_011928914.1"
                     /db_xref="GI:500357529"
                     /translation="MNDAVEEIKQKLDIVSFIGQYTKLTKAGRTMRGICPFHSEKHGS
                     FFVYPEAQNWHCFGACNTGGDIFAFVMKKEGLDFKAALELLAEKAGVSLPSQINPAIK
                     DQRDRLYEINLSAAQYYHNLLLNSPQAENARIYLNSRGLNEQSLADFQLGYALADWQG
                     LYDYLKERSYSDEDLLKAGVIVRSDEGRIHDRFRNNIIYPIANYKGQIAGFGARVMDN
                     SQPKYRNSPQTDLFDKSSLLYGLHLASASIRENNRAIIVEGYMDAIMSHQGGFTNTVA
                     CMGTALTERQIALIKRQTKNLVLGLDSDSAGEEATLRAIDYENQMESEIRVAVPEGGK
                     DPDELIRHSPQSWQEILDNARPLLDYIFEHSQRGLDLNSAAGKSKLADHLLPIISKME
                     DGVRQSHYLGKLAEIVSTSQNRILERLKKLKNETRNAKVTEKEAPSGQAPKNPALEEY
                     ALSLLFTSAEVTRFAYNLHPEYLEIPQYRELLAIYNQSAEKDNLRPCLDENLREYYDN
                     LMNKNPANDNIEDKFYDLCLRLRERYLRNLAVKLNQALSEINQPETTEYQALNDQCVK
                     VNEELRSVFSLKDRRNQKQRRQ"
     gene            complement(517332..518369)
                     /locus_tag="DEHABAV1_RS02780"
                     /old_locus_tag="DehaBAV1_0528"
     CDS             complement(517332..518369)
                     /locus_tag="DEHABAV1_RS02780"
                     /old_locus_tag="DehaBAV1_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="WP_011309069.1"
                     /db_xref="GI:499628335"
                     /translation="MISELRIRERIEAREETLSPYAVKSRLSRGRQKPEDPDPVRTCF
                     QRDRDRIIHSKAFRRLKHKTQVFIAPLGDHFVTRLTHTLEVTQIARTIARALNLNEDL
                     TEAICLGHDLGHTPFGHAGEEVLNELFPKGFHHNEQSLRVVDLLEKNGHGLNLSWEVR
                     DGILNHSKSRSNILGETHNKAATFEGQICRIADAVAYINHDILDSVRAGIIKANDLPL
                     GAVSVLGNTHSHRINTMVCDIIKNSWSCTGLLPGQEPVLTMSNKVLDASNTLRDFLFE
                     QVYQSKDRKAEHEREIVRLLYKYLVGHQDLLPAEYIALSDKPERRVADYIAGMTDLFA
                     LRLAKELNLAD"
     gene            complement(518366..520642)
                     /locus_tag="DEHABAV1_RS02785"
                     /old_locus_tag="DehaBAV1_0529"
     CDS             complement(518366..520642)
                     /locus_tag="DEHABAV1_RS02785"
                     /old_locus_tag="DehaBAV1_0529"
                     /EC_number="2.7.9.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="WP_011309070.1"
                     /db_xref="GI:499628336"
                     /translation="MQKGHEAIVWFNEVTKNDIPLVGGKGANLGEMTNAGIPVPPGYI
                     VTANAYFDFINSSNLHPAISKALESLDINDSKQLSVVANIVKEMILSTPMPPGLATQI
                     KTAYKKMGQGLVAVRSSATAEDLPEASFAGQQSTYLNIEGGDEVVVAVQKCWASLFEA
                     RAIYYRVQQNFDHLQVGIAVPVQKMVQSQASGVCFTIEPITSDPTKIVIEAIYGLGEG
                     LVSGEITPDLYILDKEGPAVLSRTISHQERRLVRKNGNSTSGAEDESGNNYWQPVPST
                     KQEQQKITEDDIITLAKLAMLIENHYKGPQDIEWAKEENEIYIVQSRPVTALKDASEL
                     EPEIDAPIMLQGAAASPGLATGGVKILQDPSEIDLVLPGDILVAEMTTPDFVPAMKRA
                     AAIVTNRGGRTSHAAIVSRELGIPCVVGTGEATKVLKNDQMITVDGTHGKVYNGKVTR
                     NVKTSNIASIVREAIRTKTRVYVNLAQPELADKVAARNVDGVGLLRAEFIFSQIGKHP
                     RYMIEMGQQEEYIQQVYAGVLSFAKAFYPRPVVYRTNDFKTNEYRDLLGGDKYEGQEE
                     NPMLGYRGVSRYIKDIEVFKMEIEAIKRVRKDYPNVYVMLPFVRTVDELVKVKRILED
                     EGLKRGPDFKLWMMVEVPSNIFLIDKFIDAGIDGISIGSNDLTQLILGVDRDSEMLRE
                     TFDERNEAVLVALEKAVTTAARRGITASICGQAPSVYPELTEKLVSWGITSVSVSPDM
                     IGTTREIIAKAEAKLKIK"
     gene            520940..521509
                     /locus_tag="DEHABAV1_RS02790"
                     /old_locus_tag="DehaBAV1_0530"
     CDS             520940..521509
                     /locus_tag="DEHABAV1_RS02790"
                     /old_locus_tag="DehaBAV1_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928915.1"
                     /db_xref="GI:500357530"
                     /translation="MIEMTIDSIRVSLMNYQRVVLLKEKTADRYLPIWIGTAEAEAIA
                     VKLQGVAVPRPLTHDLLGTVIDVLGAKVRSIVVDDLKNDTFYAKVLLEVDGEQMEIDC
                     RPSDALALAVRVNVPIYAADSVLEKASIMLDREQDKRAMDEMDLPEPPSGGKGEKTRK
                     ASDEEIKRLSAFRDFVDNLDLEDFDKRKS"
     gene            521567..521800
                     /locus_tag="DEHABAV1_RS02795"
                     /old_locus_tag="DehaBAV1_0531"
     CDS             521567..521800
                     /locus_tag="DEHABAV1_RS02795"
                     /old_locus_tag="DehaBAV1_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928916.1"
                     /db_xref="GI:500357531"
                     /translation="MRFEAVMNKWGTGLQYLGLGWYMALVILLGTLGGRWLDQALGLD
                     PVFLLAGLLIGVFLAFYGVYRLLPKITNNGKGN"
     gene            521803..522747
                     /locus_tag="DEHABAV1_RS02800"
                     /old_locus_tag="DehaBAV1_0532"
     CDS             521803..522747
                     /locus_tag="DEHABAV1_RS02800"
                     /old_locus_tag="DehaBAV1_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase F0 subunit A"
                     /protein_id="WP_011928917.1"
                     /db_xref="GI:500357532"
                     /translation="MPKKKILGMPKQVFWPVMIVILAILVVGFLSGPIGIALFGDLGF
                     PDWMKITTPKPELPSAELFSIGPVAITNTILTAWITILVLVGLSVAATRKMKLIPGRL
                     QGALEMVLSWIYNMCVDAAGEKFGRKFFPLVATIFLFIIVNAWMNLLPGYNTIFIELG
                     NGHEAHLLRGANTDINLPLALAAITFFMVEYWGIKTLGGFHYLSKFFNFKPLINAFRH
                     KEGVIGIFNGVISIFVGLLEFFLEFVRIISLTFRLFGNMIGGEILILMITFLAPFIIG
                     IPFYGLEMLVGFVQALVFCNLALVFSLIAVTPHGEETH"
     gene            522788..523018
                     /locus_tag="DEHABAV1_RS02805"
                     /old_locus_tag="DehaBAV1_0533"
     CDS             522788..523018
                     /locus_tag="DEHABAV1_RS02805"
                     /old_locus_tag="DehaBAV1_0533"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8Z7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit c"
                     /protein_id="WP_010936335.1"
                     /db_xref="GI:499238795"
                     /translation="MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAK
                     GSIFTNMILLVAFAESIAIFALVISIVLIFVA"
     gene            523043..523552
                     /locus_tag="DEHABAV1_RS02810"
                     /old_locus_tag="DehaBAV1_0534"
     CDS             523043..523552
                     /locus_tag="DEHABAV1_RS02810"
                     /old_locus_tag="DehaBAV1_0534"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8Z6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit b"
                     /protein_id="WP_011309074.1"
                     /db_xref="GI:499628340"
                     /translation="MEKLAELGINIPSFIAQIVNFGLLLGLLYLFAYKPILAKLDERS
                     TRIKESMERTDQVKEQAQKAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEAK
                     AEAEAMLSRARTEIRQERDEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVL
                     ENSTDLRKN"
     gene            523573..524115
                     /locus_tag="DEHABAV1_RS02815"
                     /old_locus_tag="DehaBAV1_0535"
     CDS             523573..524115
                     /locus_tag="DEHABAV1_RS02815"
                     /old_locus_tag="DehaBAV1_0535"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit delta"
                     /protein_id="WP_011309075.1"
                     /db_xref="GI:499628341"
                     /translation="MAKRVYAIAMRYAQALHELAKEQKSLDKWQEDLQNLSRLTEDAS
                     VDEFLSNPKIVSARKHAVLAKLSDIDPLMLNLVDMLVATRRLGIMRAISGEYNRLLNE
                     ARGVEDAIVTTAKPASEADTEIIRQQLSKITGKKINILTATDPGLIAGLKARIGDKLI
                     DGSISRRLVLLQNEISQGRI"
     gene            524138..525649
                     /locus_tag="DEHABAV1_RS02820"
                     /old_locus_tag="DehaBAV1_0536"
     CDS             524138..525649
                     /locus_tag="DEHABAV1_RS02820"
                     /old_locus_tag="DehaBAV1_0536"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8Z4.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the alpha chain is a
                     catalytic subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit alpha"
                     /protein_id="WP_011309076.1"
                     /db_xref="GI:499628342"
                     /translation="MSARGQDIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGL
                     SNAKYNELLEFPGGVLGIALNLEEDSVAAVILGEDSNIKEGDEVKATGRISEITVGKG
                     MIGRVVDPLGRPLDGKGPIKAESTRPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIG
                     RGQRELIIGDRSTGKTAIALDTIINQKGGDLVCIYVAIGQKASKVARIVALLEQYGAM
                     EHTIVVAANSSDAVALQYLAPYAGCAIGEEFMEQGKDALVVYDDLTKHAWAYRQLSLL
                     LRRPPGREAYPGDLFYLHSRLLERAARLNDKLGGGSLTALPIIETQAGDVSAYVPTNV
                     ISITDGQIYLEPDMFNAGIRPAVNVGISVSRVGSSAQTKAMKKVAGKLKMDMGQYREL
                     AAFAQFGTSELDKSTRMQLERGQRVTEVLKQGQYQPVPAAKQVAILYATLNGYLDNIE
                     VGKVRDYESGLYRFLEANFASVLTAIAKENVISADTEKTLKTALDEYKKGLVV"
     gene            525674..526531
                     /locus_tag="DEHABAV1_RS02825"
                     /old_locus_tag="DehaBAV1_0537"
     CDS             525674..526531
                     /locus_tag="DEHABAV1_RS02825"
                     /old_locus_tag="DehaBAV1_0537"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984237.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the gamma chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase gamma chain"
                     /protein_id="WP_011928918.1"
                     /db_xref="GI:500357533"
                     /translation="MANLRIIKRRIRSVRNIAKITRAMEMIAASKMKKAQERGLAGRP
                     YSEKITEVIAALAALPQSGEILHPLLERRPVKKIAILHITPDRGQCGGLVANINRKTG
                     TFIMEQKVSVSAVVVGRKGVDFIRRIRQQMRAEFINLGDKPDYLDTLPISRVIMDDFM
                     SGEIDQVFIAYTQFVSTAIQNPVLEQLLPVVPVEFPPGQNLEYIYEPESAAVLNSLLP
                     RFVEMSVYHAILESIASEQSARMVAMRNATDNAKELIGELTLVYNKARQESITNELLD
                     IVGGAAALA"
     gene            526547..527941
                     /locus_tag="DEHABAV1_RS02830"
                     /old_locus_tag="DehaBAV1_0538"
     CDS             526547..527941
                     /locus_tag="DEHABAV1_RS02830"
                     /old_locus_tag="DehaBAV1_0538"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZT7.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The beta chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit beta"
                     /protein_id="WP_011309078.1"
                     /db_xref="GI:499628344"
                     /translation="MANGKVIQVIGSVVDVEFSADSMPALFNALEIPRENGKMVLEVQ
                     SHVGNNRVKCLSFTPTDGLERGAEVIDTTRPLSVPVGRGTLGRIFNVLGEALDNRGDV
                     KSEKTMPIHRLAPGMDELESSAQVLETGIKVIDLIAPFARGGKIGALGGAGVGKTVLI
                     QELIRNIATEHEGFSVFAGVGERSREGNDLWHEMEDSGVLPKTTMVFGQMNELPAVRL
                     RIALTGLTMAEYFRDEERQDVLLFIDNIYRYTLAGMEVSALLGRMPSAVGYQPTLATE
                     MGALQERIASTKQGSITSFQAVYVPADDYTDPGVVATFGHLDAMIALERSLAEQALYP
                     AVDPLASNSRILDPQVVGEEHYKVARDVQKVLQRYKDLQDVIAILGMEELSEEDKLTV
                     ARARRIQRFLTQPMFVSEVFTGRPGQYVSLTETIRGFKEILEGKHDSLPEQAFYMVGT
                     IDDAVAEAKKLSAV"
     gene            527966..528388
                     /gene="atpC"
                     /locus_tag="DEHABAV1_RS02835"
                     /old_locus_tag="DehaBAV1_0539"
     CDS             527966..528388
                     /gene="atpC"
                     /locus_tag="DEHABAV1_RS02835"
                     /old_locus_tag="DehaBAV1_0539"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZT6.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the epsilon subunit is part
                     of the catalytic core of the ATP synthase complex; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase epsilon chain"
                     /protein_id="WP_011309079.1"
                     /db_xref="GI:499628345"
                     /translation="MAKLKLDIVTAERSVFSEEVDVVVAPGIEGEMAILPHHAPLMTA
                     LQAGELKAKIGTEEYSLVVSGGFLEVRPDRVVVLADSAERAEEIDIARAIEAKKRAEA
                     SMADKYVPGMLAAETEASLRRAMVRLKVAEKRRKHPQV"
     gene            complement(528463..528963)
                     /locus_tag="DEHABAV1_RS02840"
                     /old_locus_tag="DehaBAV1_0540"
     CDS             complement(528463..528963)
                     /locus_tag="DEHABAV1_RS02840"
                     /old_locus_tag="DehaBAV1_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZZT5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimM"
                     /protein_id="WP_011309080.1"
                     /db_xref="GI:499628346"
                     /translation="MTQEEYILIGKVLGVWGISGGLKIGVLTDFPERFDAGNELLVGR
                     KLYTISQTNWQKAQVIVHLSGIDDIDTALELKDALVEIPASALKELPEGVYYDFQLIG
                     LEVVDLSGVKIGQIKEILHMPSNDIYVSSYGVKEALIPAIKDVVKEINLKTGKIIIDP
                     IPGLLD"
     gene            complement(529051..529278)
                     /locus_tag="DEHABAV1_RS02845"
                     /old_locus_tag="DehaBAV1_0541"
     CDS             complement(529051..529278)
                     /locus_tag="DEHABAV1_RS02845"
                     /old_locus_tag="DehaBAV1_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010936343.1"
                     /db_xref="GI:499238803"
                     /translation="MKELVEYIAKSLADEPNDVVVTEEPEEEGIKLTLKVADVDKGRI
                     IGKQGRIAQAMRTLIRVKAAKAGKRARLEIL"
     gene            complement(529294..529542)
                     /locus_tag="DEHABAV1_RS02850"
                     /old_locus_tag="DehaBAV1_0542"
     CDS             complement(529294..529542)
                     /locus_tag="DEHABAV1_RS02850"
                     /old_locus_tag="DehaBAV1_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8Y8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_011309081.1"
                     /db_xref="GI:499628347"
                     /translation="MLKIRLTRIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTN
                     PETVIINAEKVLYWIGKGAQPTDTVARLLKKAGIVNSN"
     gene            529687..530358
                     /locus_tag="DEHABAV1_RS02855"
                     /old_locus_tag="DehaBAV1_0543"
     CDS             529687..530358
                     /locus_tag="DEHABAV1_RS02855"
                     /old_locus_tag="DehaBAV1_0543"
                     /EC_number="3.1.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRP8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_011928919.1"
                     /db_xref="GI:500357534"
                     /translation="MNVKIKKLHNWDMTPTEAILLQRELAQKVSACGTLSSISLVAGA
                     DVWHSRTSGMGRAAVVVLSYPDMNLVEVSRSEGDCHIPYIPGLLSFREMPLLLSAFEG
                     LESMPDLILMDGQGLAHPRRLGIASHLGLFLNKPVIGCAKSRLVGEYTPLADEAGSYS
                     DLYHNSQLVGRVLRTRRGVNPLFISVGHKICLEEACSRVADCCRGYRLPEPLRHAHLA
                     AAELI"
     gene            530545..531555
                     /locus_tag="DEHABAV1_RS02860"
                     /old_locus_tag="DehaBAV1_0544"
     CDS             530545..531555
                     /locus_tag="DEHABAV1_RS02860"
                     /old_locus_tag="DehaBAV1_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928920.1"
                     /note="catalyzes the release of newly synthesized
                     polypeptide chains at the stop codons UAA and UGA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_042377943.1"
                     /db_xref="GI:755025000"
                     /translation="MEITELETASSNPDFWQDQQNAQKAMKKLAANKRTSELWRGLER
                     RINDLTELAVLSREDPSLSNEIEHEISGLTAELDSLEVGLAFSGQYDNRNALLTVHAG
                     AGGVESQDWAGMLLRMFMRWAEKKGFGMEILDQSPGEEAGIKSATLQIEGEYAYGFLK
                     SEHGVHRLIRLSPFDADHARHTSFALVEIMPEAEDSVDIDIKPEDIKIDMFRSSGPGG
                     QNVQKVSTAVRVTHIPSGIVVASQTERSQHQNREIAMRILASKLLAVEIAKRAEERAK
                     LKGERISAEWGSQIRSYVLHPYKMVKDHRTDYEVGNAEAVLEGELDGFISAYLRQNIG
                     RE"
     gene            531555..532781
                     /locus_tag="DEHABAV1_RS02865"
                     /old_locus_tag="DehaBAV1_0545"
     CDS             531555..532781
                     /locus_tag="DEHABAV1_RS02865"
                     /old_locus_tag="DehaBAV1_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309084.1"
                     /db_xref="GI:499628350"
                     /translation="MKKQLLALGLMLGILLGGLVPSTLTAQSPITIDKSSVNITFPSN
                     IGFSLTASSISNITDIRLYYTVDRKTFSEVYSEFVLNFTPDTTVNASYSWDMRYTGGM
                     PPGARVNYWYRITDEAGNILTSPSQTVVYEDARFDWQSISEGMLELYWYNGEQSFADE
                     LMESAQAALLRLAADTGAELQDKVTLYIYANSADLQSAMVFPSEWTGGVAYPAFNVIA
                     IGIAPYDVDWGKRAITHELAHQVTSQMTSNPYCDLPVWLNEGISMYAEGNLEAVYVNY
                     LVWAIGQDKLISVKSLCSPFSANSADAYLSYAESFTLVNYLITYYGPEKFSALLETFH
                     QSAGYDEALLAVYGFDIQGLNTLWQATLKNGAIEIQPPRSIILTPGLAVLLTLVAGGS
                     IITAFWLWSNRVVSRT"
     gene            532765..533451
                     /locus_tag="DEHABAV1_RS02870"
                     /old_locus_tag="DehaBAV1_0546"
     CDS             532765..533451
                     /locus_tag="DEHABAV1_RS02870"
                     /old_locus_tag="DehaBAV1_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_011928921.1"
                     /db_xref="GI:500357536"
                     /translation="MSPVPSIRDLPLAERPRERLQSLGAGALSSVELLAVILGRGVAG
                     EPVLQSAQRLIAHFGGPSGIACASVEELSKLKGIGLAKACQLKAAFELAKRAGGIKGE
                     YQPCIKTPEDVFQIIYPLVCDEKKEYFFCLMLDVKSRLIRVGHISVGSLEESVVHPRE
                     VFKEALSASAASVILAHNHPSGDTEPSHDDIGLSARLREAGGIMGIEVLDHIIIGGQS
                     FTSLKRQGLL"
     gene            533451..535046
                     /locus_tag="DEHABAV1_RS02875"
                     /old_locus_tag="DehaBAV1_0547"
     CDS             533451..535046
                     /locus_tag="DEHABAV1_RS02875"
                     /old_locus_tag="DehaBAV1_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011928922.1"
                     /db_xref="GI:500357537"
                     /translation="MMKKILLIILSVCLSFSLLLSGCGYAPEDNTMPTGNNVLTLVGQ
                     EPYTLDPAKVSDSGSVTYIYQIFSGLLKMGDDLTPVADIAQSWEVSPDGLTYTFYLKP
                     NVKFHNGRVLTAADFKYSWERAASPATASNTVLTFLGDIQGVTEMVQGQANSISGVTV
                     VDDLTLKVKLVSPCSFFLSKISYVTAFVVDKDNVSQGSDWWKKPVGTGPFMLPELTQG
                     NYIMLNSNPDYYDTPAKISSVIFRLQSGQPMDLYEVGGIDVAGVSADYLAKATDPDGF
                     FSADLQVVPQLSFYYFAYVTSKAPFDDPKIRQAFSMAVDKARIIELSYKGSVSVAEGI
                     LPPGMPGYNPDLSGLEYNPERARELIAESSYGSVENLPTITLTASGWGGLLPVELEAV
                     IDQWRQNLGVEVVVRQIDMERFLYDLQTEKDNLYYSGWVADYPHPQDFLSVLFETTSS
                     YNSGDYSNPEVDALLVQAAATLDTEESMQLYAQAEQILINDAACLSFWFGKNYMLVKP
                     YVKGYKLNAMGIPILTEVSLEAH"
     gene            complement(535171..535260)
                     /locus_tag="DEHABAV1_RS02880"
                     /old_locus_tag="DehaBAV1_R0009"
     tRNA            complement(535171..535260)
                     /locus_tag="DEHABAV1_RS02880"
                     /old_locus_tag="DehaBAV1_R0009"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(535224..535226),aa:Ser,seq:tga)
     gene            complement(535524..535883)
                     /locus_tag="DEHABAV1_RS02885"
                     /old_locus_tag="DehaBAV1_0548"
     CDS             complement(535524..535883)
                     /locus_tag="DEHABAV1_RS02885"
                     /old_locus_tag="DehaBAV1_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928923.1"
                     /db_xref="GI:500357538"
                     /translation="MPACPYRRYKNAVKQTPNLEGKTRNVKSRYPALQLVIKVIKILA
                     VLITLAGIIASTTIMAGDGLIHIDSATAFSVFAGMLGILASLIQGILIYATAELLQCF
                     IDIERNTRKTTHLLNTR"
     gene            complement(536065..537207)
                     /locus_tag="DEHABAV1_RS02890"
                     /old_locus_tag="DehaBAV1_0549"
     CDS             complement(536065..537207)
                     /locus_tag="DEHABAV1_RS02890"
                     /old_locus_tag="DehaBAV1_0549"
                     /EC_number="2.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_011928924.1"
                     /db_xref="GI:500357539"
                     /translation="MEIKPFELERYFAKHEFSARYLMSSSDCESLGLEDLLLLADAEC
                     RNLWQNLKLGYTYSDGHPLLRKEIAKLYEHITLSDILTTVPEEGIFIALNCLLEKGDH
                     VICTFPGYQSLYQLAESLGCEVSYWKPEEENGWRFNPEFLSRNIRPNTRLIITNFPHN
                     PTGAMPDTRDYALITEIISQHNLWHFSDEMYRLLEYSPQNRLPAACDKSGMSVSLGGL
                     SKSFGLPGLRSGWLACRDKDVLSKMAGFKDYTTICGSATAEILSIIALRNKDTIVSAQ
                     LGRLNQNLKLLEGFMGRHKQYFSWVKPKAGSVCFPRLNKITPCMDFCQQVLEKTGIVI
                     LPSEVYNYGQNHFRIGFGRANFPEVLEIFENFITAYPARSKGLPEM"
     gene            complement(537223..538464)
                     /locus_tag="DEHABAV1_RS02895"
                     /old_locus_tag="DehaBAV1_0550"
     CDS             complement(537223..538464)
                     /locus_tag="DEHABAV1_RS02895"
                     /old_locus_tag="DehaBAV1_0550"
                     /EC_number="6.1.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine--tRNA ligase"
                     /protein_id="WP_011309089.1"
                     /db_xref="GI:499628355"
                     /translation="MLDLKFIRENPELVRKAVADRNTDAPIDEILELDNSRRNLTQEL
                     DNLRAKRKIMAKQRDETAIEEGRVLRGQISTLESELSQVDEKLTDRLLRVPNIPDPSV
                     PVGKDESENVVLYYRGEKRNFSFTPKPHWELGEALDIIDFDRGIKLSGSRFYILKGAG
                     ARLQRALIAFMLDLHTRKHDYTEIYPPYMIKRECLVASGNLPKFADNLYHDAEEDYWW
                     VPTAEAPLTNLHRDEILSAEQLPIHYVAYTACFRREKMSAGKDVRGIKRLHQFDKVEL
                     YKYCKPEDSFAELEKMVADAEEIADALKIPYRLKQLVTADISFGSAKSYDIEMYSPGV
                     DEWLEVSSCSNCTDFQGRRANVRFRRTSEAKPEFVHTLNGSGLALPRVMISVIENYQQ
                     PDGSIVIPEVLRPFMGVDVIR"
     gene            complement(538496..539992)
                     /locus_tag="DEHABAV1_RS02900"
                     /old_locus_tag="DehaBAV1_0551"
     CDS             complement(538496..539992)
                     /locus_tag="DEHABAV1_RS02900"
                     /old_locus_tag="DehaBAV1_0551"
                     /EC_number="6.1.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_011928925.1"
                     /db_xref="GI:500357540"
                     /translation="MPEEYLNAQKMEKLERIKSRGINPYPSTFHPSHTSAQAVALLVE
                     IETQENHLKEVLKLAGRIMTRRDMGKISFMDIRDGSGKMQIFFRQNDLDEASIELLKD
                     LDLGDFIGVEGSLMRTRTGEPSLAATKVSMLSKSLLPLPEKWHGLQDVEKRYRQRYLD
                     LISNADARQTFLTRSRVISVIRAFMNAKGFLEVETPVLQPEAGGALARPFITHHQALN
                     CDFYMRIALELHLKRLIVGGFDRVYEIGRIFRNEGISTRHNPEFTMMESYQAYANYKD
                     VMDFLEEMVSSVVKEISGGYTLPFGDITLDFTPPWPRLTMRDAVKQYAGIDFFDFPTK
                     ETLAAEMTRRKLKVDPAKDWGKLVDELVGEFVEPHLVQPTFLTDHPVAMSPLAKQKPE
                     DPRLTERFEAICANMEIANAFSELNDPVEQRARFKEQLEKRSQLRTDESESVDEDFLA
                     ALAYGMPPTGGLGVGIDRLVMLFTNHDSIREVILFPALKDREDTKTQE"
     gene            540222..540401
                     /locus_tag="DEHABAV1_RS02905"
     CDS             540222..540401
                     /locus_tag="DEHABAV1_RS02905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012984244.1"
                     /db_xref="GI:502749260"
                     /translation="MDVSESIVPIIVGIVQVVLIVVLIALGIYSLRNNKSGKQFEAKD
                     IQAGESREEKFISRD"
     gene            complement(540415..541176)
                     /locus_tag="DEHABAV1_RS02910"
                     /old_locus_tag="DehaBAV1_0553"
     CDS             complement(540415..541176)
                     /locus_tag="DEHABAV1_RS02910"
                     /old_locus_tag="DehaBAV1_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWX7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecO"
                     /protein_id="WP_011928927.1"
                     /db_xref="GI:500357542"
                     /translation="MTKPHDFKTKAIIVRKTKCGEADRILSLLTPDLGLIQGFAKSVR
                     KTTSKLSGHLELLCYSEVSLARGKAIDTITGSQTIQSFLNIRNSLQLSAMAFYACELA
                     YHFSPEEAANPALFQLLLSTLEELDNGSQPELCLKYFEINLLASSGYKPELRECANCH
                     KKLQATINYYSPESGGVICPNCRNTQIGMPVSVNTVKVLRYIQENSFSSICRLKINRE
                     ILSELELAIRANIRFVLEKEPKALFWLDSLRLADL"
     gene            complement(541275..541997)
                     /locus_tag="DEHABAV1_RS02915"
                     /old_locus_tag="DehaBAV1_0555"
     CDS             complement(541275..541997)
                     /locus_tag="DEHABAV1_RS02915"
                     /old_locus_tag="DehaBAV1_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA alkylation repair protein"
                     /protein_id="WP_011309094.1"
                     /db_xref="GI:499628360"
                     /translation="MANIEIQEEYTELITQLKALANADNAAGMSRFGISSANTLGVSG
                     KDIRRLIVQAGHNHPLAMLLWDSGIHEARIMASLVAESRKVSPQEMETWVKDIDSWDI
                     CDLCCNNLWYKTPFAYEQALKWTYREEEYVKRAGFVLLTALAVHDKKAPDEKFVLFFP
                     RLLAEASDERNYVKKSVNWALRQIGKRNLSLNKAAITLGEEILAQNTRSARFIATDAL
                     RELKSPQIQERLSGSRKKPTDA"
     gene            complement(541999..543063)
                     /locus_tag="DEHABAV1_RS02920"
                     /old_locus_tag="DehaBAV1_0556"
     CDS             complement(541999..543063)
                     /locus_tag="DEHABAV1_RS02920"
                     /old_locus_tag="DehaBAV1_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_011928929.1"
                     /db_xref="GI:500357544"
                     /translation="MTRQSKKYSQKAGMLPGSVVFIGEGKTEKASLSLHSYTPDSYQP
                     LPVRNLADCITQIKQSKGIVWIKVNGLQDTAMVEELGKCFSLHPLTIEDVVNTEQRPK
                     LEDYGNYFFAVIKALYWDSELKKTRSEHISLVLGNNYLISFQEHQSDILNPIQERLKS
                     DNGRLRKLGSDYLLYSILDMVVDGYFSLLEGFGDYLDEIEEQLLSTPSSQTLKQISGA
                     KKEMLFIRKSIWPVRETIASIERTENPLIDKNSHVYFRDIYDHLIQLIDTGETYRDML
                     SNMIDIYLSSLSNRMNEVMKVLTIFASIFIPLTFIVGIYGMNFDIPELRLSWGYPGIL
                     IFMLAVVLLLLSFFKRKKWL"
     gene            complement(543102..543716)
                     /locus_tag="DEHABAV1_RS02925"
                     /old_locus_tag="DehaBAV1_0557"
     CDS             complement(543102..543716)
                     /locus_tag="DEHABAV1_RS02925"
                     /old_locus_tag="DehaBAV1_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8X4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="WP_011309096.1"
                     /db_xref="GI:499628362"
                     /translation="MKDTSLPSTAGVVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPED
                     QVISLSDTIRNIKNQISQCRICCNVADSELCPICQNTKRETNKICVVEQPQDILALEH
                     VGVYRGYYHVLHGAISPTEGITSQNIRINELMVRLDNGQVEEIILATNPTTEGEATAM
                     YLSRLITPLGIKVTRLARGLPFGTELEYADDVTLSRAMEGRQNF"
     gene            complement(543738..544043)
                     /locus_tag="DEHABAV1_RS02930"
                     /old_locus_tag="DehaBAV1_0558"
     CDS             complement(543738..544043)
                     /locus_tag="DEHABAV1_RS02930"
                     /old_locus_tag="DehaBAV1_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377676.1"
                     /db_xref="GI:755024726"
                     /translation="MNMNMIKQAMELKSKLDKAQKELAKIVVETESAKGAIKIKMNGQ
                     QKVLSLSISPEIINPAKPKDLENALTKAFNDAYEETKKEGSKQMQGLIGDVKIPGLM"
     gene            complement(544047..545759)
                     /locus_tag="DEHABAV1_RS02935"
                     /old_locus_tag="DehaBAV1_0559"
     CDS             complement(544047..545759)
                     /locus_tag="DEHABAV1_RS02935"
                     /old_locus_tag="DehaBAV1_0559"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_011928931.1"
                     /db_xref="GI:500357546"
                     /translation="MADMTCQVFYRKWRPQTLADLVGQEHVAHTLKNALSSGRIAQAY
                     LFCGPRGTGKTSTGRILAKAVNCTTNQGKGEPCNTCPMCLSITEGSSMDIIEIDAASN
                     TGVDDIRELKEKVQYSPSLANYKVYIIDEVHMLSNSASNALLKTLEEPPPRVIFILAT
                     TEIHKVLPTIMSRCQRFDFHRVSLVDMTRKLGKISLAEGINVEPEALKLIARSAGGSF
                     RDGENLLQQIATTYGAEISLSQVQAALGISGDERIKALAENILKKDIKNGLKTLNAVL
                     ADGLDLKQFRRELLDYLRQIMLVNSGSESSLELTADEKKALQKVSGITNLENITKAIK
                     AFSQLDFSSDTASSLSFELALIDASLDKNTVPLPNKPKDEIPAVKADKPAPLEAPKTA
                     ASNNIPTKEPKTETLTKPNTSAETAATPKPHTKESAPKLTRAAIPIEEKPKYTAPAPP
                     KEEEKVLIGAGDIIEQLKVSWKSILDQAPDNLKRSAAVAILRSAGVRPVSMDKNIVTL
                     SFKYKYHKDKIEELENRKVTAELISNFVGKTCTLVCISEAETNHLVKQAQKLGAQIIS
                     VEEK"
     gene            complement(545860..546111)
                     /locus_tag="DEHABAV1_RS02940"
                     /old_locus_tag="DehaBAV1_0560"
     CDS             complement(545860..546111)
                     /locus_tag="DEHABAV1_RS02940"
                     /old_locus_tag="DehaBAV1_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011928932.1"
                     /db_xref="GI:500357547"
                     /translation="MFEIYYLYNCELNKEYRVQAEDYHRLHPARPASPRRPLMLRLGE
                     YMVNTGNRIIGHITTQPIPDTEDRSPVYRNKTVKTQTLL"
     gene            complement(546142..546564)
                     /locus_tag="DEHABAV1_RS02945"
                     /old_locus_tag="DehaBAV1_0561"
     CDS             complement(546142..546564)
                     /locus_tag="DEHABAV1_RS02945"
                     /old_locus_tag="DehaBAV1_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309100.1"
                     /db_xref="GI:499628366"
                     /translation="MSENTKKILQMLSEGKITVDEANKLLGALGNEGEKPGSIATATP
                     KGSPKYLRVIINGTDEDKNAKVNVRVPMALLRAGIKLASILPADATNEIDHNLKGKGV
                     NFDFKNLREEDIEPLIEAMTEMEVDVDSEGSKVKVFTE"
     gene            complement(546580..546864)
                     /locus_tag="DEHABAV1_RS02950"
                     /old_locus_tag="DehaBAV1_0562"
     CDS             complement(546580..546864)
                     /locus_tag="DEHABAV1_RS02950"
                     /old_locus_tag="DehaBAV1_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928933.1"
                     /db_xref="GI:500357548"
                     /translation="MYWPPMLLWVGIPFGKHGRSFPLILPLFLVYPIVLALMIVLAPF
                     MLLAILLAWASGRGRFLLLIGPYFYRVWCALRGINADIQDKNTHIKIQFI"
     gene            complement(546864..547238)
                     /locus_tag="DEHABAV1_RS02955"
                     /old_locus_tag="DehaBAV1_0563"
     CDS             complement(546864..547238)
                     /locus_tag="DEHABAV1_RS02955"
                     /old_locus_tag="DehaBAV1_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma70"
                     /protein_id="WP_011928934.1"
                     /db_xref="GI:500357549"
                     /translation="MVKDWQELTKLTQGAPVTVERVKLVSSGIAIEGSFDLPNLARLP
                     AEDQVFVMAFVKCHGSIKDMEKFFGISYPTVKNRLQRIGANFNFIENFPAPPKTNEDD
                     NVLTELEKGGISVEEALRRLQR"
     gene            complement(547445..548623)
                     /locus_tag="DEHABAV1_RS02960"
                     /old_locus_tag="DehaBAV1_0564"
     CDS             complement(547445..548623)
                     /locus_tag="DEHABAV1_RS02960"
                     /old_locus_tag="DehaBAV1_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_011309103.1"
                     /db_xref="GI:499628369"
                     /translation="MKLIVIGLGQCGSRIADEFARMDKRARSQRNVSICPGVFAVNTD
                     QADLSGLVTIKPDHQHRILIGGRKTGGHGVGKINELGAEIARADADKVIDALRTTKRF
                     YDADGFLVIAGAAGGTGSGAVSIIAQHIKERYMDKPVYALIAMPFEHEEKTEERTVYN
                     TAVCLKSISSVADAVILVENQRYVRKDFSLRYNLSKINSLIVEPFWDLLCAGEEKNAK
                     YIGAKTMDAGDIIQTISGWTVIGHGKARVRTLTLPFDKTDHFRMKSVSNYKGIRAMDE
                     AVSELSLKIDPRDAGRALFLISAPAKEINMDIIKEQGDWLREMAPNAIIRNGDYPREK
                     DTMTVTVIFSELSDLERVRYYYNRSTSMMPIIKQRQSDLADRRRDIDELSRDIPSLLE
                     "
     gene            complement(548711..549718)
                     /locus_tag="DEHABAV1_RS02965"
                     /old_locus_tag="DehaBAV1_0565"
     CDS             complement(548711..549718)
                     /locus_tag="DEHABAV1_RS02965"
                     /old_locus_tag="DehaBAV1_0565"
                     /EC_number="1.2.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_011928935.1"
                     /db_xref="GI:500357550"
                     /translation="MVTRIGINGFGRIGRITLRTINQYHRGELEVVAVNDLADNKSNA
                     HLLKWDSTYGKYAGTVESDDCSIIVDGKPIRVFSERDPMQIPWETAGVDLVIESTGLF
                     TDASKAAAHLRGSVKTVVISAPAKGEDITIVMGVNEDKYNCNTHRIISNASCTTNCVA
                     PLIKVLHDKFGVKKGFMTTCHAYTNDQKIQDMFHKDIRRARAAAVNVIPTTTGAAKAV
                     ALVLPELKGKLDGISFRIPSASVSLVDFVGELARDVTVEEVNASFKEASQGKLSGILE
                     YCEEELVSSDFKGNPASSIIDAPSTMVLGGNMVKVLSWYDNEWGYSTRLGDLIAYIAK
                     K"
     gene            complement(549740..550759)
                     /locus_tag="DEHABAV1_RS02970"
                     /old_locus_tag="DehaBAV1_0566"
     CDS             complement(549740..550759)
                     /locus_tag="DEHABAV1_RS02970"
                     /old_locus_tag="DehaBAV1_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyglutaryl-CoA dehydratase"
                     /protein_id="WP_011928936.1"
                     /db_xref="GI:500357551"
                     /translation="MKNNGQNKYIGITTTVPIEILLSAGYSPLDLNNIFVSDPKSDRL
                     IRLAEKDGFPLNCCAWIKGIYGVCLDKGISEVICVTSGDCSNTQMLREVLNLKGIRTI
                     PFDFPTEPDPAEVKASLAKLALRLSTTLEAADEWRKRLLPARELVHKLDYLCYADNKV
                     SGFENHYWLVSSSDFNGDYVKYQAELQKLLDTVQTRTPYPATELRLAYLGVPSVFGEE
                     LYPYLEQNGARVVFNEIQRQFSLPNGGADISQSYTAYTYPYPMEYRLRDIQTQLAERK
                     IDGIIHYVQAFCHRAIGDIILRQKLPLPILTLEGNADFGLNQHQKTRLEAFLDMLKAK
                     KQMNL"
     gene            complement(550756..551574)
                     /locus_tag="DEHABAV1_RS02975"
                     /old_locus_tag="DehaBAV1_0567"
     CDS             complement(550756..551574)
                     /locus_tag="DEHABAV1_RS02975"
                     /old_locus_tag="DehaBAV1_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928937.1"
                     /db_xref="GI:500357552"
                     /translation="MSLPGQTGTNFKQPDKWDCYKFECLSDFLGEYAKSVRQPTGYLE
                     AFAGSNQSVCAGINCPREACHILKGKESFFNQIVLLAQSETALAALRKPLLPARADVL
                     SGSLINEETLQKVLDSFPRSEAVFILLEPPGFHHLRFSSLKKLALRGIDKDGRKPDML
                     LVLPLEMSLIRNLGRLDCQDSISRFFGHDKWIDIRQDWYTKRINTEEARKRLLRLYLA
                     GFKDMGYKHVVHKEPANAGSPARYQLAVVSDRINFKNILDTIWDKERFLSCELF"
     gene            complement(551590..552876)
                     /gene="eno"
                     /locus_tag="DEHABAV1_RS02980"
                     /old_locus_tag="DehaBAV1_0568"
     CDS             complement(551590..552876)
                     /gene="eno"
                     /locus_tag="DEHABAV1_RS02980"
                     /old_locus_tag="DehaBAV1_0568"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407636.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_011928938.1"
                     /db_xref="GI:500357553"
                     /translation="MSAVVKSIKAREILDSRGNPTVEADVVLSDGSFGRAAVPSGAST
                     GSHEAVELRDGDKSRYNGLGVHKAVANVNTTIASAISGFKASDQQRLDNLLIELDGTP
                     NKAKLGANAMLATSLAVAHAAAASRHMPLYRYLNNSEEYILPVPMFNILNGGKHASNS
                     TDFQEFMVMPVGAKSFAQALQMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKD
                     AVEVILKAIEKAGYRPGEDIFIALDPASSELYQDGKYTLATENKTLSSAEMVDYWCGW
                     VEKYPIISIEDGLFEDDWDGWKLLTRKIGNKVQLVGDDFYVTNIKRLDRGIKEKASNS
                     ILIKLNQIGTLSETIAAIKMANNAGWTAVVSHRSGETEDTTIADLAVAMNAGQIKTGA
                     PCRSERTAKYNRLLRIEEELGGKAKYPGKDAFLNLK"
     gene            complement(552895..553374)
                     /locus_tag="DEHABAV1_RS02985"
                     /old_locus_tag="DehaBAV1_0569"
     CDS             complement(552895..553374)
                     /locus_tag="DEHABAV1_RS02985"
                     /old_locus_tag="DehaBAV1_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377681.1"
                     /db_xref="GI:755024731"
                     /translation="MKNKHIFVAVIGASKANSEEARLAEEVGKELALRQVTLVCGGMG
                     GVMEAACRGASLNGGLTIGILPGNSREEANPYVQIPIVSSIGFARNIMVVKSAQAVIA
                     IGGAYGTLSEIAYALQIELPVIALNSWSMSQNGKSDSAVIKAENALEAVTKALDLIN"
     gene            complement(553422..553991)
                     /locus_tag="DEHABAV1_RS02990"
                     /old_locus_tag="DehaBAV1_0570"
     CDS             complement(553422..553991)
                     /locus_tag="DEHABAV1_RS02990"
                     /old_locus_tag="DehaBAV1_0570"
                     /EC_number="3.1.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRL3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_011928940.1"
                     /db_xref="GI:500357555"
                     /translation="MKLIIGLGNPGKEYSGNRHNVGFQCLSRFAKENHISFDKKCCLS
                     RTGSGRINDEEIVLAKPQTYMNLSGKAVNQLLRRYNLKAADIIVVQDDLDLPAGKLRL
                     RLGGSAGGHNGVSSIITDIGTKEFIRLKIGIGKPDARNNGAEVVDHVLGNFGGEEREI
                     IETAIARAAEALACLITSGLDTASNRFNC"
     gene            complement(553991..556024)
                     /locus_tag="DEHABAV1_RS02995"
                     /old_locus_tag="DehaBAV1_0571"
     CDS             complement(553991..556024)
                     /locus_tag="DEHABAV1_RS02995"
                     /old_locus_tag="DehaBAV1_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8W1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_042377684.1"
                     /db_xref="GI:755024734"
                     /translation="MFSPLIEVENLRREINRHNQLYYVQDNPEISDAQYDTLIRRLKE
                     LEEAHPELVTPDSPTQRVGAEPLKAFGIVNHPYPLLSLANAFSDTELEAWYQRVKKLL
                     GNIPFQIDCEPKMDGLAVALTYRNGKFATGATRGDGFQGENITRNLRTIHSIPLNAEP
                     NAPPVFEVRGEVYLSKNGFAKLNRERADKGLPLFANPRNAAAGSLRQLDPSVTAERPL
                     DIFIYALGYSEDSLLPDSHWQILDYFSKIGFRINPLNRLVNTLEEAKEYYRQMAANRA
                     SLPYEADGVVFKVDSVSLQHRLGDVGREPRWAIAYKFPAEQVMTRLKKIGISVGRTGT
                     LNPFAVLEPVNVGGVVVKQAALHNEDDILRKDIREGDTVIIQRAGEVIPEVVAPVLSK
                     RNPESKPFRMEESLFNPNLNRTACPVCGGEIYRPAGEAMHYCANVSCPAQFERQLEHF
                     VSRGAMDIRGIGESLSVILAQQGLVKNVSDLYYLTTADLLQLPRMGEKSADNIIDAIA
                     DSKTRPLDRVIFGLGVRHVGNETATLLSRHYGNIWALAKTGLGELQTIPDIGDKIASS
                     IVAYFSEEKNVAVIRRLEEAGVRLTSDQKPVNKNMPFSGMEFVVTGKLESFSREEAQE
                     KIRSLGGTAKDNVTKATNYLVVGADAGSKLTKARSMGVKELSEREFINMLEQS"
     gene            556169..557497
                     /locus_tag="DEHABAV1_RS03000"
                     /old_locus_tag="DehaBAV1_0572"
     CDS             556169..557497
                     /locus_tag="DEHABAV1_RS03000"
                     /old_locus_tag="DehaBAV1_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309111.1"
                     /db_xref="GI:499628377"
                     /translation="MAEVRAFHGLRYNPMFVDDMADVICPPYDIISPEQEKALKERSP
                     YNYIRLEYSQPTPQDNIVDNRYTRAAAILEKWIGERVMTAEKKAAIYIHDHYFSVFGK
                     QYKRRGIIARVRLEEWDRMVIRPHEGTLAEPKRDRINLISAVRANTSPVYGLYQDTEK
                     DINRVLEIQTGGKPTVSMNIEGERHELWVVTDESAISKVTALFDKKPVYIADGHHRYE
                     SALTYRRERLAGNPQLPSDDPVNFVMMTLVDFADPGLVVLPAHRLLGGMDARTLSNLQ
                     TKLASFFDVTTIPAKLPAAWDTLDKAFKEEGKIRLVMYGLGGTENFTILTLRDLETAS
                     KLMPYFHSDIYKKLDVSILDHIILEELMGLKTVEDPRIAFNFDRNDVVSRIKSGEFQL
                     AFILKPMKAEVIKAISDVSDRMPRKSTYFFPKLPSGLVVYRFESEAIAKK"
     gene            complement(557568..558155)
                     /locus_tag="DEHABAV1_RS03005"
                     /old_locus_tag="DehaBAV1_0573"
     CDS             complement(557568..558155)
                     /locus_tag="DEHABAV1_RS03005"
                     /old_locus_tag="DehaBAV1_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal 5'-phosphate synthase subunit PdxT"
                     /protein_id="WP_011928942.1"
                     /db_xref="GI:500357557"
                     /translation="MKIGVLALQGAFREHLNMLGTLGAEAVEVRKAEELPELSGLIIP
                     GGESTTITKLLDIFGMAEPIKALAKKGMPIWGTCAGMICLAKELPGDISGVKPLGLMD
                     ITVRRNAFGRQVNSFEAMLKVKGLDKADFPAVFIRAPLVEKTGKGVEILSKLPDGTIV
                     AVRENNLLAISFHPELSGDNRFHRYFVQMAKTYKA"
     gene            complement(558230..559810)
                     /locus_tag="DEHABAV1_RS03010"
                     /old_locus_tag="DehaBAV1_0574"
     CDS             complement(558230..559810)
                     /locus_tag="DEHABAV1_RS03010"
                     /old_locus_tag="DehaBAV1_0574"
                     /EC_number="1.1.1.95"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015406996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_011928943.1"
                     /db_xref="GI:500357558"
                     /translation="MKKVLVSDALSATGLAPLKEIAQVDVKTGLKPEELISIIGEYDA
                     LLVRSQTQVTADIINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATE
                     HTLALMLAMARHIPRANASLKSGQWKRNEFVGSELKGKTLGIVGLGNIGSEIAKRALA
                     LEMRVIGYDPFISMERAKKLQVELLPFEDLLKQADFITLHVPMTGQTKGLIGPKELEM
                     MKPTVRLINTSRGGIIDEEALAKAVKEKRIGGAAIDVFSKEPCTESCLFECDNIIVTP
                     HLGASTAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAESLPVVGPFMPVARTVG
                     SLVSQLTDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISEERVNVVNADIVASQ
                     RGLGVTEQKESTCQNFSSLITVTIDTDNGKSNTVAGSLVRGDVHIVKLNDYWIDIVPT
                     GGYFLFADHIDRPGLIGSAGKITGDADINISYMHLSRQKARGQALMILALDEPLPEKQ
                     RQQLLSLPDVQMVQVVKI"
     gene            complement(559812..560900)
                     /locus_tag="DEHABAV1_RS03015"
                     /old_locus_tag="DehaBAV1_0575"
     CDS             complement(559812..560900)
                     /locus_tag="DEHABAV1_RS03015"
                     /old_locus_tag="DehaBAV1_0575"
                     /EC_number="1.12.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class V aminotransferase"
                     /protein_id="WP_011309114.1"
                     /db_xref="GI:499628380"
                     /translation="MQNLRIPGPTPCPEEVLKAMGQQMINHRGPEMAAIMKEVAEKLK
                     YFFQTKNDVLVLTGSGTGGLEAAAVNFLSPGDTVLSVSIGVFGERFAKIASIFGAKII
                     ALNFEQGKAADPALVKKALTEHPEIKAVLVTHNETSTGITNDLKPLASVIKGAGKLLL
                     VDAISSLSSINLPVDEWGCDVVVSGSQKGWMVPPGLAFISVSPEAWKANAESKMPRFY
                     WDLAKHKASIEKGQTPWTPCVSVIVALHTALIMMEKEGMQNIFKRHQKIADFTRKGVK
                     ELGLTLLAEEKYASNTVTAIVATEGLDVKKLLKIMREEYNTVLAGGQGPLEGKIFRIG
                     HLGWVTENDIKVTLDNLKLALPKAGFRS"
     gene            complement(560960..562150)
                     /locus_tag="DEHABAV1_RS03020"
                     /old_locus_tag="DehaBAV1_0576"
     CDS             complement(560960..562150)
                     /locus_tag="DEHABAV1_RS03020"
                     /old_locus_tag="DehaBAV1_0576"
                     /EC_number="6.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZX03.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_011309115.1"
                     /db_xref="GI:499628381"
                     /translation="MNQSENQIDQILKRGVAEVIVEEDFKKLLLSGRKLRLKEGFDPS
                     SPDIHLGHMVALRKLRQLQDLGHQVVLIVGDWTAQIGDPSGASVTRPMLSAEQVKANA
                     KTYLEQFFKIVDKDKTEVRWQSEWYGNFKLEDVVRLSSKFTVAQMLARDDFAKRYAAG
                     KPISVTELLYPMLQAYDSVMVKSDVEFGGTDQKFNLLVGRELQEMVGQKPQQVLMVPI
                     LVGTDGVHKMSKSLGNYIGVAEDPSEIFGKCMSIPDELILQYFELVTDIPDQEIADFK
                     AQMENGQVNPMILKKRLASELLTQLYNATAAQEADARFTRVVQRGEIPEDMPECRLEN
                     GQNTGVIDFIILSGLAKSKSEARRLLEQGAVEINSEKISDQNTPVKCGDIIKAGKRRY
                     SKAI"
     gene            complement(562157..563074)
                     /locus_tag="DEHABAV1_RS03025"
                     /old_locus_tag="DehaBAV1_0577"
     CDS             complement(562157..563074)
                     /locus_tag="DEHABAV1_RS03025"
                     /old_locus_tag="DehaBAV1_0577"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibF"
                     /protein_id="WP_011928944.1"
                     /db_xref="GI:500357559"
                     /translation="MTLLEEELILHASDQDTLITIGVFDGVHLGHQHLINELKKQAKE
                     RNLQSCLITFKDHPSKVLGQDDIKLILSLEERNLALEQMGLDRIIMLSFTPEIAEICA
                     TDFVGYLLDHLHMQGIVVGSDFALGRNRAGDATALRRLSHIMDFSVSVVSPVVIENQI
                     VSSTAIRQALRTGNVTKARLMLGRNYHLRGTVQSGANRGTKLGFPTANLTLPGYLALP
                     ADGVYAAKAFLAEKEYKAVANIGSCPTFGQEEHRLEVHLLDFKGDIKGQTLKVEFVEF
                     LRSEVCFANAEALKAQISVDILKARDILR"
     gene            563481..567302
                     /locus_tag="DEHABAV1_RS03030"
                     /old_locus_tag="DehaBAV1_0578"
     CDS             563481..567302
                     /locus_tag="DEHABAV1_RS03030"
                     /old_locus_tag="DehaBAV1_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZX01.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_042377688.1"
                     /db_xref="GI:755024738"
                     /translation="MVSMLPKADAATGVIRKSYAQLPEVVNVPNLIEMQLQSFVWFQE
                     EGLRELIEEISPIKDFVGNRLELEFIGYEFREPRLSEYECTQRDQTYSVPLYVKARLI
                     VKTTGEIKEPFDLFFGDIPLMTALGTFITSGTERVVVSQLLRSPGVYFTISDDPATGR
                     PLCHTNLIPSRGAWLEFETSNRDVISVKIDGRRKIPVSTLLRAIGYSDDLDILNLFEV
                     IDNDPERHYIQSSIDRDPLIKDEISALIDIYSRLRPGDPPNADNARKLINEMFFDPQH
                     YDLGKVGRYKVNRRLELPSREVGENRALTREDIVAIIQRIIMVNNGQDTPDDIDHLGN
                     RRIRTVGELVQNQFRIGLVRLERVARERMSIVNLEMVTPSALVNIRPVVSAVKEFFGG
                     SQLSQFMDQTNPLAEITNKRRLSAMGPGGLSRERAGFDVRDVHYSHYGRICPIETPEG
                     PNIGLIGSLATYSRINRYGFVETPYRKVYSKLKNNDKKLVGLKLKTEISEKGKVLAAA
                     GSTISEDSFKIISKLPECDISVMPFVSAEVKYMPADEEDRYIIAQANTRLDEKGYFLD
                     DRIEARSAERYVVEPPDKIDYMDVSPKQIFSVAASLIPFLEHDDANRALMGANMQRQA
                     VPLLRAEAPMVATGMEREAARYSGQVIFAKHAGVASSVTSEKIIIRTAEGGHDEYLLK
                     KFVRTNQGTCINQHAIINKGQKIAAGQVLADSSATENGELALGQNCVVAFMSWQGFNY
                     EDAIILSERLVREDAFTSIHITKHELEARDTKLGVEEITRDIPNVGEESLRELDEDGI
                     IRIGAEVGPDDILVGKITPKGETELSAEEKLLRAIFGEKAREVKDTSLRMPHGEWGKV
                     INVRIFSRDSGDDLPARVNKWVQVWVAQKRKVSVGDKLAGRHGNKGVISIIAPVEDMP
                     YLPDGTPVDVVLNPIGVPSRMNLGQILETHLGWAGHLLGFRVATPVFDGADDTVIEDA
                     LARSWLSAKAGAIDMSPENKRPSADAHKAIEWIKQQGFDGKKIFDEKHPGLAKEVSLK
                     LWLKDMGVDASALSGAELEKKAYDVSSQSRLPSPIVGKSVLRDGRTGETFDQPVTVGN
                     MYILKLIHLVEDKVHARATGPYSLISQQPLGGKAQFGGQRFGEMEVWAMYAYGTAHNL
                     QEMLTIKSDDIAGRAKAYESIVKGEDVLQPGVPESFKVLVKELQSLGLAVEVINEEVK
                     IAPSEKVSSLNEGNLPASDEISAEILPETLYANTEDISEDSMMSVIDADDQDLVVSSN
                     DEEVSENDERS"
     gene            567289..571176
                     /locus_tag="DEHABAV1_RS03035"
                     /old_locus_tag="DehaBAV1_0579"
     CDS             567289..571176
                     /locus_tag="DEHABAV1_RS03035"
                     /old_locus_tag="DehaBAV1_0579"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_015407642.1"
                     /db_xref="GI:505220540"
                     /translation="MNEVNDFDAIRISLASPDQIRSWSYGEVTKPETINYRTLKPERD
                     GLFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIARAKVRRERMGHIELACPVG
                     HIWFTRGIPSRVGLLLNLSTRSLERIIYYSHFIITAVNDEARAKAIKDLEVISSQRVA
                     DKGSEVDTRVAQMEAEDATVEAINQIRRDFSTEREQMEEDIQLLIDQLKDLQKGNLLT
                     ENQYYELKQRFSNVFEASMGAEALLKLLSYIDMDKERSKLIQETRSTSGQRRKKAGKQ
                     LQLVEAFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNR
                     LQHLMEIGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDHKAKSLSDLLRGKQG
                     RFRQNLLGKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFVMHRLVRDGLAPNI
                     KSARRLVERARPEVYDILEEVVKDRPVLLNRAPTLHRLSIQAFEPVLIDGSALRLHPL
                     VCSAFNADFDGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPVVSPSLDMVFGC
                     YYLTTTRPGAKGEGKIFGDFEEAKRYYEMGIIDLRAIIKVRDGKGNMLETTTGRIIFN
                     DVLPKAVEFQNMDIPKSAIKKIIGRCYKILSSQDMAVMLDKIKELGFKFATSSGISIA
                     MSDISVPREKTKLVAAADERTAIAEGQFARGLITEDERYNSIIETWMETTDRITDAIQ
                     AGFDKQGSVYMMANSGAKGNISQIRQMAGLRGLMTNPSGRIIDFPIKSSLREGLTALE
                     YFISTHGARKGLADTALRTSGSGYLTRRLIDVTQDVIILQEDCGTANGTWIIEPKEKG
                     MLPPLVDRILGRWTAHNVVHPQTGEIIVDNNEEIDEIKAKAIGEAGITEVFVRSPLTC
                     ESTHGMCRRCYGRDLGRVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGVVGVDIT
                     TGLPRVEELFEARPPKVQSIISEIDGVVEVIENENGRHIRIASDEVYQDEYELPSGWK
                     TQVQSRQWVDSGMVLASPELEGKSKAVVQSDQNVVARVAGEVTIEGNLITIKYSESEE
                     REYTIPAAMQIKVKTGDTIRAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYYS
                     QGVHINDKHIEVIARQMLIKVRIDSSGDTDLVPGELVDKFRYEDINAKVLAEGGEPAT
                     AHTVLMGITRASLSTESWLAAASFQETTRVLTDAAIYGRVDKLSGLKENVIIGKLIPA
                     QCKSCKEATIERAERIAAAASAPAMSGLPENCL"
     gene            571383..572432
                     /locus_tag="DEHABAV1_RS03040"
                     /old_locus_tag="DehaBAV1_0580"
     CDS             571383..572432
                     /locus_tag="DEHABAV1_RS03040"
                     /old_locus_tag="DehaBAV1_0580"
                     /EC_number="3.1.22.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZWZ9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holliday junction ATP-dependent DNA helicase
                     RuvB"
                     /protein_id="WP_011309119.1"
                     /db_xref="GI:499628385"
                     /translation="MSQEKERLISGKLVTDDAKLDTSLRPRCLPDFIGQKRLKDNLGV
                     AIQAAKQRGEALDHVLLYGPPGLGKTTLSHIIALEMGVNIRITSGPAIERQGDLAAIL
                     TNLKPFDILFIDEIHRLSRNVEEVLYPAMEDYALDIMVGKGPGARSLRLKLPHFTLIG
                     ATTRYAMLSAPLRDRFGSIFRLDFYDEEAIHDIVRRSARILGVEADENGLHQIACRSR
                     GTPRVANRLLRRVRDYAQVKGNGLITADIAAESLACLEVDKLGLDEIDHKVLKTIIHK
                     FGGGPVGLETIAAAISEEADTIMDVYEPYLLQLGFLERTPRGRQATRLAYQHLSIPYQ
                     NDKNNQQGLWTENGS"
     gene            572422..572970
                     /locus_tag="DEHABAV1_RS03045"
                     /old_locus_tag="DehaBAV1_0581"
     CDS             572422..572970
                     /locus_tag="DEHABAV1_RS03045"
                     /old_locus_tag="DehaBAV1_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309120.1"
                     /db_xref="GI:499628386"
                     /translation="MAAKLLLHGCCAHCTAYSFKYWQEQGFEVSVYWYNPNIHPFTEH
                     QNRLEAMVKLSQELSFELVTEPLYQMAEYFKKVAEKPDERCRTCFDMRLGQTAVYAAR
                     YGYEYFSSSLFISPHQKHQEAVFSAEAFAKETGVKFAYADLRKRYSDSRHITKPLDLY
                     RQQYCGCIYSEYERFGKTDPPA"
     gene            573047..573688
                     /locus_tag="DEHABAV1_RS03050"
                     /old_locus_tag="DehaBAV1_0582"
     CDS             573047..573688
                     /locus_tag="DEHABAV1_RS03050"
                     /old_locus_tag="DehaBAV1_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_011928947.1"
                     /db_xref="GI:500357562"
                     /translation="MVYFIRPIKDEDIPELNQIDREAFPTMWPATNFKREMENIMAHY
                     MVLVDGDSSNQAGPKTNINIWKWLWNCIYHDSTILQPVADHPKVIGYGAIWVMAGSAH
                     LVSVAVREAYRRKGFGELLLISSLKEAIKHKCFEMTLEVRVSNIVAQNLYLKYGFAIK
                     GIRKKYYLDNHEDALIMTLDSIDSPDFPAKLEGYKNSHTRKWKTTPGMAELAS"
     gene            complement(573705..573932)
                     /locus_tag="DEHABAV1_RS03055"
                     /old_locus_tag="DehaBAV1_0583"
     CDS             complement(573705..573932)
                     /locus_tag="DEHABAV1_RS03055"
                     /old_locus_tag="DehaBAV1_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309122.1"
                     /db_xref="GI:499628388"
                     /translation="MMAKIPCPDCGVIGSFSLADEVYEGPYKCWKCRKLYKILIERGA
                     VKLCEPIDEMEFERLKSLGDLKRKSRGGDEE"
     gene            complement(573997..574536)
                     /locus_tag="DEHABAV1_RS03060"
                     /old_locus_tag="DehaBAV1_0584"
     CDS             complement(573997..574536)
                     /locus_tag="DEHABAV1_RS03060"
                     /old_locus_tag="DehaBAV1_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011309123.1"
                     /db_xref="GI:499628389"
                     /translation="MASNSCERGSRPSMIIPTLILAVIAVVVSIIAYNKNGAHVEGFK
                     AAWDIFIQVLPMMVLAFVIAGMLRVIIPEETVSQWLGQESGFKGVLIGTAVGGLMPGG
                     PYSCMPIAAGLLGGGAGAGTMVAFMTGWSLLAVNRLPLEIGMLGWKFALIRLAVTALM
                     PLAAGMLANALFSKVNLLE"
     gene            complement(574565..575239)
                     /locus_tag="DEHABAV1_RS03065"
                     /old_locus_tag="DehaBAV1_0585"
     CDS             complement(574565..575239)
                     /locus_tag="DEHABAV1_RS03065"
                     /old_locus_tag="DehaBAV1_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011928948.1"
                     /db_xref="GI:500357563"
                     /translation="MNEQNFTSQSQVFDRIAAGWYSFRHRSIFSRELSALAAKWQTGK
                     LLNAGCGCGADFIPFKDSFELYGIDFSAEMINQAGKYARKHGFKPNLAVADMQNLPFE
                     DAEFDWLIAVASFHHLKGQDSQLKALQEFGRVLEDDGQIFLTVWNRLQPRFWFKGRET
                     LVSWKSQDQILKRYYRLYTCWEIEALVKKAGFRVVSSSGEKSHRGPKYFARNICLLLE
                     KQTLKK"
     gene            575283..576662
                     /locus_tag="DEHABAV1_RS03070"
                     /old_locus_tag="DehaBAV1_0586"
     CDS             575283..576662
                     /locus_tag="DEHABAV1_RS03070"
                     /old_locus_tag="DehaBAV1_0586"
                     /EC_number="2.3.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011928949.1"
                     /db_xref="GI:500357564"
                     /translation="MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPES
                     PAVLRAKSCEYQAYKQVALRLRIIQDMGHPTDKVELIIMGGTFLSADITYQYGFIKDC
                     YDALNGVVAGSLEEAKTINETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGV
                     QMLDDDIYKLVERGHTVADVAEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVF
                     EDPRFCPDGLKLYPTMVVEGTILEQWWKEGRYTPYPNGTMTGLIADIKALVPPYVRIS
                     RVLRDIPAVFISAGLKDSLRDGVRQILESRHQKCRCIRCREYGHRQRKGQTSGEPTLR
                     RLDYPDSGGKEIFLSFEDASDTLYGLLRLRIPCASLPVLGQKYGAKTGLVRELHVYGT
                     ELSLGEQGDQSAQHRGLGRKLLAEAECLARDEFGLDSLAILSGVGAREYYRSLGYELV
                     AGYMCKHLD"
     gene            576878..577816
                     /locus_tag="DEHABAV1_RS03075"
                     /old_locus_tag="DehaBAV1_0587"
     CDS             576878..577816
                     /locus_tag="DEHABAV1_RS03075"
                     /old_locus_tag="DehaBAV1_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl viologen-reducing hydrogenase"
                     /protein_id="WP_011309126.1"
                     /db_xref="GI:499628392"
                     /translation="MVRVAEEWFAVCGGCELSLLDIGEPLLDVLPHLEIVHMPVLMDH
                     KLLGQCGDGKKLEIPEADLGIITGGIRNEENRELALEMRKKCKIIVALGTCACFGGIP
                     ALANLSTTEEMMEQIYSKEKGTEKSDSPSDKSLPKMLDRVYAVDEMIKVDIHLPGCPP
                     TPTHIAELLGAVLEGKSFALPERSVCDTCPTIREKQSTGGPIKRSLQNAQFTPGRYDN
                     MRCLNEQGLFCLGPVTKAGCNRILGADPSEEIPRCIKAYMPCRGCFGPIRQGSNPTAD
                     MMGSLSYIGRDPKEIVDRVATINRFIGSGRLRPQDK"
     gene            577848..579287
                     /locus_tag="DEHABAV1_RS03080"
                     /old_locus_tag="DehaBAV1_0588"
     CDS             577848..579287
                     /locus_tag="DEHABAV1_RS03080"
                     /old_locus_tag="DehaBAV1_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase 3 subunit VhuA"
                     /protein_id="WP_011309127.1"
                     /db_xref="GI:499628393"
                     /translation="MKQITIQPVTRIEGAAKVVISLDDSGNVSDARMHIIELRGFEKF
                     CIGRPVEEMPRITPRICGVCPLSHHLCSAKACDSVFGVTPPSAGRKLRELANATAYLE
                     EHILHFFFLAGADLVMGPGENYSMRNVFGIAQKMPELGQKVIRSRHLASKMLDYLLGK
                     DIHPVAAVAGGFSKPLTETEREKMMEMAKELLEFSKFSIAYAKENLFSKYEGLIKEIG
                     VIKTGFLGTVDKNGALNQYDGNLRLMRPDGKFTEFAPKDYLDHITERVEDWSYAKFPY
                     AKELGEFNMDLDNPSGIFRVNTLARINACDRIATPLAQKELEEFRAKFGRPAQQSLLF
                     NWARLIELLYNAERVIELLSDPEITSTNTRVPVTPKAGRGVGCVEAPRGTLIHDYTTD
                     ENGLVTDANLVVATVMNNAAINMSVKQAAQTLIKGGKYNETILDEIEMVIRAYDPCLS
                     CSTHELNGKVAVRLDIVDANGQLVQTYSN"
     gene            579290..579793
                     /locus_tag="DEHABAV1_RS03085"
                     /old_locus_tag="DehaBAV1_0589"
     CDS             579290..579793
                     /locus_tag="DEHABAV1_RS03085"
                     /old_locus_tag="DehaBAV1_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HybD peptidase"
                     /protein_id="WP_011309128.1"
                     /db_xref="GI:499628394"
                     /translation="MDYLPEYCSRPVVVFGCGNILYGDDGFGPAVADYLNTHSRVPSF
                     ACVMDVGTAIRELLFNIIISDTKPKVIVLVDAMETGLGVGEMGLLTVDQVSPEKINDF
                     SLHLMPTLNMLKELHADGGVRIDVLAVKPEYIPPEMEQGLTGKVQKAVAETARYIVDT
                     YFSQPLL"
     gene            complement(579790..580095)
                     /locus_tag="DEHABAV1_RS03090"
                     /old_locus_tag="DehaBAV1_0590"
     CDS             complement(579790..580095)
                     /locus_tag="DEHABAV1_RS03090"
                     /old_locus_tag="DehaBAV1_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309129.1"
                     /db_xref="GI:499628395"
                     /translation="MTDILNEASNIAQCKECPWYRACTTPMRYTSEDIRRQVQNGGPG
                     MNAPQDEAAMQQMLSMASAAQNSMLEACPIFIERLRNNPKLGQKLKEMMQNWSQEIN"
     gene            complement(580113..580652)
                     /locus_tag="DEHABAV1_RS03095"
                     /old_locus_tag="DehaBAV1_0591"
     CDS             complement(580113..580652)
                     /locus_tag="DEHABAV1_RS03095"
                     /old_locus_tag="DehaBAV1_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="WP_011928950.1"
                     /db_xref="GI:500357565"
                     /translation="MKSKFIALSFLLLSSLCLSACSQTTPVPADNGEQPVAGIKINNL
                     APDFSLKNLTGQEIRLSNLQGSGVILNFWKISCSYCKQEMPFFEAAYLKNKTLPSGIK
                     ILMVNITENKSLIEQFLKDNRFTFPVLLDTTGATGQTYNANYIPITYFINAEGIIKAI
                     KFGAFSSQTDFDNQLNKIN"
     gene            complement(580654..581376)
                     /locus_tag="DEHABAV1_RS03100"
                     /old_locus_tag="DehaBAV1_0592"
     CDS             complement(580654..581376)
                     /locus_tag="DEHABAV1_RS03100"
                     /old_locus_tag="DehaBAV1_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcsB"
                     /protein_id="WP_011928951.1"
                     /db_xref="GI:500357566"
                     /translation="MGRCKIGLEDVSYLLALAGGLAAFFSPCVLPMMPIYLASLAGAD
                     ILDAQPNSITSFKALRHSIAFVAGFSLVFTSLGALSGLGGVIINPSDLWVRILSGGML
                     VIFGTYMLLSLRFPSLSFEKHLASQQNLRTGGYIRSFLSGAVFTLAWTPCISPMLGSI
                     LSITFGGESPLYGSALLAVFSLGMGIPFVLLGLLIQKTLPLVHKISRYSAAIYGASGV
                     ILIFIGILILGNRIGFFSTLQI"
     gene            581439..582578
                     /locus_tag="DEHABAV1_RS03105"
                     /old_locus_tag="DehaBAV1_0593"
     CDS             581439..582578
                     /locus_tag="DEHABAV1_RS03105"
                     /old_locus_tag="DehaBAV1_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease"
                     /protein_id="WP_011928952.1"
                     /db_xref="GI:500357567"
                     /translation="MRPLSYSQIDQYQSCPLKYRFLYIDGLKPLEKGYFSFGTTLHDC
                     AEHFFRVKVPPPLSLEKLMEYYQSHWRSGGYESVEIEENYRQLGREILAEFHRIHRAD
                     FHMPLAVEHQYTVNLDGVKLTGKIDRVDKLPSGELCIVDYKSNKDLFSAEYVQDNLQL
                     SLYQLAVEQIWYLPVGELCLYHLRSNTAMRCPARSKEVIADARRLVLEVAEKIEKAIF
                     PACENNFCPCDFAHLCPLYRHKYAPPPQLPEASPIDIPLAVEEYVMLQFRKNEIEARI
                     ESLKEAIIEYCRASSLGRVFGSEHALSYKEVSRSGYNNQAVHDLLEPLGLWDKVSELD
                     KTLLEKYLETDACGKELKDRILALKEVVSTSPRLYVKQVSKDKDS"
     gene            582599..583087
                     /locus_tag="DEHABAV1_RS03110"
                     /old_locus_tag="DehaBAV1_0594"
     CDS             582599..583087
                     /locus_tag="DEHABAV1_RS03110"
                     /old_locus_tag="DehaBAV1_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928953.1"
                     /db_xref="GI:500357568"
                     /translation="MFFQIIGVFLLALVEIWLAIPIGLIWGLDPWLVILLVIGGTLVG
                     VGIIILLAERVRSGSNRWLDKNRTGDATLSLSSLFAQIISALQERLHSGRLYKVWLKY
                     GIIGLGILSPVLTSAPIAAFLGVMLSADRLKLFIWISVGVAVWTTGLTLAMHFGLILL
                     GI"
     gene            583285..584034
                     /locus_tag="DEHABAV1_RS03115"
                     /old_locus_tag="DehaBAV1_0595"
     CDS             583285..584034
                     /locus_tag="DEHABAV1_RS03115"
                     /old_locus_tag="DehaBAV1_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011309134.1"
                     /db_xref="GI:499628400"
                     /translation="MKVYHLAYEPSYHSMDFHFWTECNLKCRGCYTNYEVYDFGLLDD
                     PVAEIITRERQSPPTEFLSFDQVMEKIDGYTIKYAVFLGTEAVLDPELPKLAKAVHEK
                     YGSFNILLTNGIRMPDLTDIDQIIFSLKAYSEDIYRDYTSRSNKSALENLKKIHAGLG
                     DRKLHVEVVYIPDYIAKDEIEKVAQFLASIDKDMSFRIDAYFPIPGCPWRAANKEEVE
                     EAAVVARKYLNNVVVLTLDMKRIGDKAVKVF"
     gene            584035..585834
                     /locus_tag="DEHABAV1_RS03120"
                     /old_locus_tag="DehaBAV1_0596"
     CDS             584035..585834
                     /locus_tag="DEHABAV1_RS03120"
                     /old_locus_tag="DehaBAV1_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase"
                     /protein_id="WP_011928954.1"
                     /db_xref="GI:500357569"
                     /translation="MTVGFGRQSIPANVRLSTTAKRVLEKRYLKKDDSGRVIETPEDM
                     FHRVAKVMASAEHKYAPGTDTSRIEEEFYQAMSRLEFLPNSPTLLNAGRQAGQLSACF
                     VLPVEDSIESIFDAVKQTALIHKSGGGTGFSFSDLRPAGDKVGELTEVAGGPVSVINI
                     FAAAADYVRQGGVRRGCNTAILDVTHPDILNFISCKGDPNALTNFYISVVVTRDFMTK
                     VRSGEDYDIINPHTGEVVRRLNAACVFDCIVDQAWKTGDPGLVFIDRINDDNPTPSIA
                     PIRHVSGCGEQTLLPYESCNLGSISLPRMLKRDGERVVVDYEKLGRTVKMAIRFLDNV
                     IDVNKFPTPEIEKATLRNRKIGLGVMGFADMLVLMGIPYNSEEAIFQADQIMDFIKET
                     SHRASSKLAEVRGSFPAYEGSMYDVPGGRPMRNATCTSIAPTGTLSIIAGVSSGIEPS
                     FAMVFVRNILDGENLLEINPYFEEMARREGFHSRELFEKLVSSNHLHDMECIPDWLKR
                     LLVTAHCIRPEWHIRIQAAFQKYTDNAVSKTVNFPHEATRADMANVFNMAYDQGLKGI
                     TVYRDGSRAAQPLCTSESGVKLVDQYLDNCACH"
     gene            complement(585831..586835)
                     /locus_tag="DEHABAV1_RS03125"
                     /old_locus_tag="DehaBAV1_0597"
     CDS             complement(585831..586835)
                     /locus_tag="DEHABAV1_RS03125"
                     /old_locus_tag="DehaBAV1_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011928955.1"
                     /db_xref="GI:500357570"
                     /translation="MITKSETVLTVDDEDTIRRLLYQKITSEGYKCLTASNATEAMEI
                     VKNHDIALAILDIKMPGLSGMDILPEIRIVSPDTAVIMATAISDTDTAINCMKLGAYD
                     YVTKPFKLDAVIMGMERALEKRRLILENRDYQEHLELKIKDQAEKIRGSFFNAITSLA
                     YALEAKDSYTIGHSQRVAETSVAIAGAMELPFATVEQIRLAGLVHDIGKIGIRSACLN
                     KAGNLTEDEYNHIKTHPSVGERILSPITEDHEILKIVRHHHEHFNGRGYPDGLKGEEI
                     PLGARIMALADAYDAMTSLRPYRKAMTDIEAWEELKRCSGIQFDPEIVAVFARMNNHT
                     "
     gene            complement(586865..589423)
                     /locus_tag="DEHABAV1_RS03130"
                     /old_locus_tag="DehaBAV1_0598"
     CDS             complement(586865..589423)
                     /locus_tag="DEHABAV1_RS03130"
                     /old_locus_tag="DehaBAV1_0598"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011928956.1"
                     /db_xref="GI:500357571"
                     /translation="MQDQYRSCHTSARQNVLPESADLTEILSMIESTRNLVLIFKTSP
                     EPQLIYVSSNSASISGYSPEDYLANPTLSQDILKPIGLELNTHTLDRFRIPLGPIPCY
                     IPCKKGLPVSAEILCKLSSGRLIFYIQCQHQVRHNANHPDFSDKNLPATPLVMGFQPD
                     GKLIFANHIFEEVTGYLVSEVTGEDWKSCGLFSRETTDLIIKMFQDRKPDTGQPFELQ
                     LIHKNGQTCWFSGHSRIINRDNKSSYLQLSASDITICKKSEKMLRLTRFALEQTTDAI
                     FWTDSEGNFVDVNQSACNSLGYRREDLLKLKVTDIDALITNQTDWEAHWKNLKNSAYL
                     SFESIHRNISGEEIPVEITANYMQCDKMEYNVAIARNIHLRKEAEKQLKFTSFSVEHT
                     ADSVLWVNQSGSIIAANMSACQSLGYTRTELCSLNVININPVCVAERWKTLWVRLKQD
                     INFSLESDMFTKNGQQIPIEVMCNFLEFEGIDYCCAVLRDITERKKVDARLLRAAEEW
                     RITFDNISDIVFLLDNDFNIQRANRAFTKTLNCQPQDVLNKKCYQVLHHADCPKVNCP
                     KLIASDTKKSQRIAYFEKNIDKHFEETIDPILDTNGLSMGTVHTIKDVTEQHKITAQL
                     MITDRLASLGELSAGLAHELNNPLTSVIGFSELIQEKILPEDLRQDIQIISQEAQRAA
                     EIIRNLLTFARRHEPSKDWVDMNQIIHKVLAICNYGQKVHNIQLITNLDPNLPEIKAD
                     YFQMQQVLLNIVINAEYFMTQSHGEGTIVISSRKFNDSIQISIRDDGPGMSENVLNHI
                     FDPFFTTKEVGKGTGLGLSIGHGIITQHGGKLYAESSEGKGATFFIEIPINQPD"
     gene            complement(589599..589931)
                     /locus_tag="DEHABAV1_RS03135"
                     /old_locus_tag="DehaBAV1_0599"
     CDS             complement(589599..589931)
                     /locus_tag="DEHABAV1_RS03135"
                     /old_locus_tag="DehaBAV1_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015407652.1"
                     /db_xref="GI:505220550"
                     /translation="MNDIENTDIFECRRCGNCCLHFQPHLEMAEAQNIADHLSLSLDE
                     FKAKYADKRWPGHRTMLIRHNQNGCIFMGHGVDNLSLCTIHDFKPQACRDYQPSFKHR
                     ECREGLLP"
     gene            590013..591278
                     /locus_tag="DEHABAV1_RS03140"
                     /old_locus_tag="DehaBAV1_0600"
     CDS             590013..591278
                     /locus_tag="DEHABAV1_RS03140"
                     /old_locus_tag="DehaBAV1_0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928958.1"
                     /db_xref="GI:500357573"
                     /translation="MKMKKDYIIRLIATLVISGVLFFGSATVNKAALEGQLYFSDVII
                     KVGTKLTVYGQNFLRQSNVKLFYDDQEVALGATNQLGEFTLSFIIPPSGRGLHAVKAI
                     DADYNMGSGLVLMESWIELSKNEAAIGETVNIRGTGFTPLTSVSFYYSDTPLIVTPSI
                     VKADLTGSFSVNFAVPERFAGVYLVEVRQGDYINSQSLKANVWLDINPEIGLGKALDV
                     GTELNIHGKGFKPNGQVDLRYDGVSLLVVNIDDKGIFSAQIVIPAGAGISHSLTLDDG
                     QNRIVREVWLENTSPSAPVITLPASGEALSYPFTFGWEGVNDASGVEYVFQIASDSGF
                     GSILLEIKGIKVSQYILTDNEDINNSPAASFYWRVKAVDGAGNESGWSETGVFDKASL
                     VQNLGLVVGVGAGLVAIILFMWWAIRNRR"
     gene            591420..592739
                     /locus_tag="DEHABAV1_RS03145"
                     /old_locus_tag="DehaBAV1_0601"
     CDS             591420..592739
                     /locus_tag="DEHABAV1_RS03145"
                     /old_locus_tag="DehaBAV1_0601"
                     /EC_number="5.4.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine 2,3-aminomutase"
                     /protein_id="WP_011928959.1"
                     /db_xref="GI:500357574"
                     /translation="MTNTEKIKNKQSDDPLGAGTIENCGKVDDEPPSRPDQTKRFRLK
                     YFPKVSDQDWNDWHWQFKNRVTSVAEIARFFHLSAEEYRDMDTVSAVFPLSATPYYLS
                     LVDFDNVNDPVKLQLIPDTAELCFDAHCCSDPLEEAHSSVVPGLVHRYPDRVVMVLTD
                     ICPVLCRHCTRKREWKNGGWVHTQAEIDAMLAYIRQNQAIRDVIISGGDPLTLSTSRL
                     ESVLSALRSIPHVEIIRIGTRYPVVLPQRIDDELCSMLSKYGPIWLNTHYNHPNEITD
                     ESRQACDRLVRAGVPVNNQSVLLKGINDSLPVQKALCHKLLMSKVRPYYLFQCDNVQG
                     TEHFHTPIETGVGIIEGLRGYTSGLAVPNYVIDLPGGGGKITIQPDYVLDKQADEYII
                     RNYKGEIIRFKNPGGHKVFSNTGSTGTVKTAAKINGETDANRVVIRS"
     gene            592711..593727
                     /locus_tag="DEHABAV1_RS03150"
                     /old_locus_tag="DehaBAV1_0602"
     CDS             592711..593727
                     /locus_tag="DEHABAV1_RS03150"
                     /old_locus_tag="DehaBAV1_0602"
                     /EC_number="6.3.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="WP_011928960.1"
                     /db_xref="GI:500357575"
                     /translation="MRIGLSYDLKLALTPVTGGPDDALEEYDSPETVEAITNALTAAG
                     HAVYRLGGGKEFLRKVQEQKLDLVFNISEGLGNYRSREAQIPGVLEMLDIPYTGSDPQ
                     TLAICLDKPLTKKLVAGAGVKTAKWQLVSNCEELSTIDWSDFPLPAFLKPACEGSSKG
                     VRFASRAESTDEIMRMATELLTTYNQPVLVEEFINGDEITVGVIGNDKPKVLGIMRIV
                     PKTKADYFVYSIEIKRNWRQMVEYEVPAALPAKTLARIEKATLDAYRVLECHDLCRMD
                     FRVSPDGTPYFLEVNPLPGLNPVSGDLPIMASKLGISHADLALEILNTAIARHNLVAA
                     DCLA"
     gene            593858..594289
                     /locus_tag="DEHABAV1_RS03155"
                     /old_locus_tag="DehaBAV1_0603"
     CDS             593858..594289
                     /locus_tag="DEHABAV1_RS03155"
                     /old_locus_tag="DehaBAV1_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_011928961.1"
                     /db_xref="GI:500357576"
                     /translation="MTTIQSRIRQNKYKITPQRQAVLKVLSAAIQPLSPAEVHKLVQA
                     DKPATGMATVYRSLQLLAELGLICELHTAGNCHRYLLKRIDSHHHHLICSGCGQVVHV
                     EGCGLKEITENLSRQTGFAIDTHLLEFIGRCRNCQKGIGKV"
     gene            594286..595158
                     /locus_tag="DEHABAV1_RS03160"
                     /old_locus_tag="DehaBAV1_0604"
     CDS             594286..595158
                     /locus_tag="DEHABAV1_RS03160"
                     /old_locus_tag="DehaBAV1_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_011928962.1"
                     /db_xref="GI:500357577"
                     /translation="MKFRTLFLSLILGVTLLSSLLLAGCQEETPSTAKLKIAVSIVPL
                     KEFTQQIAGDKAEVVLMVPPGAEPHTYQPLPSQMVDVSQADMYVKLGSDFGFEQNWLS
                     KILSLNHSMLVVDSSVNITLESGSEGDGADPHIWLSPRNAIQMVKNITLGLMSLDPEN
                     QSYYAANRDAYLAKLEQLDNEITLAFSNLYNRTFLVFHPAWVYFARDYNLKELSIEIE
                     GKEPTPQQMIEIINMAIQNNISIVFASPQFSSRSAEAIASEIDGRVVMIDPLAEDYIT
                     NMEFVYKQMQEVMS"
     gene            595161..595925
                     /locus_tag="DEHABAV1_RS03165"
                     /old_locus_tag="DehaBAV1_0605"
     CDS             595161..595925
                     /locus_tag="DEHABAV1_RS03165"
                     /old_locus_tag="DehaBAV1_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter ATP-binding protein"
                     /protein_id="WP_011928963.1"
                     /db_xref="GI:500357578"
                     /translation="MPVVPALVFKGVTASFDGLAVLEDITFSQPTGRMLGIIGPNGGG
                     KTTLLKLILGLIQPDCGTIKVLGKSPEDARPEIGYVSQYHLFDRDFPISVLEVVLMGR
                     YSKRGLAHSYRKEDVALAEEYLDKVGMLPFINRQIGQLSGGQQKRVFIARALVNQPKL
                     LILDEPTAGVDVAMQTGLYELLESLKKDMTIIMVTHDISAVAVCIDDIACLNKHLSYH
                     HAEEGLTAEDLAETYNCPIQLIAHGQVPHRVLKEHE"
     gene            595922..596767
                     /locus_tag="DEHABAV1_RS03170"
                     /old_locus_tag="DehaBAV1_0606"
     CDS             595922..596767
                     /locus_tag="DEHABAV1_RS03170"
                     /old_locus_tag="DehaBAV1_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011928964.1"
                     /db_xref="GI:500357579"
                     /translation="MIEALGYGFIQNAIWAGLLAAIGCGIIGSYVVVKKLASISGGIA
                     HASFGGIGLGYLLGINPVLGALAFSLLAAASMGTLTRRSRISEDTIIGMLWAFGMALG
                     IIFIGLTPGYAPDLFSYLFGNILTVPSSDLVLMLVLDALIIGVVWFFYKEFLGVSFDE
                     EFCRVSGMPTGLLYVIMLGLIALTVVMLIRVVGIILVIALLTIPAAVARRFTDSLLKM
                     MGLSIGFGVVFCLGGLWLSYILDFASGATIILFSVAVFLAVLAFKGKKKQEPASDKTG
                     CINHE"
     gene            complement(596791..597141)
                     /locus_tag="DEHABAV1_RS03175"
                     /old_locus_tag="DehaBAV1_0607"
     CDS             complement(596791..597141)
                     /locus_tag="DEHABAV1_RS03175"
                     /old_locus_tag="DehaBAV1_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309146.1"
                     /db_xref="GI:499628412"
                     /translation="MELDEFLKQSAVDYTSRQIILLFSKHPFARFDRSAIASTIEDGS
                     DILPTLQSLVSSGIIKLCQKGGAELYCLTSEPALRDMVTRLGNMEWKQQQNFSRRKLI
                     GLNVFPQTRPLGTH"
     gene            complement(597257..598387)
                     /locus_tag="DEHABAV1_RS03180"
                     /old_locus_tag="DehaBAV1_0608"
     CDS             complement(597257..598387)
                     /locus_tag="DEHABAV1_RS03180"
                     /old_locus_tag="DehaBAV1_0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_011928965.1"
                     /db_xref="GI:500357580"
                     /translation="MSKKVYVPSGAKIKVIGCGGAGSNAVTRMVRDNIQGVEFIAVNT
                     DAQHLAITEAATRIQIGERCTRGLGAGGNHTMGKAAAEESLSELKENIIGADMVFVTA
                     GMGGGTGTGSAPVVAKIAKESGALTIAVCTKPFCFEGAHRMQTAEEGINNIVDSVDTL
                     IIIPNDRLLDMVDQKTGVDGAFKLADEVLCNGVKAIAEVITVPGIINLDFADVKAVMK
                     DAGPAWMSIGKGAGQNRAADAARAALASPLLDIAVDGAMGVIYNVCGGDDLSLMEVNS
                     AADVIRQAVDPQANIIFGVSTDPRMGKEVQITLIATGFATKESMLSNNHEKEMTRMMK
                     GLRSKTQEELEVPSFMRYRSAQPSIRKPAPAAHQAPPRFLSR"
     gene            complement(598420..599622)
                     /locus_tag="DEHABAV1_RS03185"
                     /old_locus_tag="DehaBAV1_0609"
     CDS             complement(598420..599622)
                     /locus_tag="DEHABAV1_RS03185"
                     /old_locus_tag="DehaBAV1_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_011309148.1"
                     /db_xref="GI:499628414"
                     /translation="MKRRQIAAIDVGTSKICTVMADTENGDLRILGVGVVPSRGLQKG
                     MVVNLNEAKEAIRESVSMAERTAGYKLKSALIGVTGKHINSKNNRGVISITRNDHLVR
                     QSDLQRAIDIASSITMPQDRKVLHIIPRNYSVDGQEGVSNPVGMHGFRLDVETHIITA
                     ASNSIENLTKCIRAAGVEIDDLVFNPLASAEAALTDEEREKGVILADIGGGTTDIAAF
                     KGNSIYHTSVLPIAGSQVTHDVSVGLGIPFEMAEDIKQRYSSVIPGECNDANFVESGH
                     TFSYPDLCEIVRMRVEELLRLIILELPSDDYSKMVPSGLVITGGTANLPGIAELGSEV
                     LRLPVRVGTPPNLFGVSDILNDPACTNVVGMLLWSINNRDASKSHPTTEESAKGGFIS
                     RMFGNPKN"
     gene            complement(599680..599889)
                     /locus_tag="DEHABAV1_RS03190"
                     /old_locus_tag="DehaBAV1_0610"
     CDS             complement(599680..599889)
                     /locus_tag="DEHABAV1_RS03190"
                     /old_locus_tag="DehaBAV1_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928966.1"
                     /db_xref="GI:500357581"
                     /translation="MGTAIEYQKLMTEIVHINLPGPAEPMPGMSGGELLHGFLAELYR
                     APSTDSKAFIESLSGKWNVHFRHVK"
     gene            600128..600817
                     /locus_tag="DEHABAV1_RS03195"
                     /old_locus_tag="DehaBAV1_0611"
     CDS             600128..600817
                     /locus_tag="DEHABAV1_RS03195"
                     /old_locus_tag="DehaBAV1_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928967.1"
                     /db_xref="GI:500357582"
                     /translation="MANLKGSKPLPPYVSYRTFLNFLLGLQEAIPSRLDRSFWGDKWS
                     GSTGTQLMSALRFLGLADAEGMPREKLRRLVDARGEDRTLILRQITLEGYQFVFNSSA
                     DPESLTYAQLEELFHNSFKVADDVVRKCIKFFLGLAEDADISISPFVTKKSRAGRSGT
                     GTKKIQRKIIPRTASHVLIPDNTMKVPDNSDMDRVLLGKFPTFDPAWTDEVKVKWFEA
                     FDVLLKKVSKA"
     gene            600974..601837
                     /locus_tag="DEHABAV1_RS03200"
                     /old_locus_tag="DehaBAV1_0612"
     CDS             600974..601837
                     /locus_tag="DEHABAV1_RS03200"
                     /old_locus_tag="DehaBAV1_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_011928968.1"
                     /db_xref="GI:500357583"
                     /translation="MYFKRILITLDGTKTAEKTLPVAELMASYPETELLLVSICDPKP
                     KITDERQKYLDAKSAELRTKGIQANGKMFCGELLPLILKCINENGIDLLCMASHGYTG
                     IKKMVLGSVSEKLIKATNLPVLLVKEGHDPDKAVFANILLPLDGSLFSEACLKQVSDL
                     ARDFKSKLTLLVVIQPPCIPSDRSPSIQPSWDEYYQALLEELKQQAHAYLERLTGELQ
                     ANGIETEFRMEVSDKIPETILSTAEDINASLISFTTHNRSGIEKWYYGSVAAGLIENS
                     SHPMLLWRNSI"
     gene            601891..602520
                     /locus_tag="DEHABAV1_RS03205"
                     /old_locus_tag="DehaBAV1_0613"
     CDS             601891..602520
                     /locus_tag="DEHABAV1_RS03205"
                     /old_locus_tag="DehaBAV1_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="WP_011928969.1"
                     /db_xref="GI:500357584"
                     /translation="MKKIYDLSPEIRPDMISWPGDSCPEITLLHSIKYGSHSNLSRLT
                     MTLHNGSHIDAPYHFFEAGIGASEIPLEILVGDVRVLRFGGVKTITRKMLEHADLKGV
                     TRLILATDNESLWKKPDFDENYTYIDIGAAQYLTEIGIRLLGIDYLSVEDFQGLDGVH
                     KHLLSQGVVILETLQLAGVPEGDYELYCLPLKLGKVDGAPARVILIERD"
     gene            602521..603183
                     /locus_tag="DEHABAV1_RS03210"
                     /old_locus_tag="DehaBAV1_0614"
     CDS             602521..603183
                     /locus_tag="DEHABAV1_RS03210"
                     /old_locus_tag="DehaBAV1_0614"
                     /EC_number="5.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_011928970.1"
                     /db_xref="GI:500357585"
                     /translation="MKDVKVVPAILTDDPAAFESMIKQSEGFAPVAQIDIMDGQFVPS
                     LSIPPEVLGRYKPCFASEIHLMTLNPEEYLTYCKQHGARRVIFHFEATPRPEYVISRI
                     KEMGFKVGLAVNPETSVAEFAYLVPQVDMVLFMSVIPGFYGAPFIPEVLLKVKEFKRR
                     FPETEIGLDGGAKQANIPEIVAAGVNDICVGSAIFRQSDPQSSYLYLDKLAKNSAKEA
                     GL"
     gene            complement(603180..603638)
                     /locus_tag="DEHABAV1_RS03215"
                     /old_locus_tag="DehaBAV1_0615"
     CDS             complement(603180..603638)
                     /locus_tag="DEHABAV1_RS03215"
                     /old_locus_tag="DehaBAV1_0615"
                     /EC_number="5.3.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="WP_011928971.1"
                     /db_xref="GI:500357586"
                     /translation="MSNISIAIGADHGGYDLKTDILPFLNHLGLKVLDLGACTYNSSD
                     DYPDFAQTVARNVACGKTDRGIIICGSGVGACITANKIKGIRAGLCHDVYSAHQGVEH
                     DDMNVLCLGARVIGIEVAKEIISAFLNARFTGEERHKRRLEKLLKVEKEG"
     gene            complement(603631..605631)
                     /locus_tag="DEHABAV1_RS03220"
                     /old_locus_tag="DehaBAV1_0616"
     CDS             complement(603631..605631)
                     /locus_tag="DEHABAV1_RS03220"
                     /old_locus_tag="DehaBAV1_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_011928972.1"
                     /db_xref="GI:500357587"
                     /translation="MSNTKLDSLCINALRFLSVDAVQKANSGHPGAPMGMAAMAYALW
                     QNFLKHNPQDPAWPNRDRFILSAGHASALLYSLLHLTGYDLPLDELKNFRQWGSKTPG
                     HPEYGLTPGVEMTTGPLGQGFASGVGMAMAEAHLAAVFNQPDCKIIDHYTYGIVSDGD
                     LMEGVASEAASLAGHLALGKLIYLYDDNDISIEGSTELAFTENAALRFESYGWQVIDH
                     VDGLDPEAVSQAIKQAQSDTTRPSLIICKTIIGFGSPNKAGKASAHGEPLGTDEVSKS
                     RKSLGWDYEPFVIPVEALTEFREALGKGKTAQQVWLSKLDYYLSHYPEKASLLQDMLS
                     GNLPEDWDKDLDRLFDKAMASREASGLLINALASRLPSLMGGSADLSPSNKTVIKDGG
                     EYEPHYYEGRNIHFGVREHAMGAIANGLALHGGIIPYVATFLIFYDYMRPAVRLASLM
                     GQRVIYIFTHDSIGLGEDGPTHQPIEQLAGLRSVPGLVTIRPADSYETAQAWKTAILR
                     KNGPTAIALSRQKLPLLDNSQTKSLNLPKGAYILQETDSHPQVALVASGSEVTIAVEA
                     AEILKGKGISSRVVSFPSWQLFDNQPQTYRQSVLPSSLPRVIMEAGNSQGWCKYLGTN
                     GTVISIDHFGASAPAPLLYKKFGLTPENMAEKALKLLENEHE"
     gene            complement(605683..606192)
                     /locus_tag="DEHABAV1_RS03225"
                     /old_locus_tag="DehaBAV1_0617"
     CDS             complement(605683..606192)
                     /locus_tag="DEHABAV1_RS03225"
                     /old_locus_tag="DehaBAV1_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_011309155.1"
                     /db_xref="GI:499628421"
                     /translation="MDALEAIFSRRSIRHYQHGDISASELDTLLRAGMAAPSAGNQQV
                     WHFVVIDDRRILDKIPDIHPYSKMLKEAPMAIMVCADQSAETKTGYWIQDCAAATQNI
                     LLAAEALGLGACWLGLHPREERKEAISRLLNLPVSISPLSLIAIGKKGETKPPAKRYL
                     ESHIHKNGW"
     gene            606318..607160
                     /locus_tag="DEHABAV1_RS03230"
                     /old_locus_tag="DehaBAV1_0618"
     CDS             606318..607160
                     /locus_tag="DEHABAV1_RS03230"
                     /old_locus_tag="DehaBAV1_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_011928973.1"
                     /db_xref="GI:500357588"
                     /translation="MFKKLADINTKPELYQQYSAPVLWNDPHISSRMLEFHLNPDIEP
                     ASRKAVFIEKSAGWIKDYFGLGDGKQVCDFGCGPGLYTSRLAATGADVTGIDFSSRSI
                     SYARDFAASHYLDIHYIEQNYLEFATPKQFDLITLIYCDYCALSPSQRCQLLSVWNKC
                     LKDDGNILLDVFSLSAYEGRAETAGYEYRLMDGFWSGNDYFGFINTFKYPLEKVVLDK
                     YTLIEADREWQVFNWLKYFCVAELKHELAEKGFEVADIFSDVAGAVYWAGSPEIAVVA
                     RKIK"
     gene            607302..607931
                     /locus_tag="DEHABAV1_RS03235"
                     /old_locus_tag="DehaBAV1_0619"
     CDS             607302..607931
                     /locus_tag="DEHABAV1_RS03235"
                     /old_locus_tag="DehaBAV1_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928974.1"
                     /db_xref="GI:500357589"
                     /translation="MTKSTRVIPPFPQMTIGVMGSAGGTMTDETKKSLRCLGACIAKR
                     KHVLITGACPGMPHETVLGSKEEGGVVVGISPALNLEEHVEKYHSPTRGYDAIIYTGS
                     GLMGREIENIRSCDVVIFAGGRSGTLGEFAIAYDEGKVIGVLRGSGGIADHLDKIIAM
                     VDKETGARVYYESDPYKLLDMLEAVYRERILPKHKRLLENNDPDGVSDG"
     gene            608130..608345
                     /locus_tag="DEHABAV1_RS03240"
     CDS             608130..608345
                     /locus_tag="DEHABAV1_RS03240"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377696.1"
                     /db_xref="GI:755024747"
                     /translation="MQDRCEAGAVPPAVTGGNTSGSQNLKPRLPGTPRNREDSHFKMA
                     EIPLSDETEVFFCTWQNVDTTKRALEL"
     gene            608537..609550
                     /locus_tag="DEHABAV1_RS03245"
                     /old_locus_tag="DehaBAV1_0620"
     CDS             608537..609550
                     /locus_tag="DEHABAV1_RS03245"
                     /old_locus_tag="DehaBAV1_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011928975.1"
                     /db_xref="GI:500357590"
                     /translation="MLDDINMKLNSKSARLGTTVAGVFLSLVLLLGLVGGCKTADDTN
                     PDDENPVVTEVTYPLTVTDQLGRIVTILSEPQTIVSLSPSNTETIYAMGLEDKLVGVT
                     TYCNYPEAAKDKPKVGGFSNVDAEAVTAIGPDIILASNIHASTVIPQLEQLGLTVIAI
                     SPDNLEDVLASIELIGKCLNQVKKANSLMDSMQTRIDAVTSKVKNLSESQKPRVLYIV
                     WHEPLMSVGSTAFITGLITAVGGVSITADSAESYPTIGLETVLGANPQVVVVGTGMGS
                     GADAPLLFIQDEPRLANIDARINGNIYSINTDLIGRTGPRIVEALEQLAKMLHPEIFG
                     AIS"
     gene            609606..610697
                     /locus_tag="DEHABAV1_RS03250"
                     /old_locus_tag="DehaBAV1_0621"
     CDS             609606..610697
                     /locus_tag="DEHABAV1_RS03250"
                     /old_locus_tag="DehaBAV1_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="corrinoid ABC transporter permease"
                     /protein_id="WP_011309159.1"
                     /db_xref="GI:499628425"
                     /translation="MGVNTNLNKENCPAVPGGLHPHWRGRIFAMAGLFGLLLVAAVFA
                     ISFGSVEVPFFTTIAILISKIPFVHISPDWTVNTQAIIWDIRLPRVLLAGVVGMALAV
                     AGATYQGLFRNPLADPYLIGVAQGAAVGAVLGLILGIGFDVLGIFTTPLFAFAGAFGA
                     VGVVYMLARVGNRLTVTTLILAGVALGSFLTAIVSYLITVSGDKIHSVMFWLMGSFSM
                     AGWESVKIVIPIVIIGTLVILLFARSLNLIQLGEEQAQELGVDVERMKIILLTAATLI
                     TAAAVSFVGIIGFVGIIVPHAIRLIWGADYRFLLPLSALVGAVFMILADIASRTLVAP
                     SEIPVGAITALVGAPFFLYLLRKRTRMLF"
     gene            610709..611536
                     /locus_tag="DEHABAV1_RS03255"
                     /old_locus_tag="DehaBAV1_0622"
     CDS             610709..611536
                     /locus_tag="DEHABAV1_RS03255"
                     /old_locus_tag="DehaBAV1_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="WP_011928976.1"
                     /db_xref="GI:500357591"
                     /translation="MFELEVRDVTLAYGPVDVLKNVSFKTMPGEMIGLVGPNGSGKST
                     LIKSLARVIDPRLGSIYINGRNSRSIPRLELAKMVGVVPQIPVLPSAFTAFEIVLMGR
                     NPHMGTFQYESHKDIAIAWEALARAGVLHLADRQIGELSGGEIQSVVIARSLCQKTEA
                     ILLDEPTSNLDIGRQIEILDLIKSECRERNITVIAALHDLNLAAHYCERLILIDNNGI
                     HADGSPVEVITTNNISRVYGPGSYVHTHPLSGLPAVLPRLGNIRCNANGEKGGTDAH"
     gene            611526..612296
                     /locus_tag="DEHABAV1_RS03260"
                     /old_locus_tag="DehaBAV1_0623"
     CDS             611526..612296
                     /locus_tag="DEHABAV1_RS03260"
                     /old_locus_tag="DehaBAV1_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928977.1"
                     /db_xref="GI:500357592"
                     /translation="MLTEKVNIRTVAEFHGIKAEVIEHEVWGVPANALVVTFPEERRA
                     LSGRQGYRKIKAVCNIYLPDAIWPRLHDDKLSWNGYYRQVFSKALSAIGIPLSKVLVL
                     STGVTMDHLAIHEEKRGDLWVVALATAGVESNALRIGQDKSSGIDRNGRFKPFGTINT
                     IILTSENLSQATLASCFITATEAKTIALDELGVMSAYTPSLKASGTGTDQIVAVSGMG
                     DKATYVGGHTLLGELMGRSVTLAIKEALTKRIASRKGH"
     gene            612299..613225
                     /locus_tag="DEHABAV1_RS03265"
                     /old_locus_tag="DehaBAV1_0624"
     CDS             612299..613225
                     /locus_tag="DEHABAV1_RS03265"
                     /old_locus_tag="DehaBAV1_0624"
                     /EC_number="6.3.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CobD"
                     /protein_id="WP_011928978.1"
                     /db_xref="GI:500357593"
                     /translation="MEILLIFLLALVIDMVFGDPPNAFHPVAYMGKVISLFERAGFKG
                     GKGYQFVYGIVMVIFTMALFFVPVYFLLDWLQGINSIVYIIVSAILFKMCFTVTGLRK
                     AALLIKRLLEKDDIAQARFELRSLVSRDTSKLPQPKLVAAAVESVAESIGDGFVAPLF
                     FFLIFGVPGVMAYRVVSTFDSMVGYRGKYEYLGKFAARFDDVLNFIPARLSALCILVA
                     SFFGRYSPAGAWRIMWRDHGKTQSPNAGWPMATAAGALEVCLEKVGHYSLGDDIRPLL
                     PQTISRSLVLINNAGCIWVLISVGVIYFARIA"
     gene            613209..614315
                     /locus_tag="DEHABAV1_RS03270"
                     /old_locus_tag="DehaBAV1_0625"
     CDS             613209..614315
                     /locus_tag="DEHABAV1_RS03270"
                     /old_locus_tag="DehaBAV1_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_011309163.1"
                     /db_xref="GI:499628429"
                     /translation="MPVLPKPQLEKLKPCYHGGPNYAELKKLGISPDAVMDFSVSSNP
                     YPAPVELKEALSSLVIDRYPDSESAELKEYLAGRLSLKPENLIIGSGSMEVIRLVAGA
                     YFGVGDTVLILKPTFGEYELAVEVAGADIIEQWADEESGFKFDLDLTCRIIKKHQPKA
                     VFICNPNNPTGVYLSKADIEKVLNVCTDTLLVLDEAYIAFAEDCWKSADLLDSDNLIV
                     IRSMTKDCALAGLRLGYGMASAEIIANLKKICPPWNVNAAAQKAGLVCLRHPSYLAES
                     EKKIKASKEYLMQGFIRLGFSVFPSETNFFLLKVRSAADFRSAFLKYGLMVRDCTSFG
                     LPQYVRIAPRTQSECEHLLEVSVELKSKSEIYPA"
     misc_binding    614337..614530
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            complement(614347..614625)
                     /locus_tag="DEHABAV1_RS03275"
     CDS             complement(614347..614625)
                     /locus_tag="DEHABAV1_RS03275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042377699.1"
                     /db_xref="GI:755024750"
                     /translation="MLSLSSSGACPNKKGAGTSQNIFKMSRPLYHQVSGLVVTRLLAS
                     GLSPGFTLPIRVLLQQWLHKKCFKETEVPGHSGGTATDSNRVPFVNHH"
     gene            614688..615746
                     /locus_tag="DEHABAV1_RS03280"
                     /old_locus_tag="DehaBAV1_0626"
     CDS             614688..615746
                     /locus_tag="DEHABAV1_RS03280"
                     /old_locus_tag="DehaBAV1_0626"
                     /EC_number="2.4.2.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="WP_011928979.1"
                     /db_xref="GI:500357595"
                     /translation="MELLNATLAKIYGLDKEAMVKAQAHQDILIKPQGSLGKLEAIVV
                     QLAGIQGDAKPKTAKKAIITMAGDHGIIDEKFHNWPKEVTVQMLQNFAHGGAAINVLS
                     RQVGARNVVVALGVATPMAADPNIINRNIAPGTNNMVHGPAMTREQAVKAIEVGIEIV
                     NAEVKKGLDLVGTGDMGIGNTSPSAAICSVITGRSLEDVTGRGTGASDEQMKLKRNAI
                     AKAISLNNPDAKDAIDVLSKVGGYEIGGLAGVILGAAANRVAVVVDGFISGAAALIAY
                     TICPQVKDFMFAAHQSVEPGHRILLEHMGLDAILKMDMRLGEGTGAALAMNIIEAANR
                     IQHEMASFADAGVSEKQS"
     gene            615786..616550
                     /locus_tag="DEHABAV1_RS03285"
                     /old_locus_tag="DehaBAV1_0627"
     CDS             615786..616550
                     /locus_tag="DEHABAV1_RS03285"
                     /old_locus_tag="DehaBAV1_0627"
                     /EC_number="2.7.8.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin 5'-phosphate synthase"
                     /protein_id="WP_011928980.1"
                     /db_xref="GI:500357596"
                     /translation="MGSFLAAFRFLTNIPVPWLKEDWQGEKPRLDFARSLGFYPLVGL
                     IIGLILVGLGWVFSLFLPDVLTAALLTISLVIITGGLHLDGLTDTFDGIAAGHKSFER
                     AQEVMHLPGVGAIGVLAAICLLLLKFSAVLSLPSESFITGLILFPLISRWAMVYAVVK
                     YPYVRSQGLGKELKGETAKASLWFATIFCLTVCVVLGGWAGFLAMFGSWLMVMYLASF
                     FKRRLGGLNGDTYGSINEFTEVAALVFIVALSGYFS"
     gene            616569..617171
                     /locus_tag="DEHABAV1_RS03290"
                     /old_locus_tag="DehaBAV1_0628"
     CDS             616569..617171
                     /locus_tag="DEHABAV1_RS03290"
                     /old_locus_tag="DehaBAV1_0628"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ribazole-5-phosphate phosphatase"
                     /protein_id="WP_011928981.1"
                     /db_xref="GI:500357597"
                     /translation="MKLIMVRHGETETDNCRRYWGHSDIGLSDCGHAQANSLREYLAS
                     VKIDAIYSSSLKRCMETAETIAYGRPLLVNKNNDLKEIDFGRVEGLTYDDVVERYPDI
                     AQKWAEGSFDVHFPDGESMAHFAQRVIKFAKMLSKHKSDDTLLVVGHGGVFRILICHF
                     LGIEYKHWWQFILGVGSVTVLDIYPEGSILEKLNDNSHLD"
     gene            617224..617790
                     /locus_tag="DEHABAV1_RS03295"
                     /old_locus_tag="DehaBAV1_0629"
     CDS             617224..617790
                     /locus_tag="DEHABAV1_RS03295"
                     /old_locus_tag="DehaBAV1_0629"
                     /EC_number="2.7.1.156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobinamide kinase"
                     /protein_id="WP_011928982.1"
                     /db_xref="GI:500357599"
                     /translation="MNYLLIGGARSGKSSYAEELAKSIGGKVVFVATAEAGDEEMKTR
                     ILRHQQARPAEWGLIEASLQVGEKISAHGSSAGVIILDCITLLVNNIMCKYMLEHGDE
                     LTGEAADYLDAEVKKEINGIINAMKKTGASFIVVTNDVGAGLIPPNAMARIYRDLLGR
                     ANQMLGAYVEYVYLMVAGLPVQVKPLLR"
     gene            complement(617866..618189)
                     /locus_tag="DEHABAV1_RS03300"
                     /old_locus_tag="DehaBAV1_0630"
     CDS             complement(617866..618189)
                     /locus_tag="DEHABAV1_RS03300"
                     /old_locus_tag="DehaBAV1_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_011928983.1"
                     /db_xref="GI:500357624"
                     /translation="MVMELTDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLS
                     TKYAGKFKFCKLNVDENKTTATQYRVMSIPTLLFFKGGQVADMVVGAVPESALSQKID
                     QLIQK"
     gene            complement(618359..619504)
                     /locus_tag="DEHABAV1_RS03305"
                     /old_locus_tag="DehaBAV1_0631"
     CDS             complement(618359..619504)
                     /locus_tag="DEHABAV1_RS03305"
                     /old_locus_tag="DehaBAV1_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011309169.1"
                     /db_xref="GI:499628435"
                     /translation="MKKVFSFLYSQIRRLPRLLANVHIWILVLLFTGGFFLHYPQLLP
                     FIGQIDPDSFLYLTRHSVGRLIMLLPVTYTALVFGLRPGLVSLLLAIAIIIPNIFVTD
                     TVTADDIIEIIGIIIIGLVVNLWLESYETDKKHRQQAYLKMETAQRELQRMQQNLRFY
                     LKQITIAQEDERRRIAQELHDDTAQDLIVISRAIDRFVTKNPNLGEDNLAELEEMQNH
                     INRTLSEVRRFAQDLRPSVLDDLGLIPALEWLIPDLSKHFGINIDIDVNGEIRRFAPE
                     TELVLFRIVQESLRNVGKHAQATKAWVYIDFGKYKATLTVKDNGKGFLLPERVGDLAA
                     LGKLGLTGMQERAQLIGGRLSIQSKPDVGTMVTVAVPNSGNLEDDDV"
     gene            complement(619521..620195)
                     /locus_tag="DEHABAV1_RS03310"
                     /old_locus_tag="DehaBAV1_0632"
     CDS             complement(619521..620195)
                     /locus_tag="DEHABAV1_RS03310"
                     /old_locus_tag="DehaBAV1_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011309170.1"
                     /db_xref="GI:499628436"
                     /translation="MQTTQMIKVLLADDHVIVREGTRELIQRESGMMVVGEASDGVEA
                     VEMSMKVHPDVVVMDIAMPRLNGIEATKQIKQLLPTTAILILTAYESEQYILAILEAG
                     AAGFLLKNVKGTQLLEAIRSVYAGESVLQPSTTRRVIDQLINKAAKTEELSAVNPLTE
                     REIEVLKMAARGVSNKDIADQLYLSNRTIQTHLSNIFKKLSVGSRTEAILYGLKRGWF
                     IMEDLP"
     gene            complement(620265..620909)
                     /locus_tag="DEHABAV1_RS03315"
                     /old_locus_tag="DehaBAV1_0633"
     CDS             complement(620265..620909)
                     /locus_tag="DEHABAV1_RS03315"
                     /old_locus_tag="DehaBAV1_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928984.1"
                     /db_xref="GI:500357882"
                     /translation="MTNPKEVFNLPAQRNFELATKRTLELNRSHFLAVQDFDKISRQA
                     GAVLQPPFIHLKYFRFRVEIDTRNAAVTSPDTSLSPREEALILHYLLKADGTPVSREQ
                     ISFKELPEGANYQPVFYNRVLKSLIALYIANPAKLDLSAISLGGKKAEQADVSFLFQA
                     LPRLPLWLVFWQGDDEFPPEGNIIFDRSISRYLDTEAITEICQNLNRRLTEKTF"
     gene            complement(620941..622287)
                     /locus_tag="DEHABAV1_RS03320"
                     /old_locus_tag="DehaBAV1_0634"
     CDS             complement(620941..622287)
                     /locus_tag="DEHABAV1_RS03320"
                     /old_locus_tag="DehaBAV1_0634"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309172.1"
                     /note="part of a complex that catalyzes the cleavage of
                     acetyl-CoA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthase subunit gamma"
                     /protein_id="WP_011928985.1"
                     /db_xref="GI:500357911"
                     /translation="MSPTGIEIYKFLPRTNCGECGVPTCLAFAMSLASGRAELSSCPY
                     VSEETKLKLEEASAPPVRTVSIGTGIYSFKIGGETVMHRHEKRFEHQSGIALLLSDNL
                     TETEQNAKLTAFNSFQYKRVGAILKPDMLALRADSGSSEKYLKLVKLAAEKCQASLML
                     ICANTTVLDESLKICAERKPLLYAATAENSNEMAELAKKYNCPLVAKAKNLTDLAELT
                     IKLQSLGIKDIVLDSSPASFKQTLADNIAIRRAAILKKFRPLGFPVINFPCLITSDHM
                     KESLFASILTAKYAGILVLSDFRGETLFPLLVARMNLYTDPQRPLATTEGIYEINNPD
                     ANSPVMLTCNFSLTYFIVSGEMETSRVPCYLLIKDTEGLSVMTAWAAGKFGADTIGKF
                     VKNSGIAGKVNHRKLIIPGYASMESGGLEEELSGWEIMVGPREAAHIPAYLKQFKP"
     gene            complement(622308..624509)
                     /locus_tag="DEHABAV1_RS03325"
                     /old_locus_tag="DehaBAV1_0635"
     CDS             complement(622308..624509)
                     /locus_tag="DEHABAV1_RS03325"
                     /old_locus_tag="DehaBAV1_0635"
                     /EC_number="1.2.99.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309173.1"
                     /note="in acetogenic organisms, this enzyme complex
                     converts carbon dioxide to acetyl-CoA while in
                     methanogenic organisms this enzyme is used to degrade
                     acetyl-CoA to form methane and carbon dioxide; part of an
                     enzyme complex; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA decarbonylase"
                     /protein_id="WP_011928986.1"
                     /db_xref="GI:500357940"
                     /translation="MSKTVAEAAIKGARNIVNASYEVYKQTLVTNCPDTAVGFPNTAY
                     FLPVIYGILGIQVEKLSDMGMVFDKCFKMLPPPEVNAEDVTELGAVLEAGLSTLFAEE
                     MLEALRYLSQPEYYTNTEDPTPDNIWLGAADDIILRKRGVEFVDGTAPGFAAIIGAAP
                     DNAAAESIAAELQQKNLYTFMCGESQGKRFAKQLADADVELGWTPRLVSFGDEATAAI
                     FAFGFAVRVALSFGNIEPGNRAKLFEYSQERIKAFIMPLGDISDEWYANAAGALNFGF
                     PIIADKSVLPILPGVESVDSVLAGIPYSRIVSKAMDARGIKVNVTKVPVPVAYGPAYE
                     GERVRGEQIYLECGGGRTQMVELVTTAKMDDVTDGKIELFGQDVSDMPEGSRLPLAIV
                     VEAAGHKMNEDYEPILERQIHHLLNYAQGVMHIGQRDIAWLRIGKSAAAKGFSLKHIG
                     AILHAKLHQDFGGIVDKIQIKLYTTPEKVAEISRQSKKIYTKRDERIEGMTDENTETF
                     YSCTLCQSFAPSHVCIVSPERTGLCGAYNWMDCRASNEINNIGPNQPVNKGAVIDAKL
                     GQWSGINQFVEKTSGGVVSHYNLYSIIYDPMTTCGCCECISAILPLCNGVMTVNREHT
                     GMTPCGMKFTTLAGTIGGGITTPGFLGHSKYNITQRKFISAEDGLLRLVWMPKSLKEE
                     IRERFNARAAELGVPDLLERIADESVGTTEEEILPFLEEKQHPALTLEPLI"
     gene            complement(624569..625510)
                     /locus_tag="DEHABAV1_RS03330"
                     /old_locus_tag="DehaBAV1_0636"
     CDS             complement(624569..625510)
                     /locus_tag="DEHABAV1_RS03330"
                     /old_locus_tag="DehaBAV1_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407666.1"
                     /note="part of a complex that catalyzes the cleavage of
                     acetyl-CoA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthase subunit delta"
                     /protein_id="WP_011309174.1"
                     /db_xref="GI:499628440"
                     /translation="MAFETPKINYSGSIREITLGDGPKSVTVGGETALPFYLFEGDMP
                     RKPKIAMEIQDTPPLDWPADALKPFGDAVNNPVSWAKKCVDTYEAKIICLQLESTDPN
                     GLDRSAEEAAKIVREVANAVDVPLIVWGTANHEKDTEVLRKISEICPDKKLILGPVEE
                     GDYKKIAAQAMAYKHTIIASSPIDINLAKQLNILLGNLGVPANEIIMDPTVSSIGYGI
                     EYAYSVIERIRLAALTQQDERLQYPIICNIGREAWKTKEAKIPETESPELGNTEKRAI
                     MIEAMSAAILLIAGADILVMRHPESMRLVGELMAELG"
     gene            complement(625546..626436)
                     /locus_tag="DEHABAV1_RS03335"
                     /old_locus_tag="DehaBAV1_0637"
     CDS             complement(625546..626436)
                     /locus_tag="DEHABAV1_RS03335"
                     /old_locus_tag="DehaBAV1_0637"
                     /EC_number="3.5.4.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRF1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein FolD"
                     /protein_id="WP_011928987.1"
                     /db_xref="GI:500358110"
                     /translation="MSAHIINGTEIAAAIREEIRSEVIALKAKAGIVPGLATVLVGDD
                     PASHSYVDSKIKMCQNLGIYSEHHPLPQNATIEDLLTLIAKLNADPKISGILVQVPLP
                     AQISESLVLNAINPDKDVDGFHPVNVGRMCLGEPCFLPCTPHGVQELLIRSGIKIEGT
                     HVVIVGRSNLVGKPLANILLQKAPGANATVTICHSGTKNLPEITRQADILVAAMGKPK
                     FITSDMVREGAVVIDVGTTCIGYTPEGKRILSGDVDFEEVKEKAFAITPVPKGVGPMT
                     IIMLMLNTLTAAKRAAGLIK"
     gene            complement(626436..627218)
                     /locus_tag="DEHABAV1_RS03340"
                     /old_locus_tag="DehaBAV1_0638"
     CDS             complement(626436..627218)
                     /locus_tag="DEHABAV1_RS03340"
                     /old_locus_tag="DehaBAV1_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="WP_011928988.1"
                     /db_xref="GI:500358938"
                     /translation="MTYTIALAGKGGVGKTSVSSLIIRQLLKNSLTPILAVDADANAN
                     LGESLGLCVPQTVGGLIASFNKAKLNLPSGITKEAYLEYQLNTTLAESHGLDMISMGR
                     GEGDGCYCYPNTILRSYIDKLSRNYRYVVMDNEAGMEHLSRRTTQNVDHLFIISDHSV
                     KGVRTLGRIRQLIDEMKLNVSRISVIINMVSGTLDPRLGQEIDKLGIAYTDTVPADEM
                     IREFDLKQTPLLKLPDNSPAVQAVAKILSSRLGIKNLTEVSE"
     gene            complement(627215..629137)
                     /locus_tag="DEHABAV1_RS03345"
                     /old_locus_tag="DehaBAV1_0639"
     CDS             complement(627215..629137)
                     /locus_tag="DEHABAV1_RS03345"
                     /old_locus_tag="DehaBAV1_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_011928989.1"
                     /db_xref="GI:500358939"
                     /translation="MTEKKFSVCFEPGHRVINGQKGDSLLDLAIIAGTGLCASCGGEG
                     VCGRCRIKLIEGELECEDHLQISAEEFAQGIRLACQSRLVSNVTVEILAESRFDTAIS
                     GDAISCTLQSRPESVKNKPVLPLRKVFLKLVPPSGADNSSDLGRLKRFLKPFCPTEPD
                     IDYHLLSSLSETLREKNWEITVSLLETPNGVKIINIQPGDQTLTTYAFAFDIGTTGVR
                     GQLLEVTKSQVLAQATEYNGQIPFGEDVISRINYAAREGGLNQLQQAVVNTLNNLGQA
                     MLSECGLEASDIAFATIAANTTITQLLYGLDPKHLRLAPYVPLASELPLISARHINLS
                     ICPQAYIYTLPCVASYVGGDIVAGVISTNIPHREGLVLYIDIGTNGEIVVGNKDFMLT
                     ASCSAGPAFEGGGIKNGMLAKPGAIEDIELGPQSFEPKLSVMGSGNPKGICGAGLINT
                     VSALLNCGLLGQNGKYNTHIKTGRLRKGADGYEYVLAFGREFGQGQDITLSEVDIDNL
                     IRAKAAMYAGYQTLLENAGANFKNLEKVIIAGTFGAKLNIKKAINIGLLPELPEEHFI
                     FVGNGSLAGARLCAFDKNAQTEASAAAKMMTNVELSESVSFMDNYMASMFLPHTKSTD
                     FPEVYAALGKFNGGRI"
     gene            complement(629175..630917)
                     /locus_tag="DEHABAV1_RS03350"
                     /old_locus_tag="DehaBAV1_0640"
     CDS             complement(629175..630917)
                     /locus_tag="DEHABAV1_RS03350"
                     /old_locus_tag="DehaBAV1_0640"
                     /EC_number="6.3.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407668.1"
                     /note="catalyzes the formation of
                     10-formyltetrahydrofolate from formate and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="WP_042377947.1"
                     /db_xref="GI:755025004"
                     /translation="MKDWEIAEKAEDFLKPVKVLAMELGLTEDEIIPHGKYIAKVDFA
                     GVLARLKDRPNGKYIDVTAITPTPLGEGKSTTTMGLVQGLGKLGKKVTGAIRQPSSGP
                     TFNIKGSAAGGGLSQCLPLSPFSLGLTGDIDAVTNSHNLAMVALQARLQHEANNTDEF
                     LSSRHLTRLDIDPSRVEMKWAMDFCAQSLREIIMGIGSKTDGYRMPSGFGISVSSEVM
                     AILSVFTSLSDLRERMGKIIVAYRKNDEPVTTADLEVDGAMTALLLRAVNPNLLQTIE
                     GQPVFVHAGPFANIAIGQSSIVADRLALKLADYHVTESGFGADIGFEKFWNIKCRLSG
                     LKPDCAVIVVTARALKMHGGGPKVTPGTPLDPAYTTPNTKLVEKGCQNMLAHIQTVKT
                     AGINPVVCINHFAADTHEEIDIIRRTAEQAEARVAVSHHWAKGGDGATELAEAVTDAC
                     NEPNNFHFLYPENMPLKKRIETIARKVYGANGVSYTPIAMEKLARIESMGDTQFMPTC
                     MVKTHLSLSHDPALKGRPSGFTLPIRDILTYMGAGLVVPVAGDIKLMPGTSSDPNFRR
                     IDIDTQTGKVKGLF"
     gene            631099..631680
                     /locus_tag="DEHABAV1_RS03355"
                     /old_locus_tag="DehaBAV1_0641"
     CDS             631099..631680
                     /locus_tag="DEHABAV1_RS03355"
                     /old_locus_tag="DehaBAV1_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309179.1"
                     /db_xref="GI:499628445"
                     /translation="MHELLPFYGKRQKSFLKNYMRLASLGRWPLIGALVKKYANHYAR
                     KQHGGYLLNLAEAKDILDMSENIYLGPCSCREVFKNCDAPIMAEIIIGAGRHVYRDTL
                     ENFKPISRVEAMAVITTCQQAGLMTTLVHCKEHFYSICNCCRCCCVPYRLKHQYGIEF
                     ALVRDKNIVTRFAEFLKEEGLHGVPQDIQPDKT"
     gene            631643..631978
                     /locus_tag="DEHABAV1_RS03360"
     CDS             631643..631978
                     /locus_tag="DEHABAV1_RS03360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041219010.1"
                     /db_xref="GI:752547756"
                     /translation="MEYRKTYSRIKPELLFDTLKDLITKQGGHLVSSSSDNYSVMDSS
                     SDFIFKGTMAFSQSKNGSPACASVYVMGSERKDSRVILDIEAGAFGESAIKCLLDEVN
                     FLLGEYEKI"
     gene            632055..633851
                     /locus_tag="DEHABAV1_RS03365"
                     /old_locus_tag="DehaBAV1_0643"
     CDS             632055..633851
                     /locus_tag="DEHABAV1_RS03365"
                     /old_locus_tag="DehaBAV1_0643"
                     /EC_number="6.1.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8K0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate--tRNA(Asp/Asn) ligase"
                     /protein_id="WP_011928991.1"
                     /db_xref="GI:500358941"
                     /translation="MLKTHSCALTQENVGTEVTLAGWVHRRRDHGGVIFIDLRDREGI
                     VQVVFNPEQSAACLDIGKELRSEYVLQVKGVVSHRPAGTENNRMPSGMVEVVAVHAKI
                     LNAAKTPPFYINEEVEVDESLRLKYRYLDIRRQGMKNNLIIRHKAVRFMREFLNDQGF
                     IEIETPILIKSTPEGARDYLVPSRLFPGKFFALPQSPQQLKQLLMVAGMEKYYQVARC
                     FRDEDLRADRQPEFTQLDMEMSFVDEEDMMKLMEDLFTGLVANVRPDMKYNKKFPRIS
                     FADATEKYGCDKPDLRFGMELADITDIGASSAFGVFKNVAAQGGAIKAISAPGCGGYN
                     KSQQEELINLAKKYGAAGLVPISLGVENGELKDLTMEMVKSVAAKYLALEEIKTIAER
                     SGAKPGDLILIVAGARKMVNTVLGEMRNQLAVKLNLCDKNELSFAFVVDFPLFQWDEE
                     GKRWDSVHHPFTAPLESDMPLMDTDPGRVGSRAYDVVCNGYEIAGGSIRIHQADLQRK
                     VFHLLGYNDEQIDERFGHLLEAFEFGAPPHGGVAPGIDRFVMLLAGETSIREVISFPK
                     NQAAQDLLFGAPSVVDDKQIRDLHIRIQAEKE"
     gene            633871..635214
                     /locus_tag="DEHABAV1_RS03370"
                     /old_locus_tag="DehaBAV1_0644"
     CDS             633871..635214
                     /locus_tag="DEHABAV1_RS03370"
                     /old_locus_tag="DehaBAV1_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZX83.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_011928992.1"
                     /db_xref="GI:500358942"
                     /translation="MKVTDKKIEGCQASITVEMDSTEVEEGLSKTYRRLVKKVEIPGF
                     RKGKAPRDVFEKYVSREKMLDELVDDIVPEACQKAIQDEEIKPFATPKVAMVTTDPFV
                     FSARIPLPPVVELGDYKTIRATKETVEIAEENIDTVVDQVLHQRATWETAERPVKMGD
                     MLLMQVESTLNGEPYLNREDMQYSVREEAIYPAPGFGGYLVDMVAGEPKEFSIVFPED
                     HARAELAGKTAAFKVTVREIKEEKLPELNDAFAHELNPEFNTLSELRQRIRENMQDRQ
                     DDKAQAKFEDQIVEALIKMSKIDYPEVMVEAELDQIIEQQLQRLQSNVKSPEEFRAML
                     SQMTPEDMQQRYRPLAEQRVASSLALGKLATTENLVPNDEEVDAEIEKLITDAGDKKE
                     EEKALYNQPETRGRLIQLLTARKTMAFIDEIALQPALEAVESKADEDEKTEEADK"
     gene            635211..635813
                     /locus_tag="DEHABAV1_RS03375"
                     /old_locus_tag="DehaBAV1_0645"
     CDS             635211..635813
                     /locus_tag="DEHABAV1_RS03375"
                     /old_locus_tag="DehaBAV1_0645"
                     /EC_number="3.4.21.92"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="WP_011309183.1"
                     /db_xref="GI:499628449"
                     /translation="MISPENVVPMVIESSARGERAFDIYSLLLKERIIFLGSQINDQV
                     ANLVIAQLLFLDREDPDKDISLYIHSPGGVISAGLAMYDTMQLIRPKVSTICVGVAAS
                     MATVLLCAGAKGKRYALPNATIHMHQAMGGAQGQASDIEIAAREIMRQQDILRNILVK
                     HTGQTMEKIVHDSDRDYYLSAQQAVEYGLIDEILQKPENK"
     gene            complement(635894..636880)
                     /locus_tag="DEHABAV1_RS03380"
                     /old_locus_tag="DehaBAV1_0646"
     CDS             complement(635894..636880)
                     /locus_tag="DEHABAV1_RS03380"
                     /old_locus_tag="DehaBAV1_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_011309184.1"
                     /db_xref="GI:499628450"
                     /translation="MTTCSLEAIGLGAVHVDHIYTVEQILHDGECVVTESASFPGGSG
                     ANTIHGLSRLGLKCGFIGAVGNDSDGNLLIKDFENAGIDNQYLMVTDEAQTGSVVSLS
                     ESSGRRSTYVNPGANNYLNLSDINLEYLSQAKLVHMSTFFSQNEFALCHEIAERLAPD
                     VLFSFSPGALFAAQGLKRLAPILSRTNALFTNQLDIEKMTQKNYQRATDMCIRSGCEH
                     VVVTLGESRRFQRKGKITLQTYIRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTG
                     FLFGLMGDKPIEECGLLGDISARFCISKLGARSGLPNLEGLKERFGMHYFTN"
     gene            complement(636882..637703)
                     /locus_tag="DEHABAV1_RS03385"
                     /old_locus_tag="DehaBAV1_0647"
     CDS             complement(636882..637703)
                     /locus_tag="DEHABAV1_RS03385"
                     /old_locus_tag="DehaBAV1_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate transporter"
                     /protein_id="WP_011928993.1"
                     /db_xref="GI:500358943"
                     /translation="MFELGWFSTARGKGSRNLLTAVLDSIQKGELKARISFVFCSREP
                     GESAETDAFFELVKNHKIPLVTFSYQKYKTRVNGNDEIPGSILPQWRLDYDREVINRL
                     KEYNPQLCVLAGYMLIMGPEMCSRYNIINLHPATPWGPKGTWKEVIWELMQQKAAETG
                     AMIHLVTPELDRGPVVSYCRFPIQTDSFKPLWDSIAGRTVNDIKTAEGEDNSLFKAIR
                     HQGTIRELPLIVRSIKAISEGRVNIRKGQVTDNCGQTIPGYDLSAEIDHLIQGRE"
     gene            complement(637706..638365)
                     /locus_tag="DEHABAV1_RS03390"
                     /old_locus_tag="DehaBAV1_0648"
     CDS             complement(637706..638365)
                     /locus_tag="DEHABAV1_RS03390"
                     /old_locus_tag="DehaBAV1_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="WP_011309186.1"
                     /db_xref="GI:499628452"
                     /translation="MLKADLHVHTNYSMDSNTQPKDLISKCVEKGINCISLCDHGTAE
                     GALMLAKESPIKIIISEEVLTPHGEIMGMFLKESIPSGISVDECVSRIKAQGALVCIP
                     HPYDGLRGSALIDTELERLASEGKIDVLEVFNSRTLLNGSLKKARKLAKQYDLPMSAG
                     TDSHTLPEIGTTYVTMPDFNTPKEFIAALRQGRITGRQNRMVRIRALIRKLSKYIKPE
                     K"
     gene            complement(638368..638928)
                     /locus_tag="DEHABAV1_RS03395"
                     /old_locus_tag="DehaBAV1_0649"
     CDS             complement(638368..638928)
                     /locus_tag="DEHABAV1_RS03395"
                     /old_locus_tag="DehaBAV1_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_011928994.1"
                     /db_xref="GI:500358944"
                     /translation="MATGNELKKSCIIQQENGLFQVMDIQHVKMKHTALLRLKLKDIR
                     DGHTMEQTFQSDEKFNLVNLEYRHMQFLYNDENVYHFMDEKTFEQIALNKAILGDAVN
                     YLLENGSVRVMTFQEDAIGVELPASVNLRIAHTEPGFKGDTAATTTKPATLETGLVVQ
                     VPLFINTEDLIRVDTRSGQYLGKATT"
     gene            complement(638944..640035)
                     /locus_tag="DEHABAV1_RS03400"
                     /old_locus_tag="DehaBAV1_0650"
     CDS             complement(638944..640035)
                     /locus_tag="DEHABAV1_RS03400"
                     /old_locus_tag="DehaBAV1_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_011928995.1"
                     /db_xref="GI:500358945"
                     /translation="MSQSNGQRLALLRKLMAENELDGLLVSKPENQYYLSGFSGGEGH
                     LFITPTQSFIAVDFRYYEQAENESPDYTLCKIINGRSLWLPELLSSESIRRLGFESSF
                     ITFEQYSKLKNTLSKSGLNVLLVETADLAGNLRKIKSENEIDCIKQASAIGDAAFSAL
                     PSLLTPGMTERELAWELEKFMKSHGSQSMPFEVIAATGANSALPHAQTRPEAVADGQP
                     LLMDYGAKVSWYASDMTRTVLPGKPNSQFKRIYDIVLAAQQKAIDQIHSGMTGQEADA
                     IAREVIEKAGYGANFGHSLGHGVGLEVHEEPHLSPRSTDILENGMVFSIEPGIYLPGW
                     GGIRIEDTCMLKNGKIELLSKSDKQNPYI"
     gene            complement(640032..640955)
                     /locus_tag="DEHABAV1_RS03405"
                     /old_locus_tag="DehaBAV1_0651"
     CDS             complement(640032..640955)
                     /locus_tag="DEHABAV1_RS03405"
                     /old_locus_tag="DehaBAV1_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC"
                     /protein_id="WP_011309189.1"
                     /db_xref="GI:499628455"
                     /translation="MQENFNKYLEYLSVEKNVSPYTLRNYRTDLIGFVNYLIEKKVSS
                     FDRVDRYILRDYMSSLIAKGIVKGSIARKLSAVRSFYRYLMREGLIQKNPTLNASSPR
                     LDKRLPEFLTVTEVNKLLRVPDSSTPQGLRDKAFMELLYASGLRVSELVKLDIENMDL
                     HSHQIRVWGKGSKERVVLAGLPAIQSIQNYLNLGRPLLKGKRNTPALFLNPTGGRLSA
                     RSFQERLDKLAKQAGIEKHVHPHMLRHTFATHLLDGGADLRVVQELLGHSNLSTTQIY
                     THVTKSQARKVYMSSHPLARPQNNIAGREDE"
     gene            complement(640956..643067)
                     /locus_tag="DEHABAV1_RS03410"
                     /old_locus_tag="DehaBAV1_0652"
     CDS             complement(640956..643067)
                     /locus_tag="DEHABAV1_RS03410"
                     /old_locus_tag="DehaBAV1_0652"
                     /EC_number="5.99.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309190.1"
                     /note="catalyzes the ATP-dependent breakage of
                     single-stranded DNA followed by passage and rejoining,
                     maintains net negative superhelicity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_011928996.1"
                     /db_xref="GI:500358946"
                     /translation="MKEKLVIVESPAKARTISKMLGKDFNIMATMGHIRDLPKSTLGV
                     DVENNFTPKYVSLKAKAKVIKELKEAVKHSKAIYLATDPDREGEAIAWHISEVTKANL
                     SNPKRVVFHEITKEAIDKAFKNTRELDMDLVNAQQARRVLDRLVGYKLSPLLWRKVQR
                     GLSAGRVQSVSLKIIVDREREIEKFVSTEYWNIEALLSKKVKSAAFKATLAGYVTKGK
                     LEIHNESEADQIKKELEVSDYQVLKIKRKSNLRQSPAPFITSTLQQEAWRKLRFSAKQ
                     TMVIAQQLYEGLNVEGEGEVGLITYMRTDSTNVARTAVAETRDYITEKYGPAYLPKQA
                     RVFSSKVKGAQEAHEAIRPTRINRTPDFIKKSLSADQFKLYQLIWQRMMASQMSPAVF
                     DNTTIDIEAKHQPSKTRYLLRTTSSVNTFPGFTIVYIEGKDEDEEKEQSSLPPMEEGE
                     ELKLKSLDATQHFTQPPPRYTEATLIKALEQNGIGRPSTYAPTISTIQEREYITKLKG
                     SLKPSELGMLVNDLLVEHFPDIIGIDFTAAMEAELDKIATEKLDWVPIIRRFYEPFIK
                     EIEAASEKIEKIKPPEEELDELCPECNAKLVIKRGRFGKFIACSRYSKEDDGCRYTRS
                     YQIKTGAKCPDCNSDIVEKYSKKGKIFYGCAGYPNCKFVSFYKPLTKPCPECGALMTK
                     SGQNWAKCTKCGKRKKLEDES"
     gene            complement(643074..644195)
                     /locus_tag="DEHABAV1_RS03415"
                     /old_locus_tag="DehaBAV1_0653"
     CDS             complement(643074..644195)
                     /locus_tag="DEHABAV1_RS03415"
                     /old_locus_tag="DehaBAV1_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_011928997.1"
                     /db_xref="GI:500358947"
                     /translation="MQNQDNNYAIGFSYINGVGRVRLNLLDNYFGNLENAWHAGKEAL
                     ISAGLDNTLAENIVAHRPKIDLSKTLETLKRHDIQTYAHTDKDYPASLRQIHDYPPLI
                     FVKGQLLPADELCLGIVGTRQPTVYGKLVTEELAESLARAGLTIVSGLARGIDTVAHT
                     AALKAGGRSIAVFGCGLDIIYPSENHSLARQIAEDGALISEHPPGIRPRPEFFPRRNR
                     ILSGLCRGILVTEAGENSGAVITANYALEQNREIFAVPGSILSPSSLGTNRLIQEGAK
                     LVSSAKDVLEELNISLFSEENTTVEIIPENQTESLILGKLGYEPVHIDQICRECALGV
                     ALVSGTLAIMELKGQVRSTGGMNYVRTREKKEIYQLEMN"
     gene            complement(644324..644413)
                     /locus_tag="DEHABAV1_RS03420"
                     /old_locus_tag="DehaBAV1_R0010"
     tRNA            complement(644324..644413)
                     /locus_tag="DEHABAV1_RS03420"
                     /old_locus_tag="DehaBAV1_R0010"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(644377..644379),aa:Ser,seq:gga)
     gene            complement(644450..644539)
                     /locus_tag="DEHABAV1_RS03425"
                     /old_locus_tag="DehaBAV1_R0011"
     tRNA            complement(644450..644539)
                     /locus_tag="DEHABAV1_RS03425"
                     /old_locus_tag="DehaBAV1_R0011"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(644503..644505),aa:Ser,seq:cga)
     gene            644691..644885
                     /locus_tag="DEHABAV1_RS03430"
                     /old_locus_tag="DehaBAV1_0654"
     CDS             644691..644885
                     /locus_tag="DEHABAV1_RS03430"
                     /old_locus_tag="DehaBAV1_0654"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011928998.1"
                     /db_xref="GI:500358948"
                     /translation="MALSSLNIGKYLHVCGGLFLKIQIGLHNYAYFRQGKGFIPAGQK
                     QSFWTYIQDNLLFQNIFSRG"
     gene            644964..646238
                     /locus_tag="DEHABAV1_RS03435"
                     /old_locus_tag="DehaBAV1_0655"
     CDS             644964..646238
                     /locus_tag="DEHABAV1_RS03435"
                     /old_locus_tag="DehaBAV1_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011928999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/hydrogen exchanger"
                     /protein_id="WP_011928999.1"
                     /db_xref="GI:500358949"
                     /translation="METEIYFKFILSFGLILLVARLGGAIAERFLKQPAVIGELLAGI
                     IISPFLLGQFLFANDPVIMNFALIDGVFSQNGEHLSGFAPMEIISQIAVVVLLFVAGL
                     ETNVTSFIKNSFTGAMVAIGGVVVPFALGVFSAMYFFPDLHMAGWLFIGAILTATSIG
                     ITVRILMDMGKLSSREGTIILVAAVVDDIIGLVILSVVISMAQSGSVNALSAVTTGVI
                     GFAVWLGILLLGVYGHKYISKYILTPFKSSGTMPVMALIVGLIVSYLVTLVDLHPVVG
                     AYVAGLMFASTMEKEEILHQTRPIMLFIAPFFFAYLGMQVDLREVWAVIVPALVIVVL
                     AIIGKIVGCYFPARFVGKTSHNGAMIVGVGMVPRGEVGLIVAGAGLIAGAITRDLFGI
                     AVAVSILTTLVMPVMIKPFFKPKAEANAKRLP"
     gene            646274..646345
                     /locus_tag="DEHABAV1_RS03440"
                     /old_locus_tag="DehaBAV1_R0012"
     tRNA            646274..646345
                     /locus_tag="DEHABAV1_RS03440"
                     /old_locus_tag="DehaBAV1_R0012"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:646307..646309,aa:Arg,seq:ccg)
     gene            646380..646952
                     /locus_tag="DEHABAV1_RS03445"
                     /old_locus_tag="DehaBAV1_0656"
     CDS             646380..646952
                     /locus_tag="DEHABAV1_RS03445"
                     /old_locus_tag="DehaBAV1_0656"
                     /EC_number="1.2.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvic-ferredoxin oxidoreductase subunit gamma"
                     /protein_id="WP_011309194.1"
                     /db_xref="GI:499628460"
                     /translation="MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPE
                     RRGAPVQSFNRISDNNPIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTT
                     KPLEHFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPL
                     KHRFGKLAAKNMAAMKKAFEETVVKELKVG"
     gene            646945..647241
                     /gene="porD"
                     /locus_tag="DEHABAV1_RS03450"
                     /old_locus_tag="DehaBAV1_0657"
     CDS             646945..647241
                     /gene="porD"
                     /locus_tag="DEHABAV1_RS03450"
                     /old_locus_tag="DehaBAV1_0657"
                     /EC_number="1.2.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929000.1"
                     /note="catalyzes the ferredoxin-dependent oxidative
                     decarboxylation of pyruvate to form acetyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvic-ferredoxin oxidoreductase subunit delta"
                     /protein_id="WP_011929000.1"
                     /db_xref="GI:500358950"
                     /translation="MAKQENQITWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKK
                     CIKCGVCYIFCPEGCINETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEEK"
     gene            647241..648413
                     /gene="porA"
                     /locus_tag="DEHABAV1_RS03455"
                     /old_locus_tag="DehaBAV1_0658"
     CDS             647241..648413
                     /gene="porA"
                     /locus_tag="DEHABAV1_RS03455"
                     /old_locus_tag="DehaBAV1_0658"
                     /EC_number="1.2.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-ketoisovalerate ferredoxin oxidoreductase
                     subunit alpha"
                     /protein_id="WP_011929001.1"
                     /db_xref="GI:500358951"
                     /translation="MPRVGLEVSIALSEAVGLCNADVIAAYPITPQTHIVEHLAEMVA
                     EGELDAEYIPVESEHSALSACLGSAAAGARTFTATAGQGLELMHEVLYVASSMRLPIM
                     MAVANRALSGPLSVWGDHSDVMSCRDIGWIQIFTENGQEVVDNTICSFKIGEDKRVLL
                     PVMVHLDGFHLSHVIEPIEMPERKQVDAFLSVNDYPYALNPDNPRAMGDFAPPVIFTE
                     AKWAQEQDFQKSKAVILEVWKDFEKQFGRSYKPVETYRTEGAENLLFTMGSFSETAMS
                     AIDKMRDDGMSVGLVRLRLWRPFPFEELRTAVKDAKNLIVLDRALSIGGPGGPVCSEI
                     KAALYPLEKKPKIVSIIGGLGGRDITVANFEDIMKKGLAIAEKGSPSEYEIYGVRA"
     gene            648413..649354
                     /locus_tag="DEHABAV1_RS03460"
                     /old_locus_tag="DehaBAV1_0659"
     CDS             648413..649354
                     /locus_tag="DEHABAV1_RS03460"
                     /old_locus_tag="DehaBAV1_0659"
                     /EC_number="1.2.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881936.1"
                     /note="catalyzes the formation of acetyl-CoA from pyruvate
                     and coenzyme A; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvic-ferredoxin oxidoreductase subunit beta"
                     /protein_id="WP_011309197.1"
                     /db_xref="GI:499628463"
                     /translation="MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDEN
                     TIIVNATGCMEIIASQYPYTSWRLPWIHTLFENTAAVASGVESALKVLKRKKRIEDKD
                     IKIVAIGGDGATVDIGLQALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGAATT
                     TSPAGKVGKGQFSWKKDMPAIAVAHNIPYVATCCPSYPFDMIEKVSKALAADGPAYIH
                     CLSVCPTGWRCATEDTIKIGRLAVETGVFPLYEVVNGEYKMSMETPALKPLKEYTSLQ
                     RRFRHLTEESLDLIQERVQLEYNKIAERAACALKLEK"
     gene            649330..649803
                     /locus_tag="DEHABAV1_RS03465"
                     /old_locus_tag="DehaBAV1_0660"
     CDS             649330..649803
                     /locus_tag="DEHABAV1_RS03465"
                     /old_locus_tag="DehaBAV1_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase"
                     /protein_id="WP_011309198.1"
                     /db_xref="GI:499628464"
                     /translation="MCTETREIVAPKVKDILNKYAKDKGMLVAILQDIQTEFNYLPRP
                     ALEAVSQGLGVPMSQVYSVATFFKAFSLKPKGKHSVHVCMGTACHVRGASKILDKLVE
                     KLGCCAGENTEDMKFSLDAVNCVGACALGPVVVVDGQYVGNMTTEKVKPLIEGCQ"
     gene            649803..651674
                     /locus_tag="DEHABAV1_RS03470"
                     /old_locus_tag="DehaBAV1_0661"
     CDS             649803..651674
                     /locus_tag="DEHABAV1_RS03470"
                     /old_locus_tag="DehaBAV1_0661"
                     /EC_number="1.6.99.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_011929002.1"
                     /db_xref="GI:500358952"
                     /translation="MSNIAIKKFSSATELEAKRQEILKSRNSGQAVIAICCGTGCQAY
                     GAKKVADAFEEELAKAGLGDKVEVRTTGCHGFCERGPLVVIRPQNIFYQRLKISDIPE
                     IIEKTIKNNEVIERLLYVDPMTKEKKVHEHDVPFYKKQMRLVFGNNGNIDPTSIEDYL
                     AVGGYKSLAKAISSLKPDEIVEEIIKSGLRGRGGGGFPTGWKWKSCREAHDPVKYVIC
                     NCDEGDPGAFMDRSLMEGNPHSVIEGMIIGAYAIGSHEAYIYIRDEYPMAVKHALLAI
                     KQAEDYGLLGENILGSGFSLKIHINRGGGAFVCGESTALMASLEGKVGEPRAKYVHTS
                     EKGLYDKPTTLNNVETWANIPLIIEKGADWFNKIGTAGSKGTKIFSLVGKVNNTGLIE
                     VPMGITLREIVYDIGGGIPKGKKFKAIQTGGPSGGCLPESMLDLPVDFDELTKAGSMM
                     GSGAMIVMDEDNCMVEIARYFLSFLEGESCGKCVPCREGVKRMRQILEKITKGEGEEG
                     DIEHLEQLSQAIQDASLCALGGSAPNPVMSTIKYFREEYEAHIRQKTCPAKECKALIT
                     YNIIDANCPGCGLCYKACATGAIISQGKKMSVILDQSKCTKCGACFDACKLHAVEIR"
     gene            651687..652410
                     /locus_tag="DEHABAV1_RS03475"
                     /note="(2Fe-2S)-binding protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            652466..652543
                     /locus_tag="DEHABAV1_RS03480"
                     /old_locus_tag="DehaBAV1_R0013"
     tRNA            652466..652543
                     /locus_tag="DEHABAV1_RS03480"
                     /old_locus_tag="DehaBAV1_R0013"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:652501..652503,aa:Pro,seq:tgg)
     gene            652634..653323
                     /locus_tag="DEHABAV1_RS03485"
                     /old_locus_tag="DehaBAV1_0663"
     CDS             652634..653323
                     /locus_tag="DEHABAV1_RS03485"
                     /old_locus_tag="DehaBAV1_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_011929003.1"
                     /db_xref="GI:500358953"
                     /translation="MDLKRGFGVLVVLLLAVSMFLNSQNISFGDIFSNDTPVTLDGVQ
                     ILEYEGKDLTSILNLRDNSIFGPPEIDTVSYTLNINGLVGQELSFTYDELRTRFNPYT
                     KVVTLHCVEGWDATILWEGILFKDIAGMAGIKGEADTVIFHALDGYTTALSLDYLISN
                     NIMLAYKLNGVTLPAKYGFPLQLVAESKWGYKWIKWVSQIEFSDDENYLGTWERQGYS
                     NDADLNKGFFD"
     gene            653485..654954
                     /locus_tag="DEHABAV1_RS03490"
                     /old_locus_tag="DehaBAV1_0664"
     CDS             653485..654954
                     /locus_tag="DEHABAV1_RS03490"
                     /old_locus_tag="DehaBAV1_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric reductase"
                     /protein_id="WP_011929004.1"
                     /db_xref="GI:500358954"
                     /translation="MKFQYDLVVIGSGLAGFTSTVFANGLGKKVAMVEKGKLGGACTW
                     NACVPSKTLLQIGRRVGQIKKYNQNGLKLVSVNLQTENIMPYLHSVLEDISGVDDFDN
                     LEKTGINILKGEAVFTDRHHISLNGQVVSAKHFIIATGSSPAIPPVEGLADIPYYTNE
                     TVFDIKSIPSSMIVLGGGPAGIELGLAFAWLGCKVDIIEMAERILPKDDTELSGLLLD
                     YLNAEENLQIHVSTKAIRFQEQDNGQLKLEMQTREGKINEITAETVLVAVGRRANVAG
                     LALEKAGVKYTARGISVNSKLQTSSLNIFAAGDVAGPIQLGMMAEKQAILAASNACLP
                     FKQSIRYDDVAWVTYSEPQMAHIGLTEDEARRKYGNNIRIIRYPLTKVRRAVMDHDIR
                     GMCKFVLDKHDRLIGAHLLCSQAENLIHELQIVKCLHKPLSRLHTIPHIYPTYEEGII
                     KRAADISYTMKMRRNPFVRLVLRYWHGYKDKLDTVINRL"
     gene            complement(654991..655065)
                     /locus_tag="DEHABAV1_RS03495"
                     /old_locus_tag="DehaBAV1_R0014"
     tRNA            complement(654991..655065)
                     /locus_tag="DEHABAV1_RS03495"
                     /old_locus_tag="DehaBAV1_R0014"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(655031..655033),aa:Gly,seq:tcc)
     gene            655214..655600
                     /locus_tag="DEHABAV1_RS03500"
                     /old_locus_tag="DehaBAV1_0665"
     CDS             655214..655600
                     /locus_tag="DEHABAV1_RS03500"
                     /old_locus_tag="DehaBAV1_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FmdB family transcriptional regulator"
                     /protein_id="WP_011309203.1"
                     /db_xref="GI:499628469"
                     /translation="MPIYEYSCSKCNKVFEIMRPRSESSLSATCPVCSAESTRIISDF
                     THGVAFSKDAPEMRKDSANEKMWISEQKVAENKIKDPDPLKKWREEREKSCGKGPEAW
                     VEYAKQEEAKEQKVKDYGTGFTGREV"
     gene            655617..655691
                     /locus_tag="DEHABAV1_RS03505"
                     /old_locus_tag="DehaBAV1_R0015"
     tRNA            655617..655691
                     /locus_tag="DEHABAV1_RS03505"
                     /old_locus_tag="DehaBAV1_R0015"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:655649..655651,aa:Met,seq:cat)
     gene            complement(655779..656576)
                     /locus_tag="DEHABAV1_RS03510"
                     /old_locus_tag="DehaBAV1_0666"
     CDS             complement(655779..656576)
                     /locus_tag="DEHABAV1_RS03510"
                     /old_locus_tag="DehaBAV1_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011929005.1"
                     /db_xref="GI:500358955"
                     /translation="MMTIAELFDLRGKVAIVTGGAMGIGKGISMRLAEAGASIMIPDL
                     NLEVAQKTVAEIKALGGKATAIQADVSNINDTQKVIDATLKAFGDLDIMVNNAGIYRF
                     MPAIDMTEAMWDKTLGINLKGLMFFSQAAAKAMMAAKHGGKIINIASIDGFRPTGNLA
                     HYDASKGGVIMLTKAMAQEWAPHGILVNAVAPGGINTPGASALMPSGSMSAEQLMELS
                     KSFVAKLPLKRMGEPDDIGKVVLFLTSAAADYIVGSVIVADGGALLV"
     gene            656721..657932
                     /locus_tag="DEHABAV1_RS03515"
                     /old_locus_tag="DehaBAV1_0667"
     CDS             656721..657932
                     /locus_tag="DEHABAV1_RS03515"
                     /old_locus_tag="DehaBAV1_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein HflX"
                     /protein_id="WP_011929006.1"
                     /db_xref="GI:500358956"
                     /translation="MEDTINKTVGNNVVIQPERAVLAAVDTNRNSNWAIEDSLDELCQ
                     LVATAGATVVGRIIQKLHAPARNSYLGKGKLDELIEMKKELDYNLVIFDDELSPIQQR
                     SLEEALGVKVIDRVALILDIFAKHANTREGQLQVELAQMQYLLPRLAGQWSHLERLGG
                     GIGTRGPGESQLETDKRIVRTKIRNLKEHLDEVTIQRELYRERRRMRGVPVVSLVGYT
                     NSGKSSLLNAVARTDVLAENKLFATLDPTTRRLYINGLGNVLLTDTVGFIRKLPPAIV
                     KAFRATLEEINQADLLVHVVDITAKNAFEQCQTVEKILTDMGVADKPRLTAMNKIDLK
                     LDTNRNWTEEEALNLLKTECPVAENTVLISAVKRWGLIELNLMLKEKLISMGFNPGYA
                     VYDEIGEKKEQ"
     gene            657936..658148
                     /locus_tag="DEHABAV1_RS03520"
                     /old_locus_tag="DehaBAV1_0668"
     CDS             657936..658148
                     /locus_tag="DEHABAV1_RS03520"
                     /old_locus_tag="DehaBAV1_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309206.1"
                     /db_xref="GI:499628472"
                     /translation="MENELAGNIMSCFDELALGLSRRRELLARKGACENYYFYYDLAA
                     IDEEESKALNRLNNLVKQDIERNTAI"
     gene            complement(658776..659942)
                     /locus_tag="DEHABAV1_RS03525"
                     /old_locus_tag="DehaBAV1_0669"
     CDS             complement(658776..659942)
                     /locus_tag="DEHABAV1_RS03525"
                     /old_locus_tag="DehaBAV1_0669"
                     /EC_number="2.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRC5.1"
                     /note="produces methionine from
                     2-keto-4-methylthiobutyrate and glutamine in vitro;
                     mutations do not affect methionine salvage in vivo
                     however; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LL-diaminopimelate aminotransferase"
                     /protein_id="WP_011929007.1"
                     /db_xref="GI:500358957"
                     /translation="MKLSKRIENLPPYLFVQISKKIAEKRAKGEDVISFAIGDPDLPT
                     PKHILAELCKAAEDPSNHRYPETEGLPVLRKAMAEWYQKRFGVKLNPDTEVLPLIGSK
                     EGIGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGAEVFNLPLNKGNNFLPNLEAIPQ
                     NILSKAKVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFDGYKPV
                     SFLEADGAKDVGIEFHSLSKSYNMTGWRIGMAVGNAKMIDALRRFKSNLDSGIPQAIQ
                     LMAIAALNGSQEIINQNCAIYQRRRDRLVEALRNIGMEVTAPKASLYIWAPVPESYTS
                     ASFATELLDKTGVVVTPGTGYGTAGEGYIRLSLTVPDEQIEKGIAKLAGYKKSS"
     gene            complement(659929..660783)
                     /locus_tag="DEHABAV1_RS03530"
                     /old_locus_tag="DehaBAV1_0670"
     CDS             complement(659929..660783)
                     /locus_tag="DEHABAV1_RS03530"
                     /old_locus_tag="DehaBAV1_0670"
                     /EC_number="5.1.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_011929008.1"
                     /db_xref="GI:500358958"
                     /translation="MKFTKLQSVGNDFVLLDPQGEEQDWPKLALHMCHRHFGAGADGL
                     MLILPSEKADFRMRIFNADGSEAEICGNGLRCLIHYIAVNKLLGNLDELSIETLAGMR
                     HAQIFKDGRIRTTMGKPMFEAHQIPVAAEPDPKHYNGQLISDFPLNINNRRVLVSLVS
                     MGNPHAIHFCTKPVEEFPLGEVGSQVEIHKAFPKRTNFEVANILDTEHIKVRVWERGV
                     GETLGCGSGASAVAVAAQILGYVGKFVYIKLPGGTLGVEWDGHDDVYLTGKAEIIYTG
                     EWLKDEII"
     gene            complement(660770..661756)
                     /locus_tag="DEHABAV1_RS03535"
                     /old_locus_tag="DehaBAV1_0671"
     CDS             complement(660770..661756)
                     /locus_tag="DEHABAV1_RS03535"
                     /old_locus_tag="DehaBAV1_0671"
                     /EC_number="2.5.1.75"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA dimethylallyltransferase"
                     /protein_id="WP_011929009.1"
                     /db_xref="GI:500358959"
                     /translation="MSIIDSTTGANASNLPLSPLLVILGNTGSGKSALAINLAKVIPA
                     GIINADSRQIYSRMDIATAKPTLSEMLEIPHYLYSFIQPDQPFSLAEYQTLAYQAIDS
                     LHTQNRLPVLVGGSGQYLKAVLEGWSIPPVAPDETFRAALFEKAEKEGGDVIFTELEK
                     KDPQAATQIDPRNIRRVVRALEVIHKTGGKFSGLLIKNPPPYRVFKIGIHIPREELYR
                     TVDLRVEKMLEQGLEAEVRSLLEKGYKASLPSMSGIGYRQIAKYIEGGISLTEAVEQM
                     KFETHRLIRQQNTYFRLTDTNIHWITLEESRSNGIIQLVCDFLAAENKNEIH"
     gene            complement(661818..662579)
                     /gene="tpiA"
                     /locus_tag="DEHABAV1_RS03540"
                     /old_locus_tag="DehaBAV1_0672"
     CDS             complement(661818..662579)
                     /gene="tpiA"
                     /locus_tag="DEHABAV1_RS03540"
                     /old_locus_tag="DehaBAV1_0672"
                     /EC_number="5.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXC5.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_011929010.1"
                     /db_xref="GI:500358960"
                     /translation="MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPF
                     ISLYPIKTMLENSSIKLGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFG
                     ETGQVVNQKIKAALQAGLLPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIII
                     AYEPIWAIGTGKAATASEANSAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEI
                     LSQTNIDGALVGGASLKAESFVSICRQAAVIQNKH"
     gene            complement(662591..663796)
                     /locus_tag="DEHABAV1_RS03545"
                     /old_locus_tag="DehaBAV1_0673"
     CDS             complement(662591..663796)
                     /locus_tag="DEHABAV1_RS03545"
                     /old_locus_tag="DehaBAV1_0673"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881950.1"
                     /note="catalyzes the interconversion of 3-phosphoglycerate
                     and 2-phosphoglycerate; this enzyme does not require the
                     cofactor 2,3-bisphosphoglycerate as a phosphate donor;
                     BPG-independent PGAM; aPGAM; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="WP_011929011.1"
                     /db_xref="GI:500358961"
                     /translation="MNKLNLVSQLSQTTPSKIVLLVIDGLGGLPHPESGQTELETART
                     PNLDELARKSICGMASPVAAGITPGSAPGHLGLFGYDPVDCLIGRGVLEALGIDFDLK
                     PGDVATRGNFCTVDKQGLICDRRAGRVSSLVSAKLCTLLDGQEFDGIRVIVKPVKDHR
                     LVVIFRGSGLSEKVTDSDPQKLGAVPEEVKPLAENARLMAKVANRFLQFAAKTLKDHA
                     PANMILLRGFSEKPCFATMNEIYKLKTAAIASYPMYRGLSKVVGMDVLPTGSMLSDEI
                     ATYKANFEKYDFFFLHVKATDAAGEDGDFERKVKALEELDQILPEILSLKPDVVAISG
                     DHSTPAVIQGHSWHEVPVLIYSKYCRPDKVCRFSETDCLQGGLGHIPASDIMPLAMAN
                     ALKLGKFGA"
     gene            complement(663789..664982)
                     /gene="pgk"
                     /locus_tag="DEHABAV1_RS03550"
                     /old_locus_tag="DehaBAV1_0674"
     CDS             complement(663789..664982)
                     /gene="pgk"
                     /locus_tag="DEHABAV1_RS03550"
                     /old_locus_tag="DehaBAV1_0674"
                     /EC_number="2.7.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881951.1"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_011929012.1"
                     /db_xref="GI:500358962"
                     /translation="MENLTIRDLNFSGKKALVRVDFNVPINEETGTINDSSRIRAAIP
                     TIDYLLDHQAKVILCSHLGRPDGMIVESMRLAPVAKRLSEILRQEVFTASDCIGDEVA
                     AKVDALEDSQVLLLENLRFHPEEEANDPIFAKKLADLADIYVDDAFGTAHRKHASIVG
                     VAKYLPAVAGLLLEKELNALGKVLEHPPRPFMILLGGAKVSDKVGMLENVMDKVDTIL
                     IGGGMAATFLKAQGLEIGDSLIDDSLDTAKMLMDKAKSKNVKIILPDDVLVTFDKIGP
                     EARAENVSVENIPHTAKIVDIGLLTITHFTKHLEKCKTVFWNGPMGIYEIPQFSEGTR
                     AMVNTMTRLHATTIIGGGSTAEIVTELNIASKMSFVSTGGGASLKFLSGEKLPGVEVL
                     AKKNE"
     gene            complement(665082..666983)
                     /locus_tag="DEHABAV1_RS03555"
                     /old_locus_tag="DehaBAV1_0675"
     CDS             complement(665082..666983)
                     /locus_tag="DEHABAV1_RS03555"
                     /old_locus_tag="DehaBAV1_0675"
                     /EC_number="2.2.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407683.1"
                     /note="catalyzes the formation of 1-deoxy-D-xylulose
                     5-phosphate from pyruvate and D-glyceraldehyde
                     3-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_011929013.1"
                     /db_xref="GI:500358963"
                     /translation="MSKLLDTINSPSDLKKLSLDELRELAVQIREELVNRVTLNGGHL
                     ASSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFATLRQHGGLSGFT
                     CRDESPHDPFGAGHASTSISAGLGMAVARDLAKEDYSVISVIGDGAISGGMSFEAINN
                     AGHLHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRNAKQTITNMPFGKA
                     VWAFTKSIKRKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKRAKDFESKPVLI
                     HMITKKGKGYDDAEADAVKYHGISPKSGGLKSSHGLSYSQVFGQTLHKIMSQNPQVVA
                     ITAAMTDGCGLGEIAAAFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIYSTFLQRG
                     FDQIIHDVCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMVVSAPSDENDL
                     QHLLYTAVNSGKPFALRYPRGFGEGVEIESSLHNIPIGQNEILVNGSDVAILATGKSV
                     AFAREALEILTESGIKPTLVNNRYISPLDSELVLKIAQSHKYLVTVEENVISGGLGSR
                     INTLLAEAGLVNKIKIANIGIPDKFVEHGNQSLLRAKYGLDGKGIAQRVLSLVGNPNE
                     MKHPQIICP"
     gene            667147..667698
                     /locus_tag="DEHABAV1_RS03560"
                     /old_locus_tag="DehaBAV1_0676"
     CDS             667147..667698
                     /locus_tag="DEHABAV1_RS03560"
                     /old_locus_tag="DehaBAV1_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="small multi-drug export"
                     /protein_id="WP_011929014.1"
                     /db_xref="GI:500358964"
                     /translation="MSSEFWLGLGLPPELLVFLAAVLPVSELRGALPLAINVFGIPWY
                     WAYLIALAGNLLPIPVVLVLLEKVLNLLERFSFMRGFTRWIYALGQRRSTPVEKYKRI
                     GLMMLVAVPLPVTGAWTGSLVAVVLGLNYKEALIYISLGVAIAGVIVTSLCLLGWFGA
                     ILAGGVLGGIGVYRIIHSKNRPL"
     gene            667738..667814
                     /locus_tag="DEHABAV1_RS03565"
                     /old_locus_tag="DehaBAV1_R0016"
     tRNA            667738..667814
                     /locus_tag="DEHABAV1_RS03565"
                     /old_locus_tag="DehaBAV1_R0016"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:667772..667774,aa:Arg,seq:tct)
     gene            complement(668208..668717)
                     /locus_tag="DEHABAV1_RS03570"
     CDS             complement(668208..668717)
                     /locus_tag="DEHABAV1_RS03570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_042377953.1"
                     /db_xref="GI:755025010"
                     /translation="MLYTAGDIAERVASLARQISDDYPDNRPILIGVQRGFICFMADL
                     IRQIAIPLDIDFMTISYYSGSNASMVRITKDMDLEVAGRDVLLVEDIVDTGITLNYLL
                     NHLRSKNPASLKVCTLLDRKVRRLIDINIDYVGFELPDEFVVGYGLDYHEEYRNLPFI
                     GIPGIKQNP"
     gene            complement(669721..670080)
                     /locus_tag="DEHABAV1_RS03575"
                     /old_locus_tag="DehaBAV1_0678"
     CDS             complement(669721..670080)
                     /locus_tag="DEHABAV1_RS03575"
                     /old_locus_tag="DehaBAV1_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3Z8G5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_011309236.1"
                     /db_xref="GI:499628502"
                     /translation="MARIKGGLATHKRHKKVLALTKGHASTRHSLFKRAHESMVHAMS
                     YAFAHRRARKGDMRRLWITRINAAARAEGLTYGELISGLKVAGIDINRKVLADMAISD
                     TVAFAAVAAKAAAAKAN"
     gene            complement(670099..670302)
                     /locus_tag="DEHABAV1_RS03580"
                     /old_locus_tag="DehaBAV1_0679"
     CDS             complement(670099..670302)
                     /locus_tag="DEHABAV1_RS03580"
                     /old_locus_tag="DehaBAV1_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXB7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_011309237.1"
                     /db_xref="GI:499628503"
                     /translation="MPKMKTRKTAAKRFHVTGTGKIMRSKGMKSHLRRNKSARVLRQF
                     DEMSQVAGVDRARIQKLIPYGVS"
     gene            complement(670295..670822)
                     /locus_tag="DEHABAV1_RS03585"
                     /old_locus_tag="DehaBAV1_0680"
     CDS             complement(670295..670822)
                     /locus_tag="DEHABAV1_RS03585"
                     /old_locus_tag="DehaBAV1_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_042377715.1"
                     /db_xref="GI:755024766"
                     /translation="MTARECRLVGDKGEQLGILPILQAREQARKINLDLVEVAPTAVP
                     PVCRLMDYGKYRFEQTKKDREAKRTQKVSLLKEIRVRPKIGEHDFDAKARSARKQLES
                     GDKVKLTVMFRGREITHAELGLRLLKKMADSLTDIATIEGQPSLLGSRMHLTLLPKAA
                     IKVSKVKEGQETANA"
     gene            complement(670919..672667)
                     /locus_tag="DEHABAV1_RS03590"
                     /old_locus_tag="DehaBAV1_0681"
     CDS             complement(670919..672667)
                     /locus_tag="DEHABAV1_RS03590"
                     /old_locus_tag="DehaBAV1_0681"
                     /EC_number="6.1.1.3"
                     /EC_number="3.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine--tRNA ligase"
                     /protein_id="WP_011929016.1"
                     /db_xref="GI:500358966"
                     /translation="MANQIDESKPISDLEIMRHSAAHIMAEAVLSMFPEAKLGIGPAI
                     DTGFYYDFDLPRTLTPEDLPEIETRMNQLVKSNLPFRREEMSKDEARKLFANQPYKLE
                     LLNDITDETVSIYRQGNFCDLCRGPHVNYTSKVKAFKLLSIAGAYWRGDEKRPMLQRI
                     YGAAFLDKASLAEYLNMLEEAAKRDHRKLGKELELFSLHQEIGGGLVNWLPNGAIVRH
                     LIEEFWKKEHLKRGYDLVYTPHIAKVDLWKTSGHWGFYRENMYSPMDIDGEEYVLKPM
                     NCVYHILMFKNRTRSYKELPIRMAELGTVYRYERSGVLHGLSRVRGFTQDDAHIFCLY
                     DQLEKEVVKVLDLAKFMIDTFGFTKYKVMLSTRPEKYVGELDKWEYATDILAKALEAN
                     QIPYQVDPGEGVFYGPKIDIKFEDALGRAWQGPTIQVDFQLPERFDVSVVGEDGKDQP
                     VAMVHRTVLGSMERFMSCLTEQYGGAFPAWLSPKQAMVIPIADRHTEFAEKLACELRE
                     EEVRVEVDSRSETMNQKIRQAQLAKIPYMLVVGDKEIETQSVAVRTRTGSQQVMPFAE
                     FKSMLLAKIKTKSTEI"
     gene            complement(672793..675324)
                     /locus_tag="DEHABAV1_RS03595"
                     /old_locus_tag="DehaBAV1_0682"
     CDS             complement(672793..675324)
                     /locus_tag="DEHABAV1_RS03595"
                     /old_locus_tag="DehaBAV1_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929017.1"
                     /db_xref="GI:500358967"
                     /translation="MEGKKNISSNNEPVAQPKILTKPLPQILDEMDANIRAAAEAARR
                     AQEAAVTAGKAAESATHAANLAEKRAEDARLAGEKAAETATRAAAEAAAAAEKTAKLA
                     TNAANEALKAAELASRKAEDAERGAAKAADDFKRVAEEAARRAEAASQAARDAADNAI
                     LVAESAAQRAEDAGENARQAAEKAIREAQDATIAAIQASELATNAAEDAAHRAEQASA
                     LARKTAEDATNASREAVLKAEEAARKAEAASLAATNAAENATKSASEAAKRAEAASLA
                     AKEAAAMATAAAMAAAKKAEEASAIAKSAAEQAIKAANEAALRAEAAAKAATLKAEEA
                     LLASKKAAAEAIASASEAAMSAAMKSEAAVAAAKSSAEKAILVAEDAARKAEAAAAEA
                     SKKAENASLLSTQKAEEAIKAADLAAKRAEAAALAATQKADEAVKIAGEAAKLAAANA
                     TNAANEAAKRAEAAAAAATKKAEEAIAAAKLAVDEAVKAATKAAEDAAKKAQLAAEEA
                     TRRAEQASAAAAAAAAAAASRAEEAAYKAEDTAKAAKLAAEEATNRADEVALTAKETA
                     LANKKAAEASAIRASQIALTAKAELDKTILAANKAGNNATEATAAANTATTEANTRKD
                     ANSARKADEAGRKAKMAATAALQLAEETARKASLAEMAGDEALEAATRVSGDIAKRAE
                     DAGYAAKESAKSGFKVAEETRKKATLADEAGDAAIHASMSIIQDLINRAEQVGIDAKR
                     SAEDFAKISRSQAEAMMRDAQMKAAAEVEKARRAAEDAGAKAESIANAAKLAAEEAMS
                     KAQEALVKAVIKRLTSWEWISILVIINLSIVFAAVLLATAFGALI"
     gene            complement(675466..676872)
                     /locus_tag="DEHABAV1_RS03600"
                     /old_locus_tag="DehaBAV1_0683"
     CDS             complement(675466..676872)
                     /locus_tag="DEHABAV1_RS03600"
                     /old_locus_tag="DehaBAV1_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309241.1"
                     /db_xref="GI:499628507"
                     /translation="MENKSPALGQHVDQPGPKIMTKPLPIILDEMEANIRAAAEAARR
                     AEEAAKQASASAGTSMRAAEVAEKRAEDARLAGENAAAVAKKAAAEAVAKAAEATAKA
                     QEAILRSVEADRAAVKAAETFKKAAEEASEKARASAAEAAAQASLSAEEAARRAEEAA
                     MRAEETARAAIYAAEEATAKADEVARSSKEAALAAQRAAEQAAIRAEEIAKAAKEALE
                     RLIKQAEKNSVEVAAAITAAKSAGKDATIKLTTEAGKTADDAGRKAKEMAISALHLSE
                     QLSHKAEMADVAGDEAIEAATKVSGKLATAVDEAGRMAKESAANGFKIAENMAQQAVS
                     ADKAGDDAIRTAMSILQELASRAESTAKSAAERATGAEATAKAAAERATGAETTARAA
                     ADRAVAEVSRVRQTAEEVAQSARRAAEEALAKAEEALVKAVIKRLTSWEWIVILVVIN
                     LSIVFAAVLIATALGALI"
     gene            complement(677376..677460)
                     /locus_tag="DEHABAV1_RS03605"
                     /old_locus_tag="DehaBAV1_R0017"
     tRNA            complement(677376..677460)
                     /locus_tag="DEHABAV1_RS03605"
                     /old_locus_tag="DehaBAV1_R0017"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(677424..677426),aa:Leu,seq:tag)
     gene            677558..677926
                     /locus_tag="DEHABAV1_RS03610"
                     /old_locus_tag="DehaBAV1_0684"
     CDS             677558..677926
                     /locus_tag="DEHABAV1_RS03610"
                     /old_locus_tag="DehaBAV1_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929018.1"
                     /db_xref="GI:500358968"
                     /translation="MIVLFGNKSYFDILGYMVTTCPGCKTTSVMTVEQQRKKLTVYFI
                     PTFDFSRKQYMYCGHCHERFEIDKSLQSTVKARLLSKKQMEKLMVELEMEKPRYECAN
                     CESRIEAGMKFCPQCGNNLG"
     gene            677937..678599
                     /locus_tag="DEHABAV1_RS03615"
                     /old_locus_tag="DehaBAV1_0685"
     CDS             677937..678599
                     /locus_tag="DEHABAV1_RS03615"
                     /old_locus_tag="DehaBAV1_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309243.1"
                     /db_xref="GI:499628509"
                     /translation="MYENIAQNVRDILAELPPDVVLVAAVKKRQPAEILAAIAAGVKI
                     IGHNYLSEAEETYPFIGDKAEWHFIGKLQSNKCKKIVRLFSVVETVDSFEIASELNRR
                     AAEIDKVMSVFIEINSGREKQKSGVLPEETVELAKRISGLSNLKLAGLMTMGPALEDP
                     EELRTIFRLTKIKFDEIAVMGLPNTELKFLSMGMSVSYKVAVQEGTNLVRLGTRIFGN
                     RP"
     gene            complement(678596..679255)
                     /locus_tag="DEHABAV1_RS03620"
                     /old_locus_tag="DehaBAV1_0686"
     CDS             complement(678596..679255)
                     /locus_tag="DEHABAV1_RS03620"
                     /old_locus_tag="DehaBAV1_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-diketo-5-methylthio-1-phosphopentane
                     phosphatase"
                     /protein_id="WP_011309244.1"
                     /db_xref="GI:499628510"
                     /translation="MPFSHNPKLMFQSDFDGTLTEGDVSFLILEKYAQGDWCAILREY
                     QQGKISVGDFNYRAFALVKEDRETLVEFIRKNAVPKKGIYELINYCRQENIRFSVVSN
                     GLDFYIHTMLEELGFKDIEINAARTLFTSNGLDARYYGPDGKMVENGFKESYTNHFIS
                     QNYQVIYAGNGPSDFPPAKLCEYTFATDMLLDRFKQSNLPCYPFQDLHDVVSRLKTIP
                     R"
     gene            complement(679279..679782)
                     /locus_tag="DEHABAV1_RS03625"
                     /old_locus_tag="DehaBAV1_0687"
     CDS             complement(679279..679782)
                     /locus_tag="DEHABAV1_RS03625"
                     /old_locus_tag="DehaBAV1_0687"
                     /EC_number="3.5.1.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FRA7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_011929019.1"
                     /db_xref="GI:500358969"
                     /translation="MAIRRICELPEPVLRKKAKKVPSIDGSIQTLIDDMIETMNSADG
                     AGLAAPQVGVSLRLVVFREPDTKEATVLINPEIIKKEGQRQVTEGCLSIPGYFGELTR
                     AETVTAKGLDRHGKACRIKGTGIVAQLLEHETEHLDGILYIDHLESEDQLHEIGPDDE
                     MPEEIRE"
     gene            679908..679984
                     /locus_tag="DEHABAV1_RS03630"
                     /old_locus_tag="DehaBAV1_R0018"
     tRNA            679908..679984
                     /locus_tag="DEHABAV1_RS03630"
                     /old_locus_tag="DehaBAV1_R0018"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:679942..679944,aa:Pro,seq:ggg)
     gene            complement(680068..680871)
                     /locus_tag="DEHABAV1_RS03635"
                     /old_locus_tag="DehaBAV1_0688"
     CDS             complement(680068..680871)
                     /locus_tag="DEHABAV1_RS03635"
                     /old_locus_tag="DehaBAV1_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011929020.1"
                     /db_xref="GI:500358970"
                     /translation="MANKKVKQSESNQLQTFKKLRVYNLVMGSFHLAQSILILFLSNN
                     FSLPVTTNFIGGGPGGITFKPPEMLFDLPIGPMVAIFLLLSAIAHFLLSSPGVFEWYK
                     TNLSKGINYARWYEYALSSSVMIVLIAMLSGIYDVATLIAIFGANAAMNLFGLMMELH
                     NQTTPKTNWLSYTFGCFAGFMPWVAISIYFFGAISQASDNIPTFVYFILPTLFIFFFS
                     FALNMWLQYKKVGKWRDYLFGERVYILLSLTAKTALAWQVFGGALAGGS"
     gene            complement(680929..681330)
                     /locus_tag="DEHABAV1_RS03640"
                     /old_locus_tag="DehaBAV1_0689"
     CDS             complement(680929..681330)
                     /locus_tag="DEHABAV1_RS03640"
                     /old_locus_tag="DehaBAV1_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929021.1"
                     /db_xref="GI:500358971"
                     /translation="MSGLLVYLIVLVLIFVLDLIWIGLIAKKFYVTELSPIARWSGGG
                     MSPDWPSAILVYLLISLGIVAMALPLAEDNIFAALAYGGLFGFITYGIHDLTNYSTLN
                     SFSLKMALVDIGWGTFLGAAAGLTGGILYSL"
     gene            complement(681340..681999)
                     /locus_tag="DEHABAV1_RS03645"
                     /old_locus_tag="DehaBAV1_0690"
     CDS             complement(681340..681999)
                     /locus_tag="DEHABAV1_RS03645"
                     /old_locus_tag="DehaBAV1_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011309248.1"
                     /db_xref="GI:499628514"
                     /translation="MQIYEKTINVVIGTTNLPGDLAIPPEPIGLVIFVHGSGSNHQSP
                     RNRQVAHQLNSYGLATFLFDLLTPKEDMVDILIANTRYNFRFLADRVIKVTEMLKARE
                     ETQDLPLGYFGASTGAAVALYASALLPRQIKAVVSRGGRPDLARELLPMVESPTLFIV
                     GENDSQVLKLNTQSQKQMRAPNHLCILPGAGHLFEEPGALEKVAELAGGWFIEYMEKQ
                     V"
     gene            complement(682448..684574)
                     /gene="hppA"
                     /locus_tag="DEHABAV1_RS03650"
                     /old_locus_tag="DehaBAV1_0692"
     CDS             complement(682448..684574)
                     /gene="hppA"
                     /locus_tag="DEHABAV1_RS03650"
                     /old_locus_tag="DehaBAV1_0692"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929022.1"
                     /note="pyrophosphate-energized proton pump;
                     pyrophosphate-energized inorganic pyrophosphatase;
                     H+-PPase; can cleave pyrophosphate to two phosphates; can
                     generate a proton motive force and drive pyrophosphate
                     synthesis when PMF is sufficient; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase"
                     /protein_id="WP_011929022.1"
                     /db_xref="GI:500358972"
                     /translation="MDLSWLVWTAGLIAVLFALYLIRDVMRRDSGTPAMQDIAGRILE
                     GAVAFLRRQYRTIAILAVVAAVAVGAVVGLLGGERGLEAYGITGIGIAWRTALAFLAG
                     ALCSGISGVIGMYISVKSNLRCAAAAAKGGLSEAVTVAIRGGAVSGFLIVALSLLGVA
                     GIYYMYGGNPEVTPHLIIGFGFGASFVALFAQLGGGIYTKAADMGADLVGKVEAGIPE
                     DDPRNAAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGITLYLATGNAAWVLFP
                     LVVRAFGILASIVGIMFVRGKDNESPMNALNRGYFTAVGLSIIGIFIANQTIGGDLWL
                     FGAGVIGILTSVAMVFITQYYTEFRYKPVQEIANASRTGAATNIVSGTAVGLETAMPT
                     AITIGAALLLSYWMGGQTGIAGGAVFGTAAATMGMLMTCPFILAMDTFGPITDNANGV
                     IEMAGVGGKVRKITDRLDAVGNTTKALTKGYALASAGLAAFLLFEAYLERVAFLRGET
                     EMMAVDLSRIEVFVGGLLAVALVFFFSAVAIKAVGRTASKIIEEVRRQFKADPGILAG
                     TSRPDYARAVDITAAAGLREMIFPGLLPVLSPIVLGVFLKLTGYDSAMAIAGFLMVGT
                     IGGIMMAAYLNNSGGAWDNAKKYIETGEMLEKDGSPVLKHTVTHAATVVGDTVGDPFK
                     DTAGPSIHVLIKLLSTITLVLAPLFI"
     gene            684764..684994
                     /locus_tag="DEHABAV1_RS03655"
                     /old_locus_tag="DehaBAV1_0693"
     CDS             684764..684994
                     /locus_tag="DEHABAV1_RS03655"
                     /old_locus_tag="DehaBAV1_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011929023.1"
                     /db_xref="GI:500358973"
                     /translation="MGIASFVIGLFSLVSMVVGLIPLLGTINFFNFFFALIGLGLGVG
                     GMLHSPRHRLSLAGIVLCGLSLVLGFVKYILG"
     gene            complement(685062..685391)
                     /locus_tag="DEHABAV1_RS03660"
                     /old_locus_tag="DehaBAV1_0694"
     CDS             complement(685062..685391)
                     /locus_tag="DEHABAV1_RS03660"
                     /old_locus_tag="DehaBAV1_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011929024.1"
                     /db_xref="GI:500358974"
                     /translation="MIKTSTGLQENIAGLLCYVLAWISAIIFLILEKDNKFVRFHAYQ
                     SLVVFGSLQIIGLVLTIIPLLGVFISWAISVLSFILWIVLIVKASQGLKYKLPIAGDI
                     AERWANK"
     gene            complement(685463..686602)
                     /locus_tag="DEHABAV1_RS03665"
                     /old_locus_tag="DehaBAV1_0695"
     CDS             complement(685463..686602)
                     /locus_tag="DEHABAV1_RS03665"
                     /old_locus_tag="DehaBAV1_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_011929025.1"
                     /db_xref="GI:500358975"
                     /translation="MKSSFKLGRILGIEIGIHASWFIIFALLSWSLAVAYYPSIDENI
                     SPFTGWTLGILSSLLLFSSVLAHELGHSFIAIRQGIPVKSIDLFIFGGVSNLTKEPDN
                     PAAEFRMAISGPAVSIVLALVFWVFQIVFSSQNATLAGVFLYLAQINAMLAIFNLIPG
                     FPLDGGRVLRAIIWNASNDIRRATRISAGVGLGFAYLLIFGGIAAAFLGIGISGLWLA
                     LIGWFLASAAQGSFQQTVISEILREVNVSRVMKREFKTIEPDNTLHQALHEYILPLNQ
                     RALPVFENGKLAGLISLSDIKKIPTNQLNQTSVRQAMTPFEKLRTVGPEEHLGNVLNL
                     LQSEDINQLPVLSEGKLIGLISRTNLIEYLQMRQEMETGQLNSKH"
     gene            complement(686629..687429)
                     /locus_tag="DEHABAV1_RS03670"
                     /old_locus_tag="DehaBAV1_0696"
     CDS             complement(686629..687429)
                     /locus_tag="DEHABAV1_RS03670"
                     /old_locus_tag="DehaBAV1_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_011929026.1"
                     /db_xref="GI:500358976"
                     /translation="MQNSGINLDEALNQYLNDNSNKKIHQNSLVHFTRWCGKDKLVCR
                     MTAIEVSRYPECISSSDKEVSVKLQSIRAFLTYLNEQGWVDYNLSSHIKIKKLASRKS
                     ATRTSQNAVEKIPMTASGYKKLEDELCILKVKRIAVIEEMRLAALDKDMRENAPYHAA
                     KEQRGQIEGRIKEIEHELKHAEVSEYTDNNTSKVNMGNTVKLRDLKNGEQCIYTLVSP
                     KEIEPLKGRISASSPIGKALFNRSKGDNIEIEVPSGTLQYVIEDISFK"
     gene            complement(687460..688599)
                     /locus_tag="DEHABAV1_RS03675"
                     /old_locus_tag="DehaBAV1_0697"
     CDS             complement(687460..688599)
                     /locus_tag="DEHABAV1_RS03675"
                     /old_locus_tag="DehaBAV1_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_042377719.1"
                     /db_xref="GI:755024770"
                     /translation="MNTDVLVIGAGPVGLHTAKCLAECGYEVRLLEKKPEAAKQVCCT
                     GIISTECASKYGFDGKYIQNYFSEASVYSPVGQKLLLKRDTPQAIMLDRASFQAKLLQ
                     QAINCGVRTSFGFQANSIEYIENGLRITTKEGQSFTAKAVVLAAGYNTALSRATGLGE
                     INNFAYGLQAEVDTSIPANLSLFTGKAISQGYFGWLSPINDCTAKMGLLTRKNPFECW
                     SALHNTLYKQGLITAKHINYVCRPVPIGNLSASFGDRVLAVGDFAGQLKPTTGGGIYF
                     GLLCADLAVSCLDKNIKTNKISKANLAEYEKNWKSLIGSELYIGRLLSRAYTGIDDRL
                     LEQIFKKCATSGMIEKMAAKSHLGFDWHGKAFGHLLKNPFDLVRS"
     gene            688740..688976
                     /locus_tag="DEHABAV1_RS03680"
                     /old_locus_tag="DehaBAV1_0698"
     CDS             688740..688976
                     /locus_tag="DEHABAV1_RS03680"
                     /old_locus_tag="DehaBAV1_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929028.1"
                     /db_xref="GI:500358978"
                     /translation="MIVTVTSVTTATAAGLASVIGGVSLAALIVFLIAREMALARKSD
                     FSMRIARYLHISILPLFLVMGVIVITRVMETLAQ"
     gene            complement(688965..689705)
                     /locus_tag="DEHABAV1_RS03685"
                     /old_locus_tag="DehaBAV1_0699"
     CDS             complement(688965..689705)
                     /locus_tag="DEHABAV1_RS03685"
                     /old_locus_tag="DehaBAV1_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX prenyl protease domain-containing protein"
                     /protein_id="WP_011929029.1"
                     /db_xref="GI:500358979"
                     /translation="MPSALFYLLIITTAEIVTVAFHPLLGLGIYTVLLFSIIIQVAKT
                     NRFHPDRLILALSLVALIRIISLAMPLSDIPQIWWYPIIYLPLLIATIMVAKMLEYTF
                     KDIGLIWGKIPVQILIGLTGIGLGFAEYAILKPDAIAETLNWSNLILPGIILLLTTGF
                     VEELIFRGVLQKAALDSFGSRGIIYISLIFAVLHIGFFSILDIFFVFGVALVFGYLVK
                     KTGSILGVTIAHGLTNIILFAIAPLLLG"
     gene            complement(689698..690810)
                     /locus_tag="DEHABAV1_RS03690"
                     /old_locus_tag="DehaBAV1_0700"
     CDS             complement(689698..690810)
                     /locus_tag="DEHABAV1_RS03690"
                     /old_locus_tag="DehaBAV1_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M50"
                     /protein_id="WP_011929030.1"
                     /db_xref="GI:500358980"
                     /translation="MEQGINIGKLFGIQFRLHYGWFIIFGLVSVFLATQVFPDTLDNA
                     TNLQLWIMGICTSLLFFASVIVHELAHSLVGKANGMKVKSITLFIFGGAANMSEEAET
                     AGSEFKMALAGPAASLGLSGIFYVLYINLNGQSPELAIMNYWLAQINLILAVFNLIPG
                     FPLDGGRILRAVFWQTTKDLAKSTRISTIAGQIFGYLFILAGVFILIRTQDWLSGIWL
                     GLLGWYLSDTARNSLRQYTLQQILKRVTPVEVVASDIPRAKSTQIFADYLTQTPNGDY
                     ILVEDENGLAGIINQHSLKNKDNLKSTLAELYTPINEIPVIPSDTNALDIARRMNEDK
                     IEIVRLASEDTRVSFITLDSLIAYMNKASEKGFTDA"
     gene            complement(690846..692141)
                     /locus_tag="DEHABAV1_RS03695"
                     /old_locus_tag="DehaBAV1_0701"
     CDS             complement(690846..692141)
                     /locus_tag="DEHABAV1_RS03695"
                     /old_locus_tag="DehaBAV1_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase"
                     /protein_id="WP_011929031.1"
                     /db_xref="GI:500358981"
                     /translation="MTQLKQARKGIVTPEMEAVAKTEGLQPEFILKGIADGNIVIPVN
                     KLRKNLKLCGIGKGLSTKVNANIGTSTDFGSVASEVEKLKMAEMVGADTIMDLSTGPK
                     INTIRKAILENTCLPLGTVPVYQAAVEAKDRYGAMVKMTADDLFGAIESQAREGVDFV
                     TVHCGVTRQVIDTFKGQGRLTDIVSRGGTFTAGWMVFHGAENPLYEHFDRLLDICREY
                     DVTLSLGDGLRPGCIADATDRAQVAELLVLGELVKRAREAEVQVMVEGPGHVPLNQIE
                     ANVRLQKSICEDAPFYVLGPLVTDIAPGYDHITGAIGGAIAAAAGADFLCYVTPAEHL
                     SLPDVTDVRNGVIASRIAAHAADIVKGVNGAAERDRQMAIARKKLDWETQLKLSLDPE
                     HARVTRDRFKTRGKACSMCGDFCAMELAEKHLGVSVSRC"
     misc_binding    complement(692193..692288)
                     /note="TPP riboswitch (THI element) as predicted by Rfam
                     (RF00059), score 56.54"
                     /bound_moiety="thiamin/thiaminpyrophosphate"
     gene            692369..693076
                     /locus_tag="DEHABAV1_RS03700"
                     /old_locus_tag="DehaBAV1_0702"
     CDS             692369..693076
                     /locus_tag="DEHABAV1_RS03700"
                     /old_locus_tag="DehaBAV1_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXE0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase G"
                     /protein_id="WP_034377006.1"
                     /db_xref="GI:736351209"
                     /translation="MNELVYGLSALGISLNSVQLGQFETYYQELVDYNSRINLTAITE
                     YKDVQIKHFLDSVSLVLAGIKGDEKLLDVGSGAGFPGLPLKILFPAIQLGLLEATQKK
                     ARFLSEITVKLGLSGVEIISQRAEDTAQNPLYRQKYSLVTSRAVADMATLAELTLPFC
                     AIGGRVIAPKKGDIEEEMDRAATAVKKMGGRVFKVIKVELPGLEDGRKLVLLEKISNT
                     PALYPRRAGIPAKTPLI"
     gene            693082..693275
                     /locus_tag="DEHABAV1_RS03705"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            693295..694824
                     /locus_tag="DEHABAV1_RS03710"
                     /old_locus_tag="DehaBAV1_0703"
     CDS             693295..694824
                     /locus_tag="DEHABAV1_RS03710"
                     /old_locus_tag="DehaBAV1_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011929033.1"
                     /db_xref="GI:500358983"
                     /translation="MPELLTDDLNALLEVLPPHIRQPLTDPANRENLIEIVMDLGRTP
                     EARFPDREIILSERDVTQEDIDYVSSRTGDFGDDNRAGIERTLHRISAIRNRKGKIVG
                     LTLRVGRAVFGTIKIIQDLIKSDQSVLMLGRPGVGKTTMLREVARVLAGDLKKRVVIV
                     DTSNEIAGDGDIPHPAIGHARRMQVRTPDMQHAVMIEAVENHMPQVIVIDEIGTELEA
                     LAARTIAERGVQLVGTAHGNVLDNLMLNPTLSDLIGGIQSVTLGDEEARRRGTQKTIL
                     ERRAPPTFQVIVEIQDRNKVAVHPDVGAAVDSILRGVSPSAEIRYLDGNGEVVISKQQ
                     PSEEKVKSAPESLPVFRGKELPIMYLFGVNRSRMEEIAREMHLDIRISERLEQAQLMV
                     TSRNYYRSKPQRVRDAENMNIPIYVLKSHTPGQFQQLLATLSGRDVAYAVEKPPEIDV
                     AIHEAEEAVAQVKTSHIPVELSPQGAYIRRFQHIIAEKEHLSSHSLGREPHRRVRISR
                     G"
     gene            694827..695453
                     /locus_tag="DEHABAV1_RS03715"
                     /old_locus_tag="DehaBAV1_0704"
     CDS             694827..695453
                     /locus_tag="DEHABAV1_RS03715"
                     /old_locus_tag="DehaBAV1_0704"
                     /EC_number="2.7.4.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5FR84.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="WP_011929034.1"
                     /db_xref="GI:500358984"
                     /translation="MSLFITFEGGEGCGKSTQSKALYRYLKKKGLGCVLTHEPGGSKS
                     GDKITRLLKWSKEEHISPLTELLLFNASRSILIDNVIKPALQDGKIVICDRYTDSTLA
                     YQGYGRGLDLDTVKCVNSLASGGLVPDLTIWLDMDDKAALLRKGELPPDRFESENNGF
                     HQRVRNGFGAIYATEPDRFLKLDASLPQSEIFSRIKQRVTILLGCRNE"
     gene            695446..696519
                     /locus_tag="DEHABAV1_RS03720"
                     /old_locus_tag="DehaBAV1_0705"
     CDS             695446..696519
                     /locus_tag="DEHABAV1_RS03720"
                     /old_locus_tag="DehaBAV1_0705"
                     /EC_number="2.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-specific 2-thiouridylase MnmA"
                     /protein_id="WP_011309263.1"
                     /db_xref="GI:499628529"
                     /translation="MSDSSELVMVAMSGGVDSSVTAMLLLEQGYNVAGVSLQLKSNNE
                     PYGNGYNLKLINRAREVAAALNIPHYVVDLSDIFSQRVIADFCQQYSQGRTPNPCIRC
                     NYYVKIGALLNKIQDFKADYLATGHYARIVSDENGTHLLRGADGKKDQSYFLYTLPPE
                     SLSRLMFPLGQKYKKDIVRLATNMKLPVSQKESQDVCFIPDGDYKSFLATRMGFTPGK
                     ILDTTGKILGEHQGLPLYTVGQRQGLGLASNEKLFVSDMNADANTITVAGHDQLYTSR
                     ILLSNFIWRESGIPLDTSGMIVKVRYKAAPAEVKKISQSGDFYILELASPVWAATPGQ
                     AAVIYLDDMVLGGGIIESGGDTI"
     gene            696521..697159
                     /locus_tag="DEHABAV1_RS03725"
                     /old_locus_tag="DehaBAV1_0706"
     CDS             696521..697159
                     /locus_tag="DEHABAV1_RS03725"
                     /old_locus_tag="DehaBAV1_0706"
                     /EC_number="3.1.26.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXD6.1"
                     /note="cleaves the the RNA-DNA junction of a RNA-DNA/DNA
                     heteroduplex; does not have RNase H activity; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="WP_011929036.1"
                     /db_xref="GI:500358986"
                     /translation="MPATVICPSRAEEKLLRKQGFILIAGLDEAGRGCLAGPVVAGAV
                     IMPPRLKGDWVEMVRDSKVLSPAKREYLYCHIVSMAVTFGVGAVDNEQIDSMGIAPAT
                     RLAMKQAVEDLTCQPDFLLVDYLKLPDIPLPQKGIVDGDALCFSIACASIVAKVSRDR
                     LMSKLDMEYPGYYLAKHKGYGTALHVECICQKGISPIHRRTFAPLKGMIDGL"
     gene            697149..697514
                     /locus_tag="DEHABAV1_RS03730"
                     /old_locus_tag="DehaBAV1_0707"
     CDS             697149..697514
                     /locus_tag="DEHABAV1_RS03730"
                     /old_locus_tag="DehaBAV1_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXD5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011309265.1"
                     /db_xref="GI:499628531"
                     /translation="MAYNRKETGEFGEKLAAEYLKGMGYSIIQTNCRLPEGEIDIVGQ
                     DGEYLVFIEVRTKRRLGYGLPAESVTPRKKAHLMASAESYIQKHRLEHFPCRIDFVSV
                     DLSQPEPRLELIKNALGEE"
     gene            697550..698608
                     /locus_tag="DEHABAV1_RS03735"
                     /old_locus_tag="DehaBAV1_0708"
     CDS             697550..698608
                     /locus_tag="DEHABAV1_RS03735"
                     /old_locus_tag="DehaBAV1_0708"
                     /EC_number="2.5.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="WP_011929037.1"
                     /db_xref="GI:500358987"
                     /translation="MDNLEKLWRIVDVNQNRLSEGLRILEEIARLYLENETLTLRLKN
                     LRHALTLQDTASNCHLLFSRQADTDIGAHLKTVDQSKPETLFSLISANAKRAEQSLRV
                     LEEFAGLLELGFDTSIYSRGRFELYTLEKDLAAILLRKNRRDMIKGLYVAIDVDYLAG
                     RDIPRVTKEVLEGGCRLVQLRAKTASARQFLSLALSLKELCIEYGAVFIVNDRLDIAL
                     ACGADGLHLGQTDLPLSQARCLMPAGSIIGISADSPEDAASAQAGDADYVAAGAVFPT
                     QTKLDVLYGGLSGLKAIRQVVNIPLVAIGGINKSNYNEALQAGADSLCLISAVLGAPD
                     IKKATSEFMTLVEAEKND"
     gene            698601..699254
                     /locus_tag="DEHABAV1_RS03740"
                     /old_locus_tag="DehaBAV1_0709"
     CDS             698601..699254
                     /locus_tag="DEHABAV1_RS03740"
                     /old_locus_tag="DehaBAV1_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_011929038.1"
                     /db_xref="GI:500358988"
                     /translation="MTNISVKMEQISDSIRENFKTRDAAREKSLPISREAIQYCSLAI
                     RAVHRQELAQAREMLVSARALIKEAGQAIDDCGELSNTTFFLDAQKEYAEANTVLALV
                     NGKDMPSPEELEVDNAAYLNGIGEAAGELRRYILDGLRKGEDTRGEELLQAMDDIYEV
                     LVTMDFPDAITGGLRRTTDMVRGVLERTRSDLTLYIQQKGLEQKLEVFQSKLTRKGE"
     gene            699259..701298
                     /locus_tag="DEHABAV1_RS03745"
                     /old_locus_tag="DehaBAV1_0710"
     CDS             699259..701298
                     /locus_tag="DEHABAV1_RS03745"
                     /old_locus_tag="DehaBAV1_0710"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_011929039.1"
                     /db_xref="GI:500358989"
                     /translation="MSIWIALVVGLVGLAVAGLLAKFVLKQDEGTPKVREIAAAIKEG
                     AMAFITREYTVMAIFVAAVTIILAFLPSLGWPVSVSFLFGALCSGLAGFIGMSIAVRA
                     NSRTTTAASHSLNQGLKLSFRAGSVMGMCVVGIGIIGLSIMYFAFGSDVDFIKILPGY
                     GFGASSVAIFARVGGGIFTKAADTGADIVGKVEKGIPEDDPRNAAVVADFVGDNVGDV
                     AGMGADLFESYVDSIIATMALATIGAFSMKLGYALVPSQEAAFFLPMLVAAGGILASV
                     IGIFLVRTGEKLQMKALLAALRKGTLAAAFLSAVFSFLAVWYLQADFGLFFAILAGLV
                     AGVLIGESTNYFTSYVYKPTLGIAASCQTGAATNIISGFSVGLMSVVPPIVLVVIAIV
                     ISYAFGDVYGVALAGVGMLATLGIQDATDAYGPVADNAGGIAEMSGLPKEVRERTDAL
                     DSLGNTTAAIGKGFAIGSAGLTSLALLLSYTQAVGISASQVSLLDVKVLAGLLLGVMM
                     PAVFCSLTLKAVGVTSFSIVNEVRRQFKEIAGIMEGTAKPEYGKCVDICTRDSIKQMI
                     LPGVITVVSPVIVGWLLGPVAVVGFLTGTILCGFILAVTFANAGGAWDNAKKWVETGA
                     YGGKGSDAHKAAVVGDTVGDPMKDTAGPSLNIMIKLVAIIALVMAPILANFSGII"
     gene            complement(701311..701928)
                     /locus_tag="DEHABAV1_RS03750"
                     /old_locus_tag="DehaBAV1_0711"
     CDS             complement(701311..701928)
                     /locus_tag="DEHABAV1_RS03750"
                     /old_locus_tag="DehaBAV1_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactamase"
                     /protein_id="WP_042377956.1"
                     /db_xref="GI:755025013"
                     /translation="MLNRKLRLGLLGTNCYILGDEESRHGLIIDPAAISDSIPETVTE
                     YHLDVKYILLTHGHLDHLAGLEYARKLYPEAKLCFHPADASLSENVELISYLGMSALP
                     TLAPDIPLSEGSTLELGKIKFSVISIPGHTPGGICLYTRGYLFSGDTLFNSGIGRSDF
                     EESDTEALRQNIINRLLSLPPETLVFPGHGRETTIGKEKTGNPFI"
     gene            702035..702580
                     /locus_tag="DEHABAV1_RS03755"
                     /old_locus_tag="DehaBAV1_0712"
     CDS             702035..702580
                     /locus_tag="DEHABAV1_RS03755"
                     /old_locus_tag="DehaBAV1_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929041.1"
                     /db_xref="GI:500358991"
                     /translation="MSIDNQPNLPAASFRFRPVYFMAPLMVLVISLLLTAVYYGRLPS
                     DVAYRFSIDGAPVTYIDAGLITGVLLGVQFLLVLFAFGLAVFLPRLGFFKNNQTDFWV
                     KPGTLLGFMGNIMAVPQLILAYALLDVFVYNVHQIHLLPLWLFAIILIVIAAIVIGIF
                     AIPVFVRAYKTFNGPSASKKE"
     gene            702617..703918
                     /locus_tag="DEHABAV1_RS03760"
                     /old_locus_tag="DehaBAV1_0713"
     CDS             702617..703918
                     /locus_tag="DEHABAV1_RS03760"
                     /old_locus_tag="DehaBAV1_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="WP_042377959.1"
                     /db_xref="GI:755025016"
                     /translation="MDKIVSLARRRGFIFPSSEIYGGLNSCWDYGPLGVELKRNVKEA
                     WWRYMVRDRDDVVGLDASIIMHPRVWEASGHVAGFSDPMVDCKKCKMRWRPTDLAEPK
                     CPACGGELTESRQFNLMFKTFMGPIEEAASIVYLRPETAQGIFVNFENVLNTTRKKLP
                     FGIAQIGKSFRNEITTGNFIFRSREFEQMELEYFVKPGADDSCLEEWTQYRLNWYKNL
                     GMNPENLRLRAHRSDELAHYAKGCYDVEYNFPMGWSELEGIANRRDFDLTQHAKYSGK
                     SLEYFDEETKEHFVPYVIEPSAGVERSTLAFLIDAYAEEPDKDEIRTVLHLHPALAPY
                     KIAVLPLSKKEILSDYARKIYADLRKCWMVAYDDSQSIGRRYRRQDEIGTPYCVTVDF
                     QSLEDGMVTVRDRDSMAQIRVKVSELSYILAAKLSGEPFNS"
     gene            703932..705179
                     /locus_tag="DEHABAV1_RS03765"
                     /old_locus_tag="DehaBAV1_0714"
     CDS             703932..705179
                     /locus_tag="DEHABAV1_RS03765"
                     /old_locus_tag="DehaBAV1_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease SbcCD subunit D"
                     /protein_id="WP_011929043.1"
                     /db_xref="GI:500358993"
                     /translation="MKILHFADLHIGVENYGRFDSATGLSSRLADFLTAFDRLVAYAI
                     DKKVDLVVFSGDAYKSRDPSQTQQREFARRVSTLASSGIQVFLLVGNHDQPNAAGRAT
                     TTEIFDTLDIANVHVSGKAEVRLINTRNGPIQIASLPWLRRSSVLSVSNQKEEKNLSI
                     EELNQRVESYLAGIIENLAGQLDKNIPSILSAHLSVNTAKVGSERNISIGHEPTVMLS
                     NIANPAFDYVALGHIHKQQVLSSAPPVIYPGSLERLDFGEEKDDKGFYLVEIDPLSHK
                     TDFVFIKLEGRRFLTIELNLNADSLDPTLEVINILQARQQDIKDAIVRLKLELPAEIG
                     GQLRDSDIREALREAHNFTISKNVIRLTRQRADGFKVEGLDPIQALEHYLEIKQTSAQ
                     EKKTLLEYGRRLYSTLDSKQTKI"
     gene            705203..705952
                     /locus_tag="DEHABAV1_RS03770"
                     /old_locus_tag="DehaBAV1_0715"
     CDS             705203..705952
                     /locus_tag="DEHABAV1_RS03770"
                     /old_locus_tag="DehaBAV1_0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RsuA family pseudouridine synthase"
                     /protein_id="WP_011309273.1"
                     /db_xref="GI:499628539"
                     /translation="MAYNSSSDTSLVKVLVEARLGSRRKMAEAIKQGLVTLNGQKAES
                     YSQPVNTQKDKVTFEGKLVVLSRVRRIYLMLNKPPEIVSTTSDELGRKTVMDLLHRRY
                     EGAGLFPVGRLDEATTGLILLTNDGEMTNRLTHPSYEIEKEYLISIDAALTQADKESL
                     EKGILLDDGLTSPARLSRVTDEPPYNYKLIIHEGKKRIVRRMFARLGHPIKALKRSRI
                     ATLRLGKLEEGKTRELTPGEIAALRRITRLK"
     gene            complement(705945..706679)
                     /locus_tag="DEHABAV1_RS03775"
                     /old_locus_tag="DehaBAV1_0716"
     CDS             complement(705945..706679)
                     /locus_tag="DEHABAV1_RS03775"
                     /old_locus_tag="DehaBAV1_0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl transferase"
                     /protein_id="WP_011309274.1"
                     /db_xref="GI:499628540"
                     /translation="MHRPLVSPIFENRFDAGRQLAEKLSHYKDKSAIVLAIPNGGIPI
                     ATQVALALDADMDMIISRKLPIPLRPEGGFGAVADDGAVMLNHEVVNYLHMTEQQINY
                     TVNKVRAEVQQRSLLYRGHRSLSILNGRIAIIIDDGLASGYTMLAAIESVRRKKPARI
                     VAAVPAASATARKLVEKVADEVITVADGFMPKFYVSDYYRYWNVLDDEQSLKVFKDWQ
                     MRRQNLNLRPENLPPPSMTMRRKPLI"
     gene            complement(706679..708394)
                     /locus_tag="DEHABAV1_RS03780"
                     /old_locus_tag="DehaBAV1_0717"
     CDS             complement(706679..708394)
                     /locus_tag="DEHABAV1_RS03780"
                     /old_locus_tag="DehaBAV1_0717"
                     /EC_number="3.5.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="WP_011929044.1"
                     /db_xref="GI:500358994"
                     /translation="MQTNLSQLIKVARGETEADLVLLNARVINVFNAEIEQTNVAVFD
                     GKIAGVGDYRHGKEVIDLKGAYLLPGLINGHTHVESSMLDIAQYARAVVSNGTLALIT
                     DLHEISNVCGKEGIDYVLDASADLPLSIFLQVPSCVPATHLETAGAEINSQDVADLLR
                     LPNVTGLGEMMNFPGVLFGVPSVLDKIIAATGKVMDGHAPGLSGKDLNAYISAGIHSD
                     HECIHLAEAKEKLARGMYIMIREGSSEKNLAELLPLVTDKTYKRCLFVVDDRSCADLK
                     SDGDIDAVVRKAIRLGLDPVRAIQLASINTAEYFHLQGHGAIAPGYLANMIVCQNLEQ
                     LDIDMVFHKGKLVAEKGQALFKPQSRIPKSLLNSIHIKPFNTEDLVLKTIQPQIPVIE
                     VIPGQIVTRRLDLKITAENGVIKANTELDLLKIVVLERHHQSGNIGHGLIRGFGLKKG
                     AIASSVAHDSHNVVAVGTNDADLYTAIKELERINGGIALAVDGQVTASVSLPVAGLLS
                     TKPLEEVVTELEEINNQVAKLGCKLSAPFATLSFMALPVIPELRLTDLGLVDVKTFKL
                     IPQET"
     gene            complement(708378..708926)
                     /locus_tag="DEHABAV1_RS03785"
                     /old_locus_tag="DehaBAV1_0718"
     CDS             complement(708378..708926)
                     /locus_tag="DEHABAV1_RS03785"
                     /old_locus_tag="DehaBAV1_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012984296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_042377726.1"
                     /db_xref="GI:755024778"
                     /translation="MMNRMKLSLFIPKTEIEVYLERLAYEINRDFKDRPLVVIGVLKG
                     SFVFMADLIRRLNMPVELDFVGLASYGKNTQSCGKVHLTRPLNRDIAEKDILVIEDIV
                     DSGLTVSYLLKYLKKRRTNSVKLCALLSKPSRRVCPVEIDYLGCEVEDKFLVGYGLDW
                     AECYRQLPEIFALEGKPDADKP"
     gene            709211..709876
                     /locus_tag="DEHABAV1_RS03790"
                     /old_locus_tag="DehaBAV1_0719"
     CDS             709211..709876
                     /locus_tag="DEHABAV1_RS03790"
                     /old_locus_tag="DehaBAV1_0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011929046.1"
                     /db_xref="GI:500358996"
                     /translation="MKCLNCSRDFEDNLVESGLLFCPFCGVGQPRGSQNPDINNMTFC
                     SCGQGIVGKVNYCPGCGQMLNPDAPPLERTGRLYKNTTRRETADKTPPVVQEIPEDTE
                     YENDEQSESARRPQVYRDNEETPPSARPARQAYPYYDQHEERSRSRTSRRYAADDDYY
                     EDEEPIRYRNSRRPAKAYREERSYRPNRRNDVMPLLVVLLIAGVGVLGYGIYLLIQNF
                     IGS"
     gene            709971..710888
                     /locus_tag="DEHABAV1_RS03795"
                     /old_locus_tag="DehaBAV1_0720"
     CDS             709971..710888
                     /locus_tag="DEHABAV1_RS03795"
                     /old_locus_tag="DehaBAV1_0720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011309278.1"
                     /db_xref="GI:499628544"
                     /translation="MVIQVQNLVKVYGSIRAVDGISFEVKKGEVFGMLGPNGAGKTTT
                     AEIIEGLRDADSGSVSVMGLDVRKQRDQIKQLIGIQLQAPALLPLLNVEEILKLFTSF
                     YRNSVPVEKLLDMVSLTESRKVLSKNLSGGQQQRLSVAMAMVNNPEITFLDEPTTGLD
                     PQARRGLWSVIEELRSQGKTVFLTTHYMDEAERLCDRIAVVDHGKIIALDTPKKLISG
                     NFKESAIEFEMEPVPSGELLGSFPCVTSASVEGFEVILYSNNVPKTMGAILDYADKNR
                     GNTELRNLHVRQATLEDVFLKLTGRKIRE"
     gene            710885..711967
                     /locus_tag="DEHABAV1_RS03800"
                     /old_locus_tag="DehaBAV1_0721"
     CDS             710885..711967
                     /locus_tag="DEHABAV1_RS03800"
                     /old_locus_tag="DehaBAV1_0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011929047.1"
                     /db_xref="GI:500358997"
                     /translation="MNSFISMLNANFKQFLRDKTALFFTLAFPVLFIIMFGLVFSGTD
                     KISYDVALVNEDNSQISQGITEAFSQVTIFSVKDSPRDESLQLLKDGKLKAVIIIPEG
                     LGIAALSGQTTDIQVYYDGSQTNVNQILLPVIKEILQTINREITQTPVLFQISEETIQ
                     TKDMSMMSFFIPGVLAMSIMFLGLYSAMPLIQQREKKILKRLGASPISRSTIIFSQVV
                     LRLGLAVLQTIIIIVIGQLMFGVEILGNWWLLLGLVMLGTLSFISLGFLVASLAKTEE
                     GAMPIVQLIQFPMMFLSGIFFPLEFMPDFMRPVVNALPLTYLGDAFRQVMVDGAPAFP
                     LGVDLLVVTGWLVVCMAVSIRFFRWE"
     gene            complement(712050..713081)
                     /locus_tag="DEHABAV1_RS03805"
                     /old_locus_tag="DehaBAV1_0722"
     CDS             complement(712050..713081)
                     /locus_tag="DEHABAV1_RS03805"
                     /old_locus_tag="DehaBAV1_0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="WP_011929048.1"
                     /db_xref="GI:500358998"
                     /translation="MKTSDFDYNLPQEYIAQKPAEPRDSSRLLVLNRQSEELTNRIFG
                     EITDYFKPGDVLVMNDSRVLPARIKGIKQDTSAKIEILLLKRDGEGCWEALLKPSKRT
                     KPGTIIDIHQPNGGISTQAKVLADKDDSIKLLRFSDETHLMKLGEVPLPPYIHTPVAD
                     PERYQTVYALTNGSVAAPTAGLHFTPELLKRLTEMGVICTYVTLHIGLDTFRPVKEED
                     PKDHKIHREYGILSKETASAICCAKETGKRVFCVGTSATRLVEQASHLSQTSLITSYS
                     GWADLFILPGYKFRVADCFITNFHLPRSTPLMLTSAFAGWPFLRKAYEKAISEHYRFY
                     SFGDAMLIL"
     gene            713244..714041
                     /locus_tag="DEHABAV1_RS03810"
                     /old_locus_tag="DehaBAV1_0723"
     CDS             713244..714041
                     /locus_tag="DEHABAV1_RS03810"
                     /old_locus_tag="DehaBAV1_0723"
                     /EC_number="3.1.3.6"
                     /EC_number="3.1.3.5"
                     /EC_number="3.6.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase surE"
                     /protein_id="WP_011929049.1"
                     /db_xref="GI:500358999"
                     /translation="MRILVSNDDGIYSPGLWALVKRLKEVGEVIVVAPDREQSATGTQ
                     VTLRQPLRVQKTHPLIPGIEAYAVEGSPCDCVILGLAKLITEPVDLVVSGINHGLNLG
                     DDVLISGTVGAALQGYLRNIPSIAVSIPVTMEEPENLDSAACITAEVSRRIQNGDITK
                     NSFLNINIPDLPLSQIEELRVTPLAHKTHIETVEEGHDGRKRYFWLRRRQLSSADNKK
                     TDIWAIENGYITISALHERLFQQPVFTLKDAETAGILAAARSCQDKI"
     gene            714175..714729
                     /locus_tag="DEHABAV1_RS03815"
                     /old_locus_tag="DehaBAV1_0724"
     CDS             714175..714729
                     /locus_tag="DEHABAV1_RS03815"
                     /old_locus_tag="DehaBAV1_0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929050.1"
                     /db_xref="GI:500359000"
                     /translation="MNKISNGKFLRSLALSSPVLIIAAVSIVFSFSTAFEGKVASSPT
                     GNTDDNTQVTAPIDDTSTDGSVDLTITAETLYSHYVYPGETNPDLYYKSKNIKITGKV
                     AGFVYGTVANSCWISFKTDQSNGANVICYFGNYVIKPGAAITIGMDIEITGTCMGLTN
                     GHVTLINSFTDDIQLIPYDHNLEA"
     gene            714897..715754
                     /locus_tag="DEHABAV1_RS03820"
                     /old_locus_tag="DehaBAV1_0725"
     CDS             714897..715754
                     /locus_tag="DEHABAV1_RS03820"
                     /old_locus_tag="DehaBAV1_0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP oxidoreductase, coenzyme F420-dependent"
                     /protein_id="WP_011929051.1"
                     /db_xref="GI:500359001"
                     /translation="MQSIGFIGAGTVGSALALGLSEKGYPISGIASRTRLSAEKLCRK
                     IPSAKFCNSPQAVVDTADIVFITAPDDTIAEICRSLHWHSNQYVIHCSGAYSLELLQT
                     AQCSGAYTGVLHPLQSFSLQADPVRNLGGITYALEGDDQTLSLLKDMVKVLGGEWIVL
                     KPSDKVAYHVAAVLASNYLVTLIKMATGLWQSFGIPEDKAVKALMPLVRGTLSNIEKA
                     GATNALSGPIARGDCGTVSKHLAALENIAPELIPAYKELGRQTVKIALEKEKPNITGI
                     EKLSRILAN"
     gene            715777..716151
                     /locus_tag="DEHABAV1_RS03825"
                     /old_locus_tag="DehaBAV1_0726"
     CDS             715777..716151
                     /locus_tag="DEHABAV1_RS03825"
                     /old_locus_tag="DehaBAV1_0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXG1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="WP_042377730.1"
                     /db_xref="GI:755024782"
                     /translation="MLKSKIHRATITDACIDYEGSITIDKNLMQAANLLPYEQVHVVN
                     VNNGTRLETYVIEGSAGSGQICLNGAAARMGMKGDKVIILGYSLITEEDTLIHQPNLV
                     YVDALNRITKVKNGVANQGLEV"
     gene            716154..716993
                     /locus_tag="DEHABAV1_RS03830"
                     /old_locus_tag="DehaBAV1_0727"
     CDS             716154..716993
                     /locus_tag="DEHABAV1_RS03830"
                     /old_locus_tag="DehaBAV1_0727"
                     /EC_number="2.1.2.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_011929053.1"
                     /db_xref="GI:500359003"
                     /translation="MRTTISQLKEMKQNKQKIAILTAYDYPTAQILDKAGIPAILVGD
                     SLGMVVLGYDSTVSVTMEDMLHHLKAVVRGSQKALIIADMPFMTYHLSPEQALLNAGR
                     FIQEGGAQAVKLEGGVNVADKVKRIVDCGIPVMGHIGLTPQSVNQLSGFKVQGKTLAT
                     ALSLIEDAKALEKAGAFAIVLETMPAELAAIITAGISIPTIGIGAGEECDGQVQVISD
                     MLGMFTDFIPKHTKRYADLNGIITKAVSEYAAEVTKGAFPTLKESFTLDKKVLEELKK
                     CVL"
     gene            716981..717814
                     /locus_tag="DEHABAV1_RS03835"
                     /old_locus_tag="DehaBAV1_0728"
     CDS             716981..717814
                     /locus_tag="DEHABAV1_RS03835"
                     /old_locus_tag="DehaBAV1_0728"
                     /EC_number="6.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3ZXF9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate synthetase"
                     /protein_id="WP_011929054.1"
                     /db_xref="GI:500359004"
                     /translation="MRIIRTVDEMKKLHREICGPVGLVPTMGYLHEGHLSLVRASKKQ
                     DINTVASIFVNPTQFGPHEDFKKYPRDEKRDMAMLENAGVDYVFAPSVEDMYPAGFDS
                     WVEPGILQQCLEGAIRPGHFRGVCTVVAKLFTIIRPDRAYFGQKDYQQYLIIKRMASD
                     LNLDVSVEMLPIIRENDGLALSSRNTYLSPAERQAALVLYRSLLTARSLFDEKEHRAE
                     VIRKKMTDVIQHESMAEIDYVSLSHQDTLCESDEVSAKTIALVAARFGKTRLIDNMFL
                     A"
     gene            complement(717811..719073)
                     /locus_tag="DEHABAV1_RS03840"
                     /old_locus_tag="DehaBAV1_0729"
     CDS             complement(717811..719073)
                     /locus_tag="DEHABAV1_RS03840"
                     /old_locus_tag="DehaBAV1_0729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011929055.1"
                     /db_xref="GI:500359005"
                     /translation="MEQEIKPAASEKRILGFAPNVFFLGLVSFLTDISSEIIFTLVPL
                     FLANVLGATTTVIGFVGGLSDSTEAVFKIFSGYLSDKINRCKSLALFGYGFSALAKPF
                     MLLANSWGIVTGVRFADRVGKGVRSSPRDALIANSVEPHERGRSFGLHKAMDSLGATL
                     GLGIAAAVIYFTQSGSLTLELETYKTLVWWGIIPAFLAVLVLAVFVKEKHRPQTTSLK
                     GEKVRFNFRNLFLGMDSRFKLFLLVMFLFTLGNSSDYFVILRAQGMGVSVLAISLMLV
                     VFNITYTLVSLPAGMLSDKMGRRKVIAMGWLFYALVYLGFAVTQNQIGIWILFGCYGL
                     YYGIVEGVAKAFVADMIPSDKRGAAYGLYQGVVGLTLLPASLIAGILWDRVGSAAPFY
                     FGAVLALLAVIGLLVFIKEPPKKTPTVS"
     gene            complement(719073..719372)
                     /locus_tag="DEHABAV1_RS03845"
                     /old_locus_tag="DehaBAV1_0730"
     CDS             complement(719073..719372)
                     /locus_tag="DEHABAV1_RS03845"
                     /old_locus_tag="DehaBAV1_0730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_011929056.1"
                     /db_xref="GI:500359006"
                     /translation="MVDREFFLGFIRIHILYHAQNEPIFGAEIARELGRHCYTITAGT
                     LYPLLHRLQAEGYLESFPRVEQGKQRKYYRTTLKGSEMLNECRKQIRELVDEVLE"
     gene            719505..719580
                     /locus_tag="DEHABAV1_RS03850"
                     /old_locus_tag="DehaBAV1_R0019"
     tRNA            719505..719580
                     /locus_tag="DEHABAV1_RS03850"
                     /old_locus_tag="DehaBAV1_R0019"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:719538..719540,aa:Phe,seq:gaa)
     gene            719655..719741
                     /locus_tag="DEHABAV1_RS03855"
                     /old_locus_tag="DehaBAV1_R0020"
     tRNA            719655..719741
                     /locus_tag="DEHABAV1_RS03855"
                     /old_locus_tag="DehaBAV1_R0020"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:719688..719690,aa:Leu,seq:caa)
     gene            719772..719845
                     /locus_tag="DEHABAV1_RS03860"
                     /old_locus_tag="DehaBAV1_R0021"
     tRNA            719772..719845
                     /locus_tag="DEHABAV1_RS03860"
                     /old_locus_tag="DehaBAV1_R0021"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:719804..719806,aa:Gln,seq:ttg)
     gene            719856..719930
                     /locus_tag="DEHABAV1_RS03865"
                     /old_locus_tag="DehaBAV1_R0022"
     tRNA            719856..719930
                     /locus_tag="DEHABAV1_RS03865"
                     /old_locus_tag="DehaBAV1_R0022"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:719888..719890,aa:Asn,seq:gtt)
     gene            720035..721537
                     /locus_tag="DEHABAV1_RS03870"
                     /old_locus_tag="DehaBAV1_0731"
     CDS             720035..721537
                     /locus_tag="DEHABAV1_RS03870"
                     /old_locus_tag="DehaBAV1_0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene dehydrogenase"
                     /protein_id="WP_011929057.1"
                     /db_xref="GI:500359007"
                     /translation="MSSKKVIIIGAGLAGLSAGCYSRMNGYATRIYEHHSKPGGVAAC
                     WRRGEYLIDGGIHFMMGSQNGTDLYNIYRQLGVADPANFVPMKSYGSFIDIEGSRQLD
                     IPLNISELALDLKMLSPADAPLIEDLATAVTAFSGKDLAIYGQMNPPELTSGLDKLTD
                     MWKMRKLFKYMSGKYAKSMQDYTAGMQNRWLAERLNNLFTPQCPVWFVIMLLAIAADG
                     QMSYLAKGCKDFVRQIEKRYKDLNGEVTYSSTVEKILVRDDCAFGVKLADGTEDYADY
                     VISAGDIHNTVFHLLDGKYIGKKLQNKFDTCELSRPYFVASFGVKRTFENESVFNTLI
                     LKQPLQIGNREIRQIFVRIFNYSNHFAPKDKSVIQAEFETEWDYWDNLRQKDPNKYAA
                     EKERLVSEILANLEILYPGISPLVEIADVATPCTLNRYTLNHQGAPEGWGLTSQNFKE
                     ETRRSLEGLSNLYLAGHWVSGGVPGVILSGRQAIQLVCAKEKKPFFTRTT"
     gene            complement(721534..722124)
                     /locus_tag="DEHABAV1_RS03875"
                     /old_locus_tag="DehaBAV1_0732"
     CDS             complement(721534..722124)
                     /locus_tag="DEHABAV1_RS03875"
                     /old_locus_tag="DehaBAV1_0732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidic acid phosphatase"
                     /protein_id="WP_011309291.1"
                     /db_xref="GI:499628557"
                     /translation="MKTKLANYISDIFNPLTLSILFVFLLAKDSTENLWEAVKWSLIF
                     ITLCMLPIFLVILSMVKRGKLQSVFSNPREQRHVLYVLGSVMVGAGLMVLIFIGAPDK
                     LIAALFAGFVSSVLFMIVNFFWKISVHTAFASAFSSIALMLYGYSALGFMLLVPMMAW
                     ARVYLKEHTVGQVTAGALLAGTVIVTVFNIFNMVNI"
     gene            722341..723087
                     /locus_tag="DEHABAV1_RS03880"
                     /old_locus_tag="DehaBAV1_0733"
     CDS             722341..723087
                     /locus_tag="DEHABAV1_RS03880"
                     /old_locus_tag="DehaBAV1_0733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011929058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011929058.1"
                     /db_xref="GI:500359008"
                     /translation="MTGNAISLRDISFNYKHIKALDDLSLEIPGGISFGIMGPNGAGK
                     TTLIRIMVGLLRQKSGYLAILGKEFSRQLEYQLGYMPQAHSLYTELSISQNIDFFARV
                     YGLRDKTLRKARIEEVIRLVDLWERRNDAVMNLSGGMKQRVSLACAIVHNPPVIFLDE
                     PTVGLDPELRCRFWEYFKSLNQKGVTIIISSHTLDDAAHCDRLAFLREGKVIAEGTPA
                     DLKAATGKADASLEDAFLHSIRIGGIPCHE"
     gene            723080..723805
                     /locus_tag="DEHABAV1_RS03885"
                     /old_locus_tag="DehaBAV1_0734"
     CDS             723080..723805
                     /locus_tag="DEHABAV1_RS03885"
                     /old_locus_tag="DehaBAV1_0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011929059.1"
                     /db_xref="GI:500359009"
                     /translation="MNNMLAIAQRLIRQLLHDRRTMALIIVVPVVVMGLIGVSFPDAT
                     VLDYIAPAMLATLALFFSFLLTGISFLRETSQGTMERLMAAPVSRLDIVAGYLLGFFV
                     FALLQTLIIVLFTIYVLGVNFQSELWQILLFQVLIITGAVTLGIFTSSFAKNEFQMVQ
                     FIPLIIVPQIFLCGVIWPVSQMPEWLQYLSNILPLTYGVDGMREIMLEGKNLAEVGFQ
                     CGVLMLFAVITTLLASLTVPKRR"
     gene            723905..724660
                     /locus_tag="DEHABAV1_RS03890"
                     /old_locus_tag="DehaBAV1_0735"
     CDS             723905..724660
                     /locus_tag="DEHABAV1_RS03890"
                     /old_locus_tag="DehaBAV1_0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015407064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011309294.1"
                     /db_xref="GI:499628560"
                     /translation="MDSEILLEVKDLHVEVDGREILHGVDLVLPAGETHVIFGPNGSG
                     KTTLLMTLMGFPRYKITKGQLIFNGKDITHVPLDERARLGIGISFQRPPVVRGVKLRE
                     MVRSSLRAKDDKGLINELAKKANMTDFLERDVNHGFSGGEIKRSELLQLLAQGPDMVL
                     LDEPESGVDLENIALIGSLINELLEKKHPIRERKRGGLVITHTGHILDYVNARTGYVL
                     CHGRINCTGDPRDMLETIKHNGYQECVECPRKI"
     gene            724642..725877
                     /locus_tag="DEHABAV1_RS03895"
                     /old_locus_tag="DehaBAV1_0736"
     CDS             724642..725877
                     /locus_tag="DEHABAV1_RS03895"
                     /old_locus_tag="DehaBAV1_0736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010936545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011929060.1"
                     /db_xref="GI:500359010"
                     /translation="MSPKDLRPNLADTAGAAINKKPAVGDDILLEKYTDNTEAHKYVN
                     KPSELASEDKARMLESGVILDDLKERSGTYIQMDNHPVHFSAQQDGIEIMSTSEAAKK
                     YDWLKDYWWKAVSVDADKYTAHVELNQADGYFIRALPGVKTEFPVQSCMYMAKNQSIQ
                     NVHNIIIAEEGSELHIITGCTSAHRTETGLHLGVTEFYIKKGAKVTFTMIHTWSPDIA
                     VRPRTGAIVEENGVFLSNYVIMKTVKNLQSYPVAYLNGENAVARFNSVMVCPPGSKMD
                     VGSRVFLNAKHTRTELITRALTTGGEIISRGYIEGKVPDCKGHLECRGLILGDKGIIY
                     AIPELMGRVSGVDLSHEAAVGKIAEEEVEYLMARGLNKDEATAAIVRGFLNVDIEGLP
                     PLLKEEMDKAIKLGDQEGM"
     gene            complement(725946..726737)
                     /locus_tag="DEHABAV1_RS03900"
                     /old_locus_tag="DehaBAV1_0737"
     CDS             complement(725946..726737)
                     /locus_tag="DEHABAV1_RS03900"
                     /old_locus_tag="DehaBAV1_0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter"
                     /protein_id="WP_011929061.1"
                     /db_xref="GI:500359011"
                     /translation="MTNRDLPPLIEFKNISLMRGERLCLKNINLVINQGQSLAILGPN
                     GAGKSSLIKTITRELYPIFDPLGSSLRILGRENWDVFELRSQLGIVSAEVLRQDISQT
                     CQEAVLSGYFGSPYLRDAGLISLQMKTYAQDMMNLLEIDHLAERLTDEISSGEARRVV
                     IARALVNNPQSLLLDEPTTNLDMKSAHQLRQLLSKISNLGTQIILVTHNLTDIIPEIN
                     RVVMLKDGSIFRDGAKTEIMTETNFSELFGFEVNLLNKAGFYYLY"
     gene            complement(726826..726898)
                     /locus_tag="DEHABAV1_RS03905"
                     /old_locus_tag="DehaBAV1_R0023"
     tRNA            complement(726826..726898)
                     /locus_tag="DEHABAV1_RS03905"
                     /old_locus_tag="DehaBAV1_R0023"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(726863..726865),aa:Lys,seq:ctt)
     gene            complement(727013..727666)
                     /locus_tag="DEHABAV1_RS03910"
                     /old_locus_tag="DehaBAV1_0738"
     CDS             complement(727013..727666)
                     /locus_tag="DEHABAV1_RS03910"
                     /old_locus_tag="DehaBAV1_0738"
                     /EC_number="2.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011309297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_011309297.1"
                     /db_xref="GI:499628563"
                     /translation="MKITSVEARDLSEAWFLCLRQVLTNGYEYTIERGSYSGQKRKEL
                     DMITVHIKNPGNRPLIPDVPPGVPAPSTMEYIDNYLPYLMTAHRAEGEQYTYGQYLEA
                     QIAKVIKMYRETGFNTNQAFMTVGNPETLDLEDPPCLRSIDTRVRYGKLHFIIYFRSW
                     DLWAGFPSNLAAIQLLKEYMAAEIGVEDGEIIAMSKGMHIYDYAWDIAKTAAGMNGV"
     gene            complement(727678..728385)
                     /locus_tag="DEHABAV1_RS03915"