GenomeNet

Database: RefSeq
Entry: NC_009656
LinkDB: NC_009656
Original site: NC_009656 
LOCUS       NC_009656            6588339 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Pseudomonas aeruginosa PA7 chromosome, complete genome.
ACCESSION   NC_009656
VERSION     NC_009656.1  GI:152983466
DBLINK      Project: 58627
            BioProject: PRJNA58627
KEYWORDS    RefSeq.
SOURCE      Pseudomonas aeruginosa PA7
  ORGANISM  Pseudomonas aeruginosa PA7
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 6588339)
  AUTHORS   Roy,P.H., Tetu,S.G., Larouche,A., Elbourne,L., Tremblay,S., Ren,Q.,
            Dodson,R., Harkins,D., Shay,R., Watkins,K., Mahamoud,Y. and
            Paulsen,I.T.
  TITLE     Complete genome sequence of the multiresistant taxonomic outlier
            Pseudomonas aeruginosa PA7
  JOURNAL   PLoS ONE 5 (1), E8842 (2010)
   PUBMED   20107499
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 6588339)
  AUTHORS   Dodson,R.J., Harkins,D. and Paulsen,I.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2007) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
REFERENCE   3  (bases 1 to 6588339)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-2006) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000744.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..6588339
                     /organism="Pseudomonas aeruginosa PA7"
                     /mol_type="genomic DNA"
                     /strain="PA7"
                     /db_xref="taxon:381754"
                     /note="bacterial strain PA7 was obtained from Paul Roy,
                     University of Laval, Quebec, Canada"
     gene            488..2026
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /db_xref="GeneID:5359197"
     CDS             488..2026
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein"
                     /protein_id="YP_001345397.1"
                     /db_xref="GI:152989598"
                     /db_xref="GeneID:5359197"
                     /translation="MELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNRF
                     VLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQSHVAPPPPVA
                     PPPAPVQPVSAAPVVVPREELPPVAAVSSVTADSYEAEEPSIDPLAVAMPAGAAPAIR
                     TERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLYGG
                     VGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDA
                     LLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWG
                     LTVAVEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHS
                     HFMGRPITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVAR
                     PRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLLR
                     TLTT"
     misc_feature    488..2017
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    488..646
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    1022..>1168
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="Myosin and Kinesin motor domain. These ATPases
                     belong to the P-loop NTPase family and provide the driving
                     force in myosin and kinesin mediated processes; Region:
                     Motor_domain; cl00286"
                     /db_xref="CDD:260327"
     misc_feature    1115..1492
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    1136..1159
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(1139..1162,1325..1327,1427..1429)
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    1142..1165
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238659"
     misc_feature    1313..1330
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    1463..1465
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1748..2017
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1817..1819,1841..1846,1865..1867,1883..1891,
                     1916..1930,1937..1939,1946..1951)
                     /gene="dnaA"
                     /locus_tag="PSPA7_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            2055..3158
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /db_xref="GeneID:5355053"
     CDS             2055..3158
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /EC_number="2.7.7.7"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_001345398.1"
                     /db_xref="GI:152987905"
                     /db_xref="GeneID:5355053"
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSL
                     TGTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPSDVLIDIRVEEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLL
                     EVNGGALRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVIGDRQQLREAFSRTAILSN
                     EKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGT
                     EQVRFILSDSNSSALVHEADNDDSAYVVMPMRL"
     misc_feature    2055..3155
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    2055..3152
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(2124..2126,2271..2273,2292..2294,2649..2651)
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2274..2276,2283..2285,2361..2363,2367..2369,
                     2871..2873,2964..2969)
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2568..2570,2574..2585,3015..3017,3141..3152)
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2568..2570,2574..2579,2796..2798,2901..2903,
                     2940..2945,3024..3026,3141..3152)
                     /gene="dnaN"
                     /locus_tag="PSPA7_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            3168..4277
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /db_xref="GeneID:5357082"
     CDS             3168..4277
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein F"
                     /protein_id="YP_001345399.1"
                     /db_xref="GI:152985186"
                     /db_xref="GeneID:5357082"
                     /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIH
                     LLGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQN
                     ARSAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALR
                     QRNSWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDL
                     TLSYYRGWDKDRDLQDVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQ
                     KLVVCALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCV
                     DPQLLKDGWRTDTPVAMFHVEHGKVSQTTTIGSEA"
     misc_feature    3168..4250
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="Recombinational DNA repair ATPase (RecF pathway)
                     [DNA replication, recombination, and repair]; Region:
                     RecF; COG1195"
                     /db_xref="CDD:224116"
     misc_feature    3174..4247
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    3255..3278
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(3264..3269,3273..3281,3525..3527,4077..4082,
                     4170..4172)
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    3516..3527
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    3978..4007
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    4065..4082
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    4089..4100
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    4158..4178
                     /gene="recF"
                     /locus_tag="PSPA7_0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            4274..6694
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /db_xref="GeneID:5358744"
     CDS             4274..6694
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /EC_number="5.99.1.3"
                     /note="negatively supercoils closed circular
                     double-stranded DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_001345400.1"
                     /db_xref="GI:152984068"
                     /db_xref="GeneID:5358744"
                     /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
                     VVDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHA
                     GGKFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVG
                     ETDGSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFK
                     YEGGLKAFVEYLNTNKSAVNQVFHFNVQREEDGVGVEVALQWNDSFNENILCFTNNIP
                     QRDGGTHLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQMPELIERGYVYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDA
                     SLHVNEHAPGLAGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLAN
                     ESVMQGWLEKFQARLSAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRD
                     FFASNDYRSVSLLGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQR
                     YKGLGEMNPEQLWETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LAVSNLDV"
     misc_feature    4274..6691
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    4385..4690
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(4403..4405,4415..4417,4424..4426,4490..4492,
                     4496..4498,4502..4504,4508..4513,4628..4639,4679..4681,
                     4685..4687)
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    4415..4417
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4502..4504,4508..4510,4628..4630,4634..4636)
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4934..5410
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    5090..5092
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5264..5266,5273..5278,5282..5284)
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5282..5284,5288..5290)
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5531..5875
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5549..5554,5561..5563,5771..5773,5777..5779,
                     5783..5785)
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5549..5551,5771..5773)
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    6464..6658
                     /gene="gyrB"
                     /locus_tag="PSPA7_0004"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(7025..7798)
                     /locus_tag="PSPA7_0005"
                     /db_xref="GeneID:5356224"
     CDS             complement(7025..7798)
                     /locus_tag="PSPA7_0005"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01553"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="YP_001345401.1"
                     /db_xref="GI:152984031"
                     /db_xref="GeneID:5356224"
                     /translation="MSTVQAIRTVLFYLLLSSSAFVWGTLSFFIAPFLPFRARYRFVV
                     RSWCRFAIWLTRVVAGIRYEVRGLENVPEQPCVILSKHQSTWETFFLSGFFEPLSQVL
                     KRELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIP
                     VGQMGKFSRGGTALAVNAGLPVLPIAHNAGQFWPKAGWAKYPGTIQVVIGPAMHAEGE
                     GPRAIAELNQRAEAWVSETMAEISPTQQRVSHPEPSVVS"
     misc_feature    complement(7106..7657)
                     /locus_tag="PSPA7_0005"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(7325..7333,7484..7495,7538..7540,
                     7544..7546,7553..7555))
                     /locus_tag="PSPA7_0005"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(7810..8364)
                     /locus_tag="PSPA7_0006"
                     /db_xref="GeneID:5357146"
     CDS             complement(7810..8364)
                     /locus_tag="PSPA7_0006"
                     /note="Converts the D-glycero-beta-D-manno-heptose
                     1,7-bisphosphate intermediate into
                     D-glycero-beta-D-manno-heptose 1-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="YP_001345402.1"
                     /db_xref="GI:152987801"
                     /db_xref="GeneID:5357146"
                     /translation="MANCASMSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAI
                     ARLSKAGWTVAVATNQSGIARGYYELAVLEAMHARLRELVAKQGGELGLIVYCPHGPD
                     DGCDCRKPKPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRT
                     LGKPLPEGTLIFDDLAAVASALLQ"
     misc_feature    complement(7813..8346)
                     /locus_tag="PSPA7_0006"
                     /note="D,D-heptose 1,7-bisphosphate phosphatase;
                     Validated; Region: PRK08942"
                     /db_xref="CDD:236354"
     misc_feature    complement(7909..8334)
                     /locus_tag="PSPA7_0006"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(8188..8193,8314..8322))
                     /locus_tag="PSPA7_0006"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(8305..8322)
                     /locus_tag="PSPA7_0006"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(8191..8193)
                     /locus_tag="PSPA7_0006"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            8363..8635
                     /locus_tag="PSPA7_0007"
                     /db_xref="GeneID:5356724"
     CDS             8363..8635
                     /locus_tag="PSPA7_0007"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345403.1"
                     /db_xref="GI:152989281"
                     /db_xref="GeneID:5356724"
                     /translation="MNGKGRFYLSQPEHRGWNDEPSPGVLQPRPGLAGDAPLPWLKAL
                     PQPPARHPRWTGADRRDSGNSRCSREYGGSLSAEEKRALLEYLKVL"
     gene            complement(8691..10748)
                     /gene="glyS"
                     /locus_tag="PSPA7_0008"
                     /db_xref="GeneID:5357517"
     CDS             complement(8691..10748)
                     /gene="glyS"
                     /locus_tag="PSPA7_0008"
                     /note="glycine--tRNA ligase beta chain; glyS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking the carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="YP_001345404.1"
                     /db_xref="GI:152989471"
                     /db_xref="GeneID:5357517"
                     /translation="MMSAKDFLVELGTEELPPKALNSLGEAFLNGIEKGLKAAGLSYS
                     AARFYAAPRRLAVLIEQLAVQQPDRTVNLDGPPLQAAFDASGKPTQAALGFAKKCGVD
                     LEQIDKSGPKLRFSQTIAGQPAAGLLPGIVETSLNELPIPKRMRWAARRDEFVRPTQW
                     LVMLFGDEVVDCEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAER
                     RELIAKRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITT
                     MQDNQKYFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDK
                     KQPLESFNERLQNVVFQAQLGTVFDKARRVSGLAAYIAERIGGDAQNAARAGILSKCD
                     LATEMVGEFPEMQGIAGYYYATHGGEPEDVALALNEQYMPRGAGAELPSTLTGAAVAV
                     ADKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVHAAVEQYG
                     DKVKAAGLAEQVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAF
                     RQLPEAEALAAANKRVSNILAKSEDEVPASVDASLLVEAAEKALGSAVANAESEVAPL
                     AAARDYRAALARLAALREPVDAFFADVMVNVDDSSVRANRYALLAKLRGLFLGVADIS
                     LLG"
     misc_feature    complement(8697..10739)
                     /gene="glyS"
                     /locus_tag="PSPA7_0008"
                     /note="glycyl-tRNA synthetase subunit beta; Validated;
                     Region: glyS; PRK01233"
                     /db_xref="CDD:234925"
     misc_feature    complement(9102..10730)
                     /gene="glyS"
                     /locus_tag="PSPA7_0008"
                     /note="Glycyl-tRNA synthetase beta subunit; Region:
                     tRNA_synt_2f; pfam02092"
                     /db_xref="CDD:251082"
     misc_feature    complement(8733..9011)
                     /gene="glyS"
                     /locus_tag="PSPA7_0008"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     gene            complement(10745..11692)
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /db_xref="GeneID:5356792"
     CDS             complement(10745..11692)
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="glycine--tRNA ligase alpha chain; GlyRS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_001345405.1"
                     /db_xref="GI:152988775"
                     /db_xref="GeneID:5356792"
                     /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHT
                     ATFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLG
                     SLKAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYLQGVDSVYDLIWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANV
                     PKLFELFDFYESEANRLIELELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARAVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
     misc_feature    complement(10817..11665)
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="Class II Glycyl-tRNA synthetase (GlyRS) alpha
                     subunit core catalytic domain. GlyRS functions as a
                     homodimer in eukaryotes, archaea and some bacteria and as
                     a heterotetramer in the remainder of prokaryotes and in
                     arabidopsis. It is responsible for the...; Region:
                     GlyRS_alpha_core; cd00733"
                     /db_xref="CDD:238375"
     misc_feature    complement(order(10943..10945,10955..10957,10964..10975,
                     10979..10981,10991..10993,11000..11002,11009..11014,
                     11021..11026,11033..11035,11042..11044,11048..11050,
                     11069..11074,11081..11083,11132..11134,11450..11452,
                     11498..11500,11510..11512,11537..11539,11585..11596,
                     11600..11602,11606..11611,11633..11635,11645..11647,
                     11657..11659))
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(11591..11614)
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="motif 1; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(order(11180..11185,11189..11194,11198..11203,
                     11249..11251,11261..11266,11429..11437,11441..11443,
                     11447..11449,11495..11497,11570..11572,11576..11578))
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="active site"
                     /db_xref="CDD:238375"
     misc_feature    complement(11489..11500)
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="motif 2; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(11180..11191)
                     /gene="glyQ"
                     /locus_tag="PSPA7_0009"
                     /note="motif 3; other site"
                     /db_xref="CDD:238375"
     gene            11797..12348
                     /gene="tag"
                     /locus_tag="PSPA7_0010"
                     /db_xref="GeneID:5353842"
     CDS             11797..12348
                     /gene="tag"
                     /locus_tag="PSPA7_0010"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03352; match to protein family HMM TIGR00624"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosidase I"
                     /protein_id="YP_001345406.1"
                     /db_xref="GI:152986267"
                     /db_xref="GeneID:5353842"
                     /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGL
                     SWITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRSKLNAARQNAQAW
                     LELDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYA
                     FMQASGMVMDHTRDCDRYAQLAG"
     misc_feature    11812..12336
                     /gene="tag"
                     /locus_tag="PSPA7_0010"
                     /note="Methyladenine glycosylase; Region: Adenine_glyco;
                     pfam03352"
                     /db_xref="CDD:251892"
     gene            12625..13512
                     /locus_tag="PSPA7_0011"
                     /db_xref="GeneID:5355625"
     CDS             12625..13512
                     /locus_tag="PSPA7_0011"
                     /note="Acylates the intermediate (KDO)2-lipid IVA to form
                     (KDO)2-(lauroyl)-lipid IVA"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="YP_001345407.1"
                     /db_xref="GI:152985637"
                     /db_xref="GeneID:5355625"
                     /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSRE
                     VVRINLSKCFPELSEAELEKLVGQSLMDIGKTLTESACAWIWPPEKSLKYIREVEGME
                     VLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL
                     GNRVAPSTPEGILSVIKEVKRGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLL
                     SRGKARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLDVSVAAMSRELAKYVRAYPSQ
                     YMWSMKRFKNRPDGEKKWY"
     misc_feature    12664..>12999
                     /locus_tag="PSPA7_0011"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cl17185"
                     /db_xref="CDD:266537"
     misc_feature    12913..13479
                     /locus_tag="PSPA7_0011"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    order(12982..12984,12991..12993,12997..12999,13045..13056,
                     13195..13203)
                     /locus_tag="PSPA7_0011"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            13589..13855
                     /locus_tag="PSPA7_0012"
                     /db_xref="GeneID:5353611"
     CDS             13589..13855
                     /locus_tag="PSPA7_0012"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345408.1"
                     /db_xref="GI:152987598"
                     /db_xref="GeneID:5353611"
                     /translation="MDNQRQHPRTPIKCRIRISHPQLGELMAQTRDLSDTGVYVKHPD
                     LLRLDVGSIVTGQVQDLPIEAPVLRMEVVRIDAEGVGLRFLADQ"
     misc_feature    13595..13843
                     /locus_tag="PSPA7_0012"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            13999..14655
                     /locus_tag="PSPA7_0013"
                     /db_xref="GeneID:5354734"
     CDS             13999..14655
                     /locus_tag="PSPA7_0013"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02592; match to protein family HMM TIGR00697"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345409.1"
                     /db_xref="GI:152986844"
                     /db_xref="GeneID:5354734"
                     /translation="MSASSPTAWRGTLAGLIVFHIFIIIASNYLVQLPVTLFGWHTTW
                     GAFSFPFIFLATDLTVRLMGKGPARLVIARVMLPALIASYLVSVLFQEAAFRGLSALL
                     EFNTFVARISLASFLAYVLGQVLDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFF
                     VAFWRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPRTDDA
                     "
     misc_feature    13999..14625
                     /locus_tag="PSPA7_0013"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11212"
                     /db_xref="CDD:183041"
     gene            complement(14713..14982)
                     /locus_tag="PSPA7_0014"
                     /db_xref="GeneID:5359755"
     CDS             complement(14713..14982)
                     /locus_tag="PSPA7_0014"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345410.1"
                     /db_xref="GI:152987489"
                     /db_xref="GeneID:5359755"
                     /translation="MSKHTRYAPPQLHFEPDQALLYIYRNASSDALFETAQERLKGLV
                     GLLQALERFRTRTGGDLSIGRATDILHTLASDALTLHMAARNVAP"
     gene            complement(15288..15602)
                     /locus_tag="PSPA7_0015"
                     /db_xref="GeneID:5353924"
     CDS             complement(15288..15602)
                     /locus_tag="PSPA7_0015"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF07719"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345411.1"
                     /db_xref="GI:152985082"
                     /db_xref="GeneID:5353924"
                     /translation="MIEGLEKMLAKGVDNALLRFGLGKGYLDAGNAERAAEHLQSCVE
                     QDPGYSAGWKLLGKARQAGGDLDGARRAWEQGLKAATAHGDKQAEKEMAVFLRKLDKA
                     KP"
     misc_feature    complement(15369..>15590)
                     /locus_tag="PSPA7_0015"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(15375..15377,15384..15386,15396..15398,
                     15432..15434,15477..15479,15486..15488,15498..15500,
                     15534..15536,15579..15581,15588..15590))
                     /locus_tag="PSPA7_0015"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(15369..15563)
                     /locus_tag="PSPA7_0015"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(15414..15419,15426..15431,15438..15443,
                     15519..15524,15531..15536,15540..15545))
                     /locus_tag="PSPA7_0015"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(15657..17108)
                     /gene="trkH2"
                     /locus_tag="PSPA7_0016"
                     /db_xref="GeneID:5354041"
     CDS             complement(15657..17108)
                     /gene="trkH2"
                     /locus_tag="PSPA7_0016"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02386; match to protein family HMM TIGR00933"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium uptake protein TrkH"
                     /protein_id="YP_001345412.1"
                     /db_xref="GI:152986997"
                     /db_xref="GeneID:5354041"
                     /translation="MHYASIFRILGVLLMLFSSAQIPPLLVALFYAEPVWQPFLLAFV
                     ITLATGACIWWPVRGVQEELRIREGYLITALFWVVLGSFGAIPFMFSETPHMSLTDAL
                     FEAISGISTTGATVLTGLDRLPRAILYYRQQLQWFGGMGIVVLAVAIMPMLGIGGMQL
                     YRAEMPGPLKEQKLSPRIADTAKTLWLIYCGLTLACALAYWAAGMSLFDAVGHSFSTI
                     AIGGFSTHDASIGYFDSPLIEAICMFFLVVSGINFGLHFLAWRRRSLAHYLRDPECRA
                     YLSILLAVFLVTALALVAQRHYEQPLQAIRYAAFMVVSIGTTTGFGLADFATWPTFLP
                     HLLLYTTFIGACAGSTGGGMKVMRILLVYRQGMREFMRLLHPSGVFLVKLGRRPIPDR
                     VVESVWGFCSIYLVTFVVLMLVLLALGVDLLTAFSSLSSCLNNLGPALGEAAAHYGGL
                     PDSAKLVLAFAMMLGRLEVFSLLILFTPAFWRY"
     misc_feature    complement(15663..17108)
                     /gene="trkH2"
                     /locus_tag="PSPA7_0016"
                     /note="Trk-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: TrkG;
                     COG0168"
                     /db_xref="CDD:223246"
     misc_feature    complement(15663..17108)
                     /gene="trkH2"
                     /locus_tag="PSPA7_0016"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     gene            complement(17245..18618)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /db_xref="GeneID:5354401"
     CDS             complement(17245..18618)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="YP_001345413.1"
                     /db_xref="GI:152988900"
                     /db_xref="GeneID:5354401"
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREP
                     AYLTRTGLFDNDAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAY
                     YGGPLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIR
                     AVMGEMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDST
                     IVLNGSASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAY
                     VDLVQGGEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSK
                     VIGRSINEIKLPPGTTIGALVRDEEVLIAHGDTRIESDDHVLLFLVDKKYIRDVERLF
                     QAGLTFF"
     misc_feature    complement(17254..18618)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /note="potassium transporter peripheral membrane
                     component; Reviewed; Region: trkA; PRK09496"
                     /db_xref="CDD:236541"
     misc_feature    complement(18247..18612)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(17959..18159)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(17572..17919)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(17281..17454)
                     /gene="trkA"
                     /locus_tag="PSPA7_0017"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(18646..19950)
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /db_xref="GeneID:5357200"
     CDS             complement(18646..19950)
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /EC_number="2.1.1.-"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01029; match to protein family HMM PF01189; match to
                     protein family HMM TIGR00563"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="YP_001345414.1"
                     /db_xref="GI:152985582"
                     /db_xref="GeneID:5357200"
                     /translation="MNPRLAACQALAAVLAGRASLSGALPAQLDKVAPRDRGLTQELA
                     FGAARWQPRLQALAARLLQKPFKAADNDIHALLLIGLYQLLYTRVPPHAAIGETVGCA
                     DKLKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALQQAWPEQLEA
                     LCAANNAHPPMTLRVNRRHGERDTYLAELAEAGIEARACDYSRDGIQLAAPRDVRELP
                     GFAEGRVSVQDEAAQLAAELLESAPGQRVLDACCAPGGKTCHLLEIQPELGEVVAVDL
                     EQSRLLRVRENLQRLGLEARLVAADARATGEWWDGQPFQRILLDAPCSATGVIRRHPD
                     IKLARKPDDIAALAQLQGELLDALWPTLEVGGVLVYATCSVMPSENSDGIAAFLARTP
                     GARELDLPGPWGMKQAHGRQLLPQVDGHDGFYYAKLIKISAR"
     misc_feature    complement(18658..19950)
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /note="16S rRNA methyltransferase B; Provisional; Region:
                     PRK10901"
                     /db_xref="CDD:236790"
     misc_feature    complement(19576..19950)
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /note="RNA binding domain of NusB (N protein-Utilization
                     Substance B) and Sun (also known as RrmB or Fmu) proteins.
                     This family includes two orthologous groups exemplified by
                     the transcription termination factor NusB and the
                     N-terminal domain of the...; Region: NusB_Sun; cl00223"
                     /db_xref="CDD:260276"
     misc_feature    complement(19939..19947)
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238253"
     misc_feature    complement(18841..19215)
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(18991..18993,19045..19053,19123..19128,
                     19183..19203))
                     /gene="sun"
                     /locus_tag="PSPA7_0018"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(19947..20879)
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /db_xref="GeneID:5355526"
     CDS             complement(19947..20879)
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /EC_number="2.1.2.9"
                     /note="modifies the free amino group of the aminoacyl
                     moiety of methionyl-tRNA(fMet) which is important in
                     translation initiation; inactivation of this gene in
                     Escherichia coli severely impairs growth"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_001345415.1"
                     /db_xref="GI:152989066"
                     /db_xref="GeneID:5355526"
                     /translation="MRIVFAGTPEFAAEHLKALLDTPHQLVAVYTQPDRPAGRGQKLM
                     PSAVKSLALEHGLPVIQPPSLRSADAQAELAALRPDLMVVVAYGLILPQAVLDIPRLG
                     CINSHASLLPRWRGAAPIQRAVEAGDAQSGVTVMQMEAGLDTGPMLLKVATPIAADDS
                     GGSLHDRLAALGPKAVVEAIAGLAAGTLRGEVQDDALATYAHKLNKDEARLDWSRPAV
                     ELERQVRAFTPWPVCHSSLAGASLKVLGASLGHGSGTPGSILEASRDGLLVACGEGAL
                     RLTRLQLPGGKPLAFADLYNSRREQFAAGQVLGQ"
     misc_feature    complement(19953..20879)
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    complement(20268..20879)
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(20451..20456,20463..20468,20472..20474,
                     20532..20534,20556..20567,20592..20594,20607..20630,
                     20844..20849,20859..20861))
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(20271..20273,20526..20534,20556..20561,
                     20565..20567,20616..20627,20757..20768,20772..20774,
                     20784..20786,20847..20849,20853..20858))
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(20451..20456,20463..20468,20565..20567,
                     20592..20594,20607..20615,20619..20621,20628..20630))
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(20451..20453,20559..20561,20565..20567))
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(20010..20261)
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    complement(order(20013..20015,20019..20024,20028..20030,
                     20034..20036,20151..20153,20157..20159,20190..20192))
                     /gene="fmt"
                     /locus_tag="PSPA7_0019"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            complement(20944..21450)
                     /gene="def"
                     /locus_tag="PSPA7_0020"
                     /db_xref="GeneID:5357812"
     CDS             complement(20944..21450)
                     /gene="def"
                     /locus_tag="PSPA7_0020"
                     /EC_number="3.5.1.88"
                     /note="cleaves off formyl group from N-terminal methionine
                     residues of newly synthesized proteins; binds iron(2+)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_001345416.1"
                     /db_xref="GI:152988653"
                     /db_xref="GeneID:5357812"
                     /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPG
                     IGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENV
                     DRPQKVRIKALDRDGKPFEEVAEGLLAVCIQHECDHLNGRLFVDYLSTLKRDRIRKKL
                     EKQHRQQA"
     misc_feature    complement(21019..21435)
                     /gene="def"
                     /locus_tag="PSPA7_0020"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(21037..21039,21046..21051,21172..21180,
                     21298..21300,21313..21321))
                     /gene="def"
                     /locus_tag="PSPA7_0020"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(21046..21048,21172..21174,21298..21300,
                     21313..21315))
                     /gene="def"
                     /locus_tag="PSPA7_0020"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(21037..21039,21049..21051,21175..21177))
                     /gene="def"
                     /locus_tag="PSPA7_0020"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            21589..22614
                     /locus_tag="PSPA7_0021"
                     /db_xref="GeneID:5355130"
     CDS             21589..22614
                     /locus_tag="PSPA7_0021"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345417.1"
                     /db_xref="GI:152985066"
                     /db_xref="GeneID:5355130"
                     /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISG
                     KFLRQPWKWPQLWHANPQIQNPHLIYPGDTLSLVYIDGQPRLVLNRGESRGTIKLSPK
                     IRSTPIAEAIPTIPLDKINSFLLANRIVDDEKTFTAAPYIVAGNAERIVSGTGDRVYA
                     RGKFADGQPAYGIFRQGKVYVDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQ
                     EVRLGDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGLRDG
                     LAEGNVLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYQKLSYALVLMASRPLSV
                     TDRVQNP"
     misc_feature    <21664..21819
                     /locus_tag="PSPA7_0021"
                     /note="Uncharacterized protein containing LysM domain
                     [Function unknown]; Region: XkdP; COG1652"
                     /db_xref="CDD:224566"
     misc_feature    21679..21819
                     /locus_tag="PSPA7_0021"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    21781..22596
                     /locus_tag="PSPA7_0021"
                     /note="Uncharacterized protein containing LysM domain
                     [Function unknown]; Region: XkdP; COG1652"
                     /db_xref="CDD:224566"
     gene            22749..23837
                     /locus_tag="PSPA7_0022"
                     /db_xref="GeneID:5358561"
     CDS             22749..23837
                     /locus_tag="PSPA7_0022"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02481; match to protein family HMM TIGR00732"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-processing protein smf chain A"
                     /protein_id="YP_001345418.1"
                     /db_xref="GI:152989517"
                     /db_xref="GeneID:5358561"
                     /translation="MNNLSHAELDARLRLHGLPELGPIRFLRLIEAFGSASSALAAPA
                     GAWHTLGLPAEAAAARRSAEVRERAADALRWLEAPRRHLLMWDDPAYPALLGEVSDAP
                     PLLFVEGAPTALERPQLAMVGSRRASPAGLGCARSFARSLARGGFAITSGLALGIDGA
                     AHEGALEVGGVTLAVLGTGLRTLYPRRHAALARRIVEGGGALVSELPLDSPPLPANFP
                     RRNRIISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
                     DGALLVESVEHVLEALRGWTQAGPAEAPVASLDHPLLELLRVAPYSSEGLAAASGWAL
                     PEVLAALTELELDGRVACEAGTWVHRSG"
     misc_feature    22758..23828
                     /locus_tag="PSPA7_0022"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     misc_feature    22971..23600
                     /locus_tag="PSPA7_0022"
                     /note="DNA recombination-mediator protein A; Region:
                     DNA_processg_A; pfam02481"
                     /db_xref="CDD:251323"
     gene            23877..24434
                     /locus_tag="PSPA7_0023"
                     /db_xref="GeneID:5356838"
     CDS             23877..24434
                     /locus_tag="PSPA7_0023"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345419.1"
                     /db_xref="GI:152988004"
                     /db_xref="GeneID:5356838"
                     /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKARPVEKGLIVVAAHIHQLDFLLEDLPDVWLERLAGTWPGPNTWLVPHQDRLPEWV
                     TGVHDSVAVRVTDHPLVQELCYLTGPLISTSANPAGRPAARTRLRVEQYFHDELDGVL
                     GGALGGRRNPSLIRDLVTGQVIRPA"
     misc_feature    23904..24425
                     /locus_tag="PSPA7_0023"
                     /note="Telomere recombination; Region: Sua5_yciO_yrdC;
                     cl00305"
                     /db_xref="CDD:260340"
     gene            complement(24445..25422)
                     /gene="qor"
                     /locus_tag="PSPA7_0024"
                     /db_xref="GeneID:5357448"
     CDS             complement(24445..25422)
                     /gene="qor"
                     /locus_tag="PSPA7_0024"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00107; match to protein family HMM PF08240"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="YP_001345420.1"
                     /db_xref="GI:152987374"
                     /db_xref="GeneID:5357448"
                     /translation="MAKRVQFAAYGSPEVLEYRDYQPAEPGPREVRVRNRAIGLNFID
                     TYYRSGLYPAPGLPSGLGSEGAGEVEAVGSAVTRFQVGDRVAYATGPLGAYSELHVLA
                     EDNLVRLPEAIDFEQAAAMMLKGLTTQYLLRQTYELQSGETILFHAAAGGVGLFACQW
                     AKALGVKLIGTVSSPEKARLARQHGAWETIDYSHENVAKRVLELTDGKKCPVVYDSVG
                     KDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGVLSQKGSLYVTRPTLGSYANTPEKL
                     QAMADELFGLVERGAIRIEINQRFALVDAAQAHTELAARRTTGSTVLLP"
     misc_feature    complement(24448..25422)
                     /gene="qor"
                     /locus_tag="PSPA7_0024"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     misc_feature    complement(24448..25416)
                     /gene="qor"
                     /locus_tag="PSPA7_0024"
                     /note="Quinone oxidoreductase (QOR); Region: QOR2;
                     cd05286"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(24478..24480,24484..24486,24625..24636,
                     24697..24711,24772..24777,24847..24849,24892..24894,
                     24904..24909,24964..24972,24979..24981,25033..25035,
                     25042..25044,25054..25056,25285..25287,25297..25302))
                     /gene="qor"
                     /locus_tag="PSPA7_0024"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(24616..24621,24628..24651,24673..24690,
                     24727..24732,25018..25020))
                     /gene="qor"
                     /locus_tag="PSPA7_0024"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176189"
     gene            25614..26531
                     /gene="hemF"
                     /locus_tag="PSPA7_0025"
                     /db_xref="GeneID:5354213"
     CDS             25614..26531
                     /gene="hemF"
                     /locus_tag="PSPA7_0025"
                     /note="catalyzes the conversion of the propionic acid
                     groups of rings I and III to vinyl groups during heme
                     synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_001345421.1"
                     /db_xref="GI:152983988"
                     /db_xref="GeneID:5354213"
                     /translation="MTDRIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGG
                     GRTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPH
                     VPTSHANVRFFCAEKAGEEPVWWFGGGFDLTPYYASEEDCVHWHRVARDACAPFGADV
                     YPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIV
                     QRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKPEPGSEEARLTEYFLTDRDWLAGQP"
     misc_feature    25614..26516
                     /gene="hemF"
                     /locus_tag="PSPA7_0025"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK05330"
                     /db_xref="CDD:235413"
     gene            26589..27413
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /db_xref="GeneID:5355176"
     CDS             26589..27413
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_001345422.1"
                     /db_xref="GI:152984179"
                     /db_xref="GeneID:5355176"
                     /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGQALAYEAQLAPLDDFA
                     GFARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLVRLDGGRLRGDNTDG
                     AGLLRDLTVNAGVQLRDRRVLLLGAGGAVRGVLAPFLGERPAQLLVANRTAEKAVALA
                     GEFADLGAVRGCGFADVEGPFDLIVNGTSASLAGDVPPLAESVIERGRTVCYDMMYAK
                     EATAFNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATG"
     misc_feature    26589..27404
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
                     PRK00258"
                     /db_xref="CDD:234703"
     misc_feature    26604..26849
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    26886..27353
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(26889..26891,27234..27236,27312..27314,27321..27323)
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(26967..26969,26976..26978,27036..27041,27147..27155,
                     27228..27230,27300..27302,27309..27314)
                     /gene="aroE"
                     /locus_tag="PSPA7_0026"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            27525..28511
                     /locus_tag="PSPA7_0027"
                     /db_xref="GeneID:5354591"
     CDS             27525..28511
                     /locus_tag="PSPA7_0027"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase C, PlcB"
                     /protein_id="YP_001345423.1"
                     /db_xref="GI:152986177"
                     /db_xref="GeneID:5354591"
                     /translation="MKTLTRLAAGLCICAIAGQANAWSQPTHKNIVKDALAFMNSSYA
                     TEEMRQAYQFYVSAAGGEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASG
                     IVNYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKRED
                     FDTTEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLASYWFDQFRAAPSLQTIGYALHAT
                     GDVAQPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQ
                     TGQVAYAHPEPLYDTSYETRLRVAKELIPESIALTVTVLTKGANSFNAQTAL"
     misc_feature    27882..28475
                     /locus_tag="PSPA7_0027"
                     /note="Zinc dependent phospholipase C (alpha toxin);
                     Region: Zn_dep_PLPC; cd11009"
                     /db_xref="CDD:211381"
     misc_feature    order(27900..27902,28023..28025,28170..28172,28182..28184,
                     28200..28202,28227..28229,28239..28241)
                     /locus_tag="PSPA7_0027"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:211381"
     gene            28492..29778
                     /locus_tag="PSPA7_0028"
                     /db_xref="GeneID:5359611"
     CDS             28492..29778
                     /locus_tag="PSPA7_0028"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345424.1"
                     /db_xref="GI:152988040"
                     /db_xref="GeneID:5359611"
                     /translation="MRKPLSDRRPGWRRAICGVALALLACAAQAVPGEVPRDLTIDGE
                     VLPGKSIDLLERALSRVKFNTDPRQLRRGLVENRLLAREVEGQLTAQNRADLDASVEI
                     EAGNLLEQLYGKRYREDLGPFLRQPQPLSAERLRQVLAPASRGLVENSLVLGEAQRRE
                     AAGVELIGWQFPGQPARTLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRLRRDYLW
                     YRLARDGFGPAEQRGLKTLVRDRLVRQRYLHQIGLYSDFHHESDVLRQLAAKVSDQDA
                     EAYYRRNLERYRNVAQVQAVHIRLADQASADRVYAELQKGLAFDEAVRRHSLADDRDR
                     DPPGDLGLIRPQDGQLDLLRKTALIQKADTLSQPMRIDGAFEIVRVRSREDRQLPLSD
                     RSVRFEVNQAVARERLAAQFETQLRGLLAGARVEGL"
     misc_feature    <29155..29775
                     /locus_tag="PSPA7_0028"
                     /note="Parvulin-like peptidyl-prolyl isomerase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SurA; COG0760"
                     /db_xref="CDD:223831"
     misc_feature    29302..29658
                     /locus_tag="PSPA7_0028"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     pfam13145"
                     /db_xref="CDD:257517"
     gene            29775..30377
                     /locus_tag="PSPA7_0029"
                     /db_xref="GeneID:5355671"
     CDS             29775..30377
                     /locus_tag="PSPA7_0029"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345425.1"
                     /db_xref="GI:152983800"
                     /db_xref="GeneID:5355671"
                     /translation="MKRWLGVALGCSGLAMALACAGVLWMPSAETVASPSAPPTAGTA
                     MAAAAVEDPPPVERARTPAAVRHVVGQPSAPGLDREQAILFMQMLRDEGDPRSPPLGG
                     LQPRQGASAEALADPKRYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSA
                     EDIDEARAALGQLEMMRDKLQRESPQLLPGDSAPPAPAVP"
     misc_feature    30099..>30347
                     /locus_tag="PSPA7_0029"
                     /note="peptide chain release factor 1; Validated; Region:
                     prfA; PRK00591"
                     /db_xref="CDD:234801"
     gene            complement(30381..31934)
                     /locus_tag="PSPA7_0030"
                     /db_xref="GeneID:5354275"
     CDS             complement(30381..31934)
                     /locus_tag="PSPA7_0030"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00916; match to protein family HMM PF01740"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfate transporter"
                     /protein_id="YP_001345426.1"
                     /db_xref="GI:152988087"
                     /db_xref="GeneID:5354275"
                     /translation="MRSRLLPFLAWLPGLRRGDLGREAWVGLNGAVLALPQSMAYALI
                     AGLPAAYGLYAAMLPVAIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPVGSAEYIQA
                     VLLLTFLAGAFQCLLGLLRIGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLFGLPANG
                     EGAVPGNGWRLLRRVAEIDGPSLLVGGFSFALSLLVRRLRPRWPALPLGLLGGATLVW
                     ALPATFASVAHVQALSSALPAWSPPVFEARAILDLLPAAVACGMLGLVTSLSIARALA
                     ARQGDAFDANQEVRAQGLSNLFGPWLSASLSAGSFTRSGLNLEAGARSPLAGVFSALW
                     VALLAVLGARLIEHLPLPAMAAGILLIAWGLVDRPALRALYRSGRGECLVAGLTSLAT
                     LLLPLQNAIYAGVLASLFFYLRRTSTPRVLRQRNDEEEVLRIEGSIFFGACDYLQRLM
                     RQSDKPRLVLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQAD
                     EDSRLHYEG"
     misc_feature    complement(30402..31934)
                     /locus_tag="PSPA7_0030"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    complement(31671..31919)
                     /locus_tag="PSPA7_0030"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    complement(30783..31586)
                     /locus_tag="PSPA7_0030"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     pfam00916"
                     /db_xref="CDD:250221"
     misc_feature    complement(30420..30644)
                     /locus_tag="PSPA7_0030"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain of SulP-like sulfate transporters, plays
                     a role in the function and regulation of the transport
                     activity, proposed general NTP binding function; Region:
                     STAS_SulP_like_sulfate_transporter; cd07042"
                     /db_xref="CDD:132913"
     gene            complement(31939..32862)
                     /locus_tag="PSPA7_0031"
                     /db_xref="GeneID:5355718"
     CDS             complement(31939..32862)
                     /locus_tag="PSPA7_0031"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345427.1"
                     /db_xref="GI:152988567"
                     /db_xref="GeneID:5355718"
                     /translation="MNRLPTRLLAATLLLGSTPLHAEDAACAHVRLADPGWSDIAVTN
                     ASAAFLLESLGYRVKIETLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHERFVASGQVE
                     RLGRNLDGTRFTLAVPRYVWDAGIHRFEDLARQAQRFDRKLYGIGSGAPANQSIQKMI
                     DANRFGLGDWKLVASSEQAMLAELARAEKRQRWLVFLGWTPHPMNLRHELRYLDGGEQ
                     YFGERGQVYTLARKGYAAQCPNPARLLANLRFALDMENQMMSDALQGSATPATAARAW
                     LKAHPQVLDAWLRGVTARDGGDALAAVRDRL"
     misc_feature    complement(31942..32799)
                     /locus_tag="PSPA7_0031"
                     /note="choline ABC transporter, periplasmic binding
                     protein; Region: ABC_choline_bnd; TIGR03414"
                     /db_xref="CDD:188316"
     gene            complement(32880..34391)
                     /gene="betC"
                     /locus_tag="PSPA7_0032"
                     /db_xref="GeneID:5356908"
     CDS             complement(32880..34391)
                     /gene="betC"
                     /locus_tag="PSPA7_0032"
                     /EC_number="3.1.6.6"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00884; match to protein family HMM TIGR03417"
                     /codon_start=1
                     /transl_table=11
                     /product="choline sulfatase"
                     /protein_id="YP_001345428.1"
                     /db_xref="GI:152989262"
                     /db_xref="GeneID:5356908"
                     /translation="MKTPPNILFIMADQMAAPLLPFHDPRSVLRMPNLSRLAERAVVF
                     DSAYCNSPLCAPSRFTLVSGRLPSRIGAWDNAADFAADTPTYAHYLRRLGYRTALSGK
                     MHFCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQ
                     LDFDEEAVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYCIPASYWNLYRDEDIPLP
                     RQSFAQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQVGALLATLE
                     ECGLADDTILVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPGRFAARRIGASVS
                     TVDLLPTLVELAGGQVDARLPLDGRSLLPHLRDGSGHDEVIGEYTAEGTLGPLMMIRR
                     GDYKFIYSEQDPCLLYDLRNDPQERENLAASPAHRGAFEAFLDEARRRWDIPALTRAV
                     LDSQRRRRLVAEALTRGRLTSWDHQPWVDASQQYMRNHIDLDDLERRARFPQP"
     misc_feature    complement(32889..34385)
                     /gene="betC"
                     /locus_tag="PSPA7_0032"
                     /note="choline-sulfatase; Region: chol_sulfatase;
                     TIGR03417"
                     /db_xref="CDD:234202"
     misc_feature    complement(33351..34379)
                     /gene="betC"
                     /locus_tag="PSPA7_0032"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     misc_feature    complement(32892..33053)
                     /gene="betC"
                     /locus_tag="PSPA7_0032"
                     /note="Choline sulfatase enzyme C terminal; Region:
                     Choline_sulf_C; pfam12411"
                     /db_xref="CDD:257033"
     gene            34520..35419
                     /locus_tag="PSPA7_0033"
                     /db_xref="GeneID:5357498"
     CDS             34520..35419
                     /locus_tag="PSPA7_0033"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466; match to
                     protein family HMM TIGR03418"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345429.1"
                     /db_xref="GI:152988427"
                     /db_xref="GeneID:5357498"
                     /translation="MPLSLDLLRVFESAARQLSFTAAAEELGSTQPAVSQQIKRLEQE
                     LQTELFQRVHRGILLTDAGLLLLRHVAPALESVEAGIAALGARQRHEVLQVATDYAFA
                     AYWLMPRLPRFHLAHPHLDVSLVTSERGLAGPRGDIDVAILFGDGRSKHGETHRLFRE
                     EVFPVCSPRLLEGLPLPLAKEHLARLPMLHLKPAQHSRWFDWPALFEALAIDRQPIPA
                     VLSFDNYTLLIQAAIAGQGVAIGWRHLVDDLLEQGLLCRPISESCLSRYGYYALLPER
                     KRRQRLVDAFVGWLRAELQAGGA"
     misc_feature    34526..35398
                     /locus_tag="PSPA7_0033"
                     /note="putative choline sulfate-utilization transcription
                     factor; Region: chol_sulf_TF; TIGR03418"
                     /db_xref="CDD:188320"
     misc_feature    34532..34690
                     /locus_tag="PSPA7_0033"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    34793..35389
                     /locus_tag="PSPA7_0033"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    order(34793..34816,34820..34873,34877..34897)
                     /locus_tag="PSPA7_0033"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    order(34811..34816,34820..34822,35186..35194,35252..35254)
                     /locus_tag="PSPA7_0033"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            35430..35807
                     /locus_tag="PSPA7_0035"
                     /db_xref="GeneID:5358347"
     CDS             35430..35807
                     /locus_tag="PSPA7_0035"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF08883"
                     /codon_start=1
                     /transl_table=11
                     /product="dopa 4,5-dioxygenase"
                     /protein_id="YP_001345430.1"
                     /db_xref="GI:152986299"
                     /db_xref="GeneID:5358347"
                     /translation="MNEFSTPRIQGFHAHVYFDAQSIERARALCEEAARRFPLKMGRV
                     HQRPVGPHPDWSCQLAFTPELFGELIPWLAIHRQDLVVFVHPVTGNDLVDHRDRAMWM
                     GAIRPLDLSILDEGAESYDFRAP"
     misc_feature    35463..35768
                     /locus_tag="PSPA7_0035"
                     /note="Dopa 4,5-dioxygenase family; Region: DOPA_dioxygen;
                     pfam08883"
                     /db_xref="CDD:255088"
     gene            complement(35786..36151)
                     /locus_tag="PSPA7_0034"
                     /db_xref="GeneID:5359544"
     CDS             complement(35786..36151)
                     /locus_tag="PSPA7_0034"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345431.1"
                     /db_xref="GI:152985466"
                     /db_xref="GeneID:5359544"
                     /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNSEDTRKLRRAQER
                     EQIQELNELAHRLAGMASLIHAHAVERACHHLEIACGETSVSNLADAVDELVTALGDL
                     QCELHDWMTLTEPQGARKS"
     misc_feature    complement(35831..36100)
                     /locus_tag="PSPA7_0034"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    complement(order(35921..35923,35930..35932,35975..35980,
                     35987..35989))
                     /locus_tag="PSPA7_0034"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    complement(35987..35989)
                     /locus_tag="PSPA7_0034"
                     /note="active site"
                     /db_xref="CDD:238041"
     gene            complement(36159..36782)
                     /locus_tag="PSPA7_0036"
                     /db_xref="GeneID:5356692"
     CDS             complement(36159..36782)
                     /locus_tag="PSPA7_0036"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00072; match to protein family HMM PF00196; match to
                     protein family HMM PF08281"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component response regulator"
                     /protein_id="YP_001345432.1"
                     /db_xref="GI:152985987"
                     /db_xref="GeneID:5356692"
                     /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARK
                     KSPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVS
                     KRENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLAN
                     GNTNKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
     misc_feature    complement(36162..36776)
                     /locus_tag="PSPA7_0036"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(36474..36770)
                     /locus_tag="PSPA7_0036"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(36474..36476,36483..36485,36540..36542,
                     36600..36602,36624..36626,36756..36761))
                     /locus_tag="PSPA7_0036"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(36624..36626)
                     /locus_tag="PSPA7_0036"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(36600..36608,36612..36617))
                     /locus_tag="PSPA7_0036"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(36174..36344)
                     /locus_tag="PSPA7_0036"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(36201..36203,36234..36248,36252..36257,
                     36261..36266,36288..36296,36333..36341))
                     /locus_tag="PSPA7_0036"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(36174..36179,36186..36188,36195..36203,
                     36294..36296,36300..36302,36306..36308))
                     /locus_tag="PSPA7_0036"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(36967..37773)
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /db_xref="GeneID:5355393"
     CDS             complement(36967..37773)
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /EC_number="4.2.1.20"
                     /note="catalyzes the formation of indole and
                     glyceraldehyde 3-phosphate from indoleglycerol phosphate
                     in tryptophan biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="YP_001345433.1"
                     /db_xref="GI:152983685"
                     /db_xref="GeneID:5355393"
                     /translation="MSRLQTRFAQLKQDNRAALVTFVTAGDPDYDASLEILKGLPAAG
                     ADVIELGMPFTDPMADGPAIQLANIRALQGGQTLAKTLRMVREFRAGDSDTPLVLMGY
                     FNPIHHYGVERFVTEAKEAGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGD
                     ERLPTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAE
                     HAAAVARLADGVVVGSALIERIAKAGDTARAVKDVLALCGELAEGVRNAR"
     misc_feature    complement(36994..37722)
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /note="Ttryptophan synthase (TRPS) alpha subunit (TSA).
                     TPRS is a bifunctional tetrameric enzyme (2 alpha and 2
                     beta subunits) that catalyzes the last two steps of
                     L-tryptophan biosynthesis. Alpha and beta subunit catalyze
                     two distinct reactions which are both...; Region:
                     Tryptophan_synthase_alpha; cd04724"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(37072..37077,37135..37140,37222..37227,
                     37249..37251,37582..37584,37594..37596,37627..37629))
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(37225..37227,37468..37470,37594..37596,
                     37627..37629))
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /note="active site"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(37468..37470,37594..37596,37627..37629))
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(37288..37290,37297..37305,37309..37311,
                     37369..37371,37378..37380,37384..37389,37453..37455,
                     37462..37464,37576..37581,37588..37590,37597..37599,
                     37603..37614))
                     /gene="trpA"
                     /locus_tag="PSPA7_0037"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240075"
     gene            complement(37770..38978)
                     /gene="trpB"
                     /locus_tag="PSPA7_0038"
                     /db_xref="GeneID:5358013"
     CDS             complement(37770..38978)
                     /gene="trpB"
                     /locus_tag="PSPA7_0038"
                     /EC_number="4.2.1.20"
                     /note="catalyzes the formation of L-tryptophan from
                     L-serine and 1-(indol-3-yl)glycerol 3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="YP_001345434.1"
                     /db_xref="GI:152988472"
                     /db_xref="GeneID:5358013"
                     /translation="MTAYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDP
                     AFQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQIL
                     LARRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGA
                     EVIPVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKET
                     REQLAEKEGRLPDSLVACIGGGSNAMGLFHPFLDDAGVRIVGVEAAGHGIDTGKHAAS
                     LNGGVPGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDVGRVEYTSIT
                     DDEALDAFHTCCRLEGIIPALESSHALAEAFKRAPGLPGDHIMVVNLSGRGDKDMQTV
                     MHHMQQEHKA"
     misc_feature    complement(37803..38885)
                     /gene="trpB"
                     /locus_tag="PSPA7_0038"
                     /note="Tryptophan synthase-beta:  Trptophan synthase is a
                     bifunctional enzyme that catalyses the last two steps in
                     the biosynthesis of L-tryptophan via its alpha and beta
                     reactions. In the alpha reaction, indole 3-glycerol
                     phosphate is cleaved reversibly to...; Region:
                     Trp-synth_B; cd06446"
                     /db_xref="CDD:107207"
     misc_feature    complement(order(37833..37835,37911..37913,38253..38267,
                     38391..38393,38619..38621,38700..38705))
                     /gene="trpB"
                     /locus_tag="PSPA7_0038"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107207"
     misc_feature    complement(38700..38702)
                     /gene="trpB"
                     /locus_tag="PSPA7_0038"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107207"
     gene            39076..39969
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /db_xref="GeneID:5355748"
     CDS             39076..39969
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466; match to
                     protein family HMM PF08279"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator TrpI"
                     /protein_id="YP_001345435.1"
                     /db_xref="GI:152985690"
                     /db_xref="GeneID:5355748"
                     /translation="MAMSRELPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVR
                     LLEEALGVPLFGKEGRGIKLTDAGLRLRDACGDAFERLRGVCAELRRQTAEAPFVLGV
                     PGSLLARWFIPRLDRLNRALPDLRLQLSTSEGELDPQRPGLDALLWFAAPPWPADMQV
                     FELAPERMGPVLSPRLARETGLAEAPAARLLEEPLLHTASRPQAWPAWAVSQGLAPEA
                     LRYGQGFEHLYYLLEAAVAGLGVAIAPEALVRDDLAAGRLVAPWGFIETDARLALWVP
                     ARLHDPRAERLAQWLRECLAD"
     misc_feature    39082..39948
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    39103..39279
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    39364..39948
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator TrpI, which is
                     involved in control of tryptophan synthesis, contains type
                     2 periplasmic binding fold; Region: PBP2_TrpI; cd08482"
                     /db_xref="CDD:176171"
     misc_feature    order(39364..39387,39391..39444,39448..39468)
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176171"
     misc_feature    order(39382..39387,39391..39393,39751..39759,39817..39819)
                     /gene="trpI"
                     /locus_tag="PSPA7_0039"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176171"
     gene            40071..40286
                     /locus_tag="PSPA7_0040"
                     /db_xref="GeneID:5356090"
     CDS             40071..40286
                     /locus_tag="PSPA7_0040"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF07311"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345436.1"
                     /db_xref="GI:152987643"
                     /db_xref="GeneID:5356090"
                     /translation="MSNHHTYKKIELVGSSRTSIEDAINNALAEAAKSIQHLEWFEVV
                     DTRGHIENGAVGHYQVTLKVGFRIADS"
     misc_feature    40083..40280
                     /locus_tag="PSPA7_0040"
                     /note="Dodecin; Region: Dodecin; pfam07311"
                     /db_xref="CDD:254151"
     gene            40398..40625
                     /locus_tag="PSPA7_0041"
                     /db_xref="GeneID:5357556"
     CDS             40398..40625
                     /locus_tag="PSPA7_0041"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345437.1"
                     /db_xref="GI:152985189"
                     /db_xref="GeneID:5357556"
                     /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAY
                     TLEIVDKGSVTDKKVVGSCDGGTKEIVYQRG"
     misc_feature    40398..>40463
                     /locus_tag="PSPA7_0041"
                     /note="Outer membrane protein transport protein
                     (OMPP1/FadL/TodX); Region: Toluene_X; cl17479"
                     /db_xref="CDD:266717"
     misc_feature    40470..40619
                     /locus_tag="PSPA7_0041"
                     /note="Protein of unknown function (DUF1161); Region:
                     DUF1161; pfam06649"
                     /db_xref="CDD:253842"
     gene            40918..42606
                     /locus_tag="PSPA7_0042"
                     /db_xref="GeneID:5358747"
     CDS             40918..42606
                     /locus_tag="PSPA7_0042"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03865; match to protein family HMM PF08479"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345438.1"
                     /db_xref="GI:152988960"
                     /db_xref="GeneID:5358747"
                     /translation="MAIPRLALVLLCLPLMASAAPFTSPGDRDLIRERQQRLLDEQRK
                     RLEELQQLPGNEAPSTPGGSAGDGRCFDIRRIELEGAEHLAQGARDELLAPYQGKCLG
                     VGQLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRVIVVEGRLEGLDSSALASPR
                     ELAMSFPGKTGELLDLRELEQLVDQLGRLPSRQAQLELVPGSQVGGSRVRLKGERDKP
                     WRVSATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLSLRANQDAVSDRWRHSDSQSLF
                     YSLPWGWWTFTYGYSQSDYRTRNETSGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMS
                     LGLSHQRTNNYIEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQ
                     GRGQPRGGDAHARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLG
                     GNSSVRGFKDQTLTGDSGGYWRNQLRWRRAVQWAPLRPWLQEYGVAFAYDVGVIRHDR
                     YNDGASGRMSGNAIELDARGRYFAASVGFARSLERPSVIERREHPIYFRVDAFF"
     misc_feature    40963..42603
                     /locus_tag="PSPA7_0042"
                     /note="Hemolysin activation/secretion protein
                     [Intracellular trafficking and secretion]; Region: FhaC;
                     COG2831"
                     /db_xref="CDD:225387"
     misc_feature    41128..41355
                     /locus_tag="PSPA7_0042"
                     /note="POTRA domain, ShlB-type; Region: POTRA_2;
                     pfam08479"
                     /db_xref="CDD:117056"
     misc_feature    41605..>42306
                     /locus_tag="PSPA7_0042"
                     /note="Surface antigen; Region: Bac_surface_Ag; pfam01103"
                     /db_xref="CDD:250364"
     gene            42719..44503
                     /locus_tag="PSPA7_0043"
                     /db_xref="GeneID:5356995"
     CDS             42719..44503
                     /locus_tag="PSPA7_0043"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF05594; match to protein family HMM PF05860; match to
                     protein family HMM TIGR01731; match to protein family HMM
                     TIGR01901"
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin/hemagglutinin"
                     /protein_id="YP_001345439.1"
                     /db_xref="GI:152984928"
                     /db_xref="GeneID:5356995"
                     /translation="MDIRSPLNQCIALTLAGILFLDPIVAAAAQLAVDAAAGGNTSLG
                     QAGNGVPIVNIATPNGAGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNL
                     QGQAAQVILNQVTGGNRSTLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTT
                     GKPIMDGQRLERFQVDGGDIAIEGAELNVSNLEQFDLITRSATLNAKLYAKNLNIVTG
                     RNDVQADSLQATPRAADGSEKPRLAIDSSALGGMYAGAIRLVGTEQGVGVKLAGDMAA
                     SGGDIRIDASGRLSLAQASSQGDLKIAAQAVELNGKTYAGGSAEIRGAEELVNRQSLA
                     ARERIALEAAHIDNAGVIEAGVDPDNRRNARGDLGLDSRTLRNAGSLVASRTLEARAS
                     QALDNQGGSLKGATTRVAAGDLDNRGGKLLAEGELRVAAANLDNRRGGLLHSRDRTVV
                     AAAGKLDNRGGQVIGLNDLEVGAGTLDNSQEGLLGSQQRPASAPRRWTTGRMAKFPAS
                     APRCASAAWTTVAASCSATTCWWSPAAPSTTASACSRRPTASTCRPAAWTTAARVRWP
                     ARAGWSPASPACWTTATRATCSARARSA"
     misc_feature    42830..43222
                     /locus_tag="PSPA7_0043"
                     /note="haemagglutination activity domain; Region:
                     Haemagg_act; pfam05860"
                     /db_xref="CDD:253427"
     gene            44500..53214
                     /locus_tag="PSPA7_0044"
                     /db_xref="GeneID:5355299"
     CDS             44500..53214
                     /locus_tag="PSPA7_0044"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF04830; match to protein family HMM PF05594; match to
                     protein family HMM TIGR01731"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin"
                     /protein_id="YP_001345440.1"
                     /db_xref="GI:152983920"
                     /db_xref="GeneID:5355299"
                     /translation="MTVGQLDNRAGGLLSSRSELNVHGASLDNRGGMLVADAGLEATG
                     GAFDNGDGGIASGKGGVRVEVASLRNDQGGKLLSDGRLDLTANAVGNAGGRIAAKGDL
                     QATLGSLAQQGGELVSEKTLKVAADTLDNSQSGLIAANGGIAIEARQVDNRAGEISST
                     AKVAVNVREQLDNRAGKVIGDGGLRLTVQRLLNQAKGVLAGRDGLSLDGGELFNGDGG
                     RLDSQKGLGVSLDGALDNQGGALVSEGALTARSASLDNRGGTFSSAGPLTLSSRGALN
                     NQGGKLLSDAGVALDGASLDNSRAGVISAKGAVDIRTGALDNSQKGTIGSNAGITLAA
                     ARLDNGQQGRISAKGLLDANLKGLDQRAGGALVSETGITLDLNGGALVNRDGGLIATP
                     GALLLRQLGAVDNGAGGEISSDRAFTLAAASLDNRGGRLLSADSLVLRIAQALDNSLA
                     GVISGATGLDIEAGSLDNSAKGTLASRAGIDLRVAGALDNHAEGTVSGARLTLASASL
                     DNSGKGLLSGNAGLSVATGALNNAQGGQLVSQGALDVSSADLDNRGGALSGKQSLTLG
                     AGNLDNRGGLLTSDGELELTAGRVDSADGGEISARGDLRLTVERLLQRQGRLIGERGV
                     RLDLQGGDLDNQGGLISARGPLSIERLNVLDNRQGGEISSQQGFELLASRIDNGQKGR
                     IISAGKLRLVADQLGNAGDGLFSGWEGLAVEGGSLYNSAGGTLSSKNGELAVSLAGAL
                     DNHGQGALVSKGAQRIAAARLANAGGIVSGESDVTLSIAGKLDNGQGGLISAQRALTF
                     DRASAVLNNAGGQVNGGSLLLTGASLDNSGGQLISQGRLEALLGGALVNTGGARLASG
                     GDLLLRSASVDNRGGKLVSQGLLELFAQGLDNSASGTLASQADMTLRLGQGALRNQQD
                     GLVFSQAGALDVQAGSLDNRQGTLQAQGDNRLRLDAALDNRGGRLDSRAGNLDLQSAS
                     LDNGAGGVLDSAKGWLKLVTGLFDNSAGITQAQSLEIQAQQGVRNQKGHLSALAGDNR
                     IVTADFDNQGGGLYASGLLSVSGQRFLNQGAAAGQGGKVGAGRVDFSLAGALANRFGQ
                     LESEGDLLLRAASIDNSDGSLRALGRSGSTRLVAGELNNAYGALESANQDLDLQLGSL
                     ANADGRILHTGNGTFGLDSGQVIRAGGELTTNGLLDIRASEWTNSSVLQAGRLNLDIG
                     TFRQTAEGKLLAVQSFTGRGGDWSNDGLLASDGSLRLDLSGGYRGNGRATSLGDFALN
                     AASLDLGTAASLAGGANVTLGAGNLLVNRGRITAAGDLVASAASLNNYGTLGGGGNLR
                     LNAPALLNERGLLFSGADMTLRARDITNLYGDVYSLGRLDIARDDAGGRADSLRNLSG
                     VIESDKDFSLRASLIENRRAVLESKSGLYTAKMEQTACIEGVNAGDCSGKRNAIWTVT
                     QRDKTEVTASSAMGQLLAGGDFAIDGGTLSNVSSLIGAGGNLTANLEVLDNQGLETGE
                     LETIRVLRTARGGDIGGIDQKSRNFTDLYWYQSANFDPARAGEIPAALNAILSDWSFE
                     YEFPSKGPTPISTGDQSYAAVIQAAGNVTVNAGKRINNSVIRPGYTFVGSGRQVGDSA
                     VGGSGVSVVVPLTSQLPPDLARRQVNPVTLPGFSLPQGDNGLFRLSSHFAEDGNASAA
                     LGAGADRTQGGSGVSVGQQGAGNAAGTWQGQGVRVDGLAGAANVQGQGGSALGGSLPG
                     VARVQGVPGNATPSASHKYLIETNPALTELKQFLNSDYLLSGLGMNPDASKKRLGDGL
                     YEQRLIRDAVVARTGQRYIDGLSSDEALFRYLMDNAIAYKDQLHLQLGVGLSAEQMAA
                     LTHDIVWLEEVEVNGEKVLAPVVYLAQAEGRLAPNGALIQGRDVKLVSGGDLHNVGTL
                     RAQNDLSATADNLDNSGLIESGKRLDLLAGDSIRNRQGGVIAGRDVSLTALTGDVINE
                     RSVTRYDSALDGRTWERSFADSAARVEAANSLNVQAGRDIANLGGVLQSRGDLSLDAG
                     RDVTVAAVEDRQGQTRWSTSRLQSVTQLGAEVSAGRDLNVSAGRDLTAVASTLEARRD
                     IALSAGRDVTLAAAANEEHAYSKTRKVTYQEDKVAQQGTRVDAGGDLAINAGQDLRLV
                     ASQTSAGDEAYLVAGDKLELLAANDSNYYLYDKKKKGDFGRKETQRDEVTDVKAVGSQ
                     ISSGGDLTLLSGGDQTYQGAKLESGNDLAIVSGGAVTFEAVKDLHQESHEKSKGDLAW
                     QSSKGKGQTDETVRQTQIVAQGNLAIKAVEGLKIDLKHIDQKTVSQTIDAMVQADPQL
                     AWLKEAEQRGDVDWRMVQEVHDSWKYSNSGMGPATQIAVAIAAAAIGGMAAAGALSGA
                     GVGASSFAMGAGVGAAGSLSGTAAVSLINNKGDLGKVLKDSFSSDSLKQIAIASLTGG
                     LTAEYFDGILQTKTDPLTGKVTVDLSSLSGVGRFAANQAMQNATSTVLSQALGQGGSL
                     NEALKSALYNSFAAAGFNFVGDIGQEYSLKPGDPSMVTMHALMGGLAAQVSGGDFATG
                     AAAAGANEALVAKLDQAFKSLSPENREAMVTMGSQLVGVLATAVRDPDATGKALESAA
                     WVAKNSTQYNFLNHQDVADLDNALQKCKSQGNCRQVEEEFKARSDENRRRLNGCVAVG
                     NCAEIRAEIDAGSRALNELVARQETANPGGSDSDIAYGFLMGRNVVDWTTAGQLHLEQ
                     TANLWWNGNPQWQKEVGAYLDQTGFNPFGIGVPAMGGAAGKVSAKALMNALKAGELPK
                     GEVAPGKANLPTIGALADAEAGMPYTHPVKPAVKSVVDDLGGGSSKITELPKATRNSP
                     RNIQTDQSASDAIKNLVSAGFKNTPSKDGTVNVLTKGDKTYTFYSRSKTTGLPSAELK
                     IGGNSKKNIAVKIRFENP"
     misc_feature    46654..49566
                     /locus_tag="PSPA7_0044"
                     /note="Large exoproteins involved in heme utilization or
                     adhesion [Intracellular trafficking and secretion];
                     Region: FhaB; COG3210"
                     /db_xref="CDD:225751"
     misc_feature    48244..>48468
                     /locus_tag="PSPA7_0044"
                     /note="Pertactin-like passenger domains (virulence
                     factors) of autotransporter proteins of the type V
                     secretion system. Autotransporters are proteins used by
                     Gram-negative bacteria to transport proteins across their
                     outer membranes. The C-terminal (beta) domain...; Region:
                     PL_Passenger_AT; cl00185"
                     /db_xref="CDD:260243"
     misc_feature    <49612..>50385
                     /locus_tag="PSPA7_0044"
                     /note="Large exoproteins involved in heme utilization or
                     adhesion [Intracellular trafficking and secretion];
                     Region: FhaB; COG3210"
                     /db_xref="CDD:225751"
     misc_feature    50599..51231
                     /locus_tag="PSPA7_0044"
                     /note="Haemagluttinin repeat; Region: Fil_haemagg_2;
                     pfam13332"
                     /db_xref="CDD:257662"
     misc_feature    51643..52092
                     /locus_tag="PSPA7_0044"
                     /note="Possible hemagglutinin (DUF637); Region: DUF637;
                     pfam04830"
                     /db_xref="CDD:252824"
     gene            53311..53757
                     /locus_tag="PSPA7_0045"
                     /db_xref="GeneID:5353618"
     CDS             53311..53757
                     /locus_tag="PSPA7_0045"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345441.1"
                     /db_xref="GI:152984053"
                     /db_xref="GeneID:5353618"
                     /translation="MTFFVERSALYSLSILKLLFFVSVNSGAKKIFFCFLVAQKNKFE
                     ISSVYEVDLLEVNFTEIENRLCSLYEEHVLVGEVGRIVAFSDMVSWVLYEEVLEEIGV
                     LVMLDETKSVYSNFDFGEFVSRDFMMEQADLGLYRKEYVDKLISNY"
     gene            53972..54355
                     /locus_tag="PSPA7_0046"
                     /db_xref="GeneID:5358914"
     CDS             53972..54355
                     /locus_tag="PSPA7_0046"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345442.1"
                     /db_xref="GI:152986393"
                     /db_xref="GeneID:5358914"
                     /translation="MTLFEECKEALRADFNIVEGQAQQDAIDILYKYPLEKGNILWSE
                     MEYSDYENIDALLDVNSIKNADVFVFADDVNIPIFRTNLKLIAENIYDVIALSPKLFI
                     FNNNMILETLFPTEMFRLGIKAINP"
     gene            complement(57148..58401)
                     /locus_tag="PSPA7_0047"
                     /db_xref="GeneID:5355488"
     CDS             complement(57148..58401)
                     /locus_tag="PSPA7_0047"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345443.1"
                     /db_xref="GI:152988275"
                     /db_xref="GeneID:5355488"
                     /translation="MTLSLELLLSLCTALAIGLLIGAERGWQARDREDTRQIAGIRTF
                     SLVGLLGGFATLLAGELGSAVWVALLLALAALVVAGYVSDVRRGGDQGMTTEIALLTT
                     FLLGSLALTEQRLMAAAGGIVLTLLLSLKDKLHAVLKRLTAEELSGTLKLLFISVVLL
                     PVLPDRGYGPWAFFNPYLTWWMVVLIAALGFSAYLAIRLVGSRKGLLLTAVLGGLVSS
                     TVMTLTLARLRQRMPDALLACGLLATSALMFPRILVEIGALHPALLKELALPFAATTL
                     VYLGGTLFHALRGGRASQEAPDEPGLRNPFELLPALRFAALLSAILLLVEAGRRLFGD
                     AGIYAVALLSGLADVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLVVLVG
                     GKRLALLTLPFSLAGLLVGALLILL"
     misc_feature    complement(57979..58362)
                     /locus_tag="PSPA7_0047"
                     /note="MgtC family; Region: MgtC; pfam02308"
                     /db_xref="CDD:111223"
     misc_feature    complement(57190..58281)
                     /locus_tag="PSPA7_0047"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3174"
                     /db_xref="CDD:225715"
     misc_feature    complement(57223..57852)
                     /locus_tag="PSPA7_0047"
                     /note="Domain of unknown function (DUF4010); Region:
                     DUF4010; pfam13194"
                     /db_xref="CDD:257562"
     gene            58884..59570
                     /locus_tag="PSPA7_0048"
                     /db_xref="GeneID:5354877"
     CDS             58884..59570
                     /locus_tag="PSPA7_0048"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03783"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345444.1"
                     /db_xref="GI:152988492"
                     /db_xref="GeneID:5354877"
                     /translation="MSHRAKKALLPLLAAATLAGLAGCATETSTALPVQQVESVNRPY
                     SGVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSE
                     IQQEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNI
                     VNISTSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAV
                     DSGAWKPQNQ"
     misc_feature    58953..59567
                     /locus_tag="PSPA7_0048"
                     /note="Uncharacterized protein involved in formation of
                     curli polymers [Cell envelope biogenesis, outer membrane];
                     Region: CsgG; COG1462"
                     /db_xref="CDD:224379"
     gene            59601..59954
                     /locus_tag="PSPA7_0049"
                     /db_xref="GeneID:5355768"
     CDS             59601..59954
                     /locus_tag="PSPA7_0049"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345445.1"
                     /db_xref="GI:152985080"
                     /db_xref="GeneID:5355768"
                     /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGES
                     KEAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSLGKDDQMVREFKTEKALFPESA
                     TYMDFLLNNARGGAR"
     misc_feature    59601..59951
                     /locus_tag="PSPA7_0049"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4259"
                     /db_xref="CDD:226710"
     gene            59951..60616
                     /locus_tag="PSPA7_0050"
                     /db_xref="GeneID:5354039"
     CDS             59951..60616
                     /locus_tag="PSPA7_0050"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF05643"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345446.1"
                     /db_xref="GI:152984316"
                     /db_xref="GeneID:5354039"
                     /translation="MKLARLSGLVAGFTLLALLGGCAPTKSVDYSAFKQAKPRSILVL
                     PPLNESPDVKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQVSPAK
                     LREIYGADAALYVTVSDYGTRYMVISSATIVTASARLVDLRSGTTLWTGTATASSEEN
                     NGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRSPKY
                     GSD"
     misc_feature    59975..60613
                     /locus_tag="PSPA7_0050"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4380"
                     /db_xref="CDD:226815"
     gene            complement(60631..61047)
                     /locus_tag="PSPA7_0051"
                     /db_xref="GeneID:5359001"
     CDS             complement(60631..61047)
                     /locus_tag="PSPA7_0051"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01381"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345447.1"
                     /db_xref="GI:152985027"
                     /db_xref="GeneID:5359001"
                     /translation="MSFSQNVLRLRRQNALTQRQMAERLGVTLSQFRHFETKGGQPSL
                     AVLKTFAGRFGVSLDWLICDRGERRALQADLQLQFEAIGRLRLDERRAIRALLDELIR
                     QYMAKRNLPAKPRPAPGAPPPPVRPANRAEATDAPP"
     misc_feature    complement(60718..61044)
                     /locus_tag="PSPA7_0051"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(60865..61038)
                     /locus_tag="PSPA7_0051"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60937..60939,61012..61014,61024..61026))
                     /locus_tag="PSPA7_0051"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60940..60942,61015..61017))
                     /locus_tag="PSPA7_0051"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60934..60939,60949..60951,60958..60960,
                     60991..60996))
                     /locus_tag="PSPA7_0051"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(61423..63084)
                     /locus_tag="PSPA7_0052"
                     /db_xref="GeneID:5355866"
     CDS             complement(61423..63084)
                     /locus_tag="PSPA7_0052"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345448.1"
                     /db_xref="GI:152987632"
                     /db_xref="GeneID:5355866"
                     /translation="MRYARFASRHSLLALAVAAALLPGASWAASGERAAARKPPSAAC
                     AWNRDVPLSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFARRLCAD
                     NGRTPVTSYAKALKLVTEEGRALWRAAVDRVQGRRAIPAGALPASDDRMLYWTRTYMT
                     RTLRQWAPSFRLSQAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVF
                     TLGAPGTPNTGLRNGNPSGATALALDGREIRLSDGSLLRIEAYLLPVSYDPFNRGMQE
                     DTLGPWFRPGPRRVDASITISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADKALPN
                     YVLPLGSVTNPGSAPISLPGSGCNINPPRRWLGYDSASHWRRNLPAQFSRASLPVRQL
                     LAADTWRGIERPPGATSQAAEGFDVTWHTNYAFFPDCAKPQTESVPSNGVMNAMPDPA
                     LVLPPNRRICARNGGGGDYLSNESAYRNTVLRDTFGLDIPAGHIHVPVMNNYYTGSPA
                     SGGSARNDNAISDARYEAYRSAIVAQTRALLVGVGNALAQGAKAD"
     gene            complement(63619..64047)
                     /locus_tag="PSPA7_0053"
                     /db_xref="GeneID:5354768"
     CDS             complement(63619..64047)
                     /locus_tag="PSPA7_0053"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345449.1"
                     /db_xref="GI:152987299"
                     /db_xref="GeneID:5354768"
                     /translation="MDLRPSHVHVFPPSRDLPAETHPHRETLLRSGCAWNGSLYLGYP
                     LGQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGC
                     LMNIIHRLVAGAEPVEALLFHAGVEGMPVGLGDRGETPAG"
     misc_feature    complement(63685..64029)
                     /locus_tag="PSPA7_0053"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(64300..64848)
                     /locus_tag="PSPA7_0054"
                     /db_xref="GeneID:5354125"
     CDS             complement(64300..64848)
                     /locus_tag="PSPA7_0054"
                     /note="in yeast cells this enzyme removes the 2'-phosphate
                     from RNA via an intermediate in which the phosphate is
                     ADP-ribosylated by NAD followed by a presumed
                     transesterification to release the RNA and generate
                     ADP-ribose 1''-2''-cyclic phosphate; functions in tRNA
                     splicing; the function and substrate of bacterial enzymes
                     in organisms that do not perform splicing is unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 2'-phosphotransferase-like protein"
                     /protein_id="YP_001345450.1"
                     /db_xref="GI:152985877"
                     /db_xref="GeneID:5354125"
                     /translation="MDRKTLDDTSRFLSHVLRHQPEAIGLTLDGEGWADIDALIAGAA
                     RDGRALDRALLGAVLRSNDKQRFAFSADGQRIRAVQGHSHAAVAIAYAPAVPPAVLYH
                     GTARRFLDSIREHGLVPGSRHHVHLSARRATALEVGRRYGSPVLLEVDARDMHLAGHL
                     FHQAENGVWLAGQVPVRFIREA"
     misc_feature    complement(64303..64848)
                     /locus_tag="PSPA7_0054"
                     /note="RNA 2'-phosphotransferase; Reviewed; Region:
                     PRK00819"
                     /db_xref="CDD:179136"
     gene            complement(64887..65393)
                     /locus_tag="PSPA7_0055"
                     /db_xref="GeneID:5359199"
     CDS             complement(64887..65393)
                     /locus_tag="PSPA7_0055"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345451.1"
                     /db_xref="GI:152988210"
                     /db_xref="GeneID:5359199"
                     /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDA
                     RLAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEG
                     IREEQLDGAEERNVTLKVRGQEISFNGRDYLFGFALPNFFFHVTTAYAILRHNGVELG
                     KMDFLGGA"
     misc_feature    complement(64890..65393)
                     /locus_tag="PSPA7_0055"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3812"
                     /db_xref="CDD:226333"
     gene            complement(65459..66379)
                     /locus_tag="PSPA7_0056"
                     /db_xref="GeneID:5357349"
     CDS             complement(65459..66379)
                     /locus_tag="PSPA7_0056"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345452.1"
                     /db_xref="GI:152986508"
                     /db_xref="GeneID:5357349"
                     /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWV
                     GARLLHRSTRRLSLTDAGAELLPQCREMLAVADSMQATGQTRRDSPRGTLRITSSLSF
                     AQAWLTRAAAAFVERFPGTAIDLQVNSQVINLVEERIDLALRITNQLDPNLIARRLGE
                     CRSVICAAPDYLRRHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLS
                     ANESTVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQM
                     PPALRALLDFLVERMAADPHWDEAGPLALA"
     misc_feature    complement(65489..66373)
                     /locus_tag="PSPA7_0056"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(66194..66358)
                     /locus_tag="PSPA7_0056"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(65519..66106)
                     /locus_tag="PSPA7_0056"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(65582..65584,65663..65665,65714..65716,
                     65897..65899,65903..65905,65945..65947,66062..66064,
                     66074..66076))
                     /locus_tag="PSPA7_0056"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(65687..65689,65696..65701,65720..65734,
                     65816..65818,65999..66019,66023..66025,66035..66037,
                     66044..66049,66053..66058,66068..66073))
                     /locus_tag="PSPA7_0056"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            66487..67374
                     /locus_tag="PSPA7_0057"
                     /db_xref="GeneID:5357937"
     CDS             66487..67374
                     /locus_tag="PSPA7_0057"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345453.1"
                     /db_xref="GI:152983789"
                     /db_xref="GeneID:5357937"
                     /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFA
                     VSSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKPLSTIYISHGDPDFYFGLDVLK
                     AAFPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHA
                     LKVVDLKGPSPNRTVLWIPSLKTVVGGVLVESGSHVWTADTQTKASRQAWVAMLERIE
                     ALQPRRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLP
                     GEEGLELSAKVLKGEMQWP"
     misc_feature    66631..67263
                     /locus_tag="PSPA7_0057"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     gene            67437..68138
                     /locus_tag="PSPA7_0058"
                     /db_xref="GeneID:5356879"
     CDS             67437..68138
                     /locus_tag="PSPA7_0058"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345454.1"
                     /db_xref="GI:152984241"
                     /db_xref="GeneID:5356879"
                     /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMT
                     DANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTGAVFDSAPPTAAVLAA
                     EALGGLGAAMLARIQRAHYVEGRRIAERPVLFGLAAELGLGQGFAEAFDACSGEPLRV
                     HFADSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDEWRAFLETQKDIANSTL
                     TSGVPAPFCGIDGCP"
     misc_feature    67446..68036
                     /locus_tag="PSPA7_0058"
                     /note="DsbA family, FrnE-like subfamily; composed of
                     uncharacterized proteins containing a CXXC motif with
                     similarity to DsbA and FrnE. FrnE is presumed to be a
                     thiol oxidoreductase involved in polyketide biosynthesis,
                     specifically in the production of the...; Region:
                     DsbA_FrnE_like; cd03025"
                     /db_xref="CDD:239323"
     misc_feature    order(67476..67478,67485..67487)
                     /locus_tag="PSPA7_0058"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239323"
     gene            68252..68677
                     /gene="osmC"
                     /locus_tag="PSPA7_0059"
                     /db_xref="GeneID:5356572"
     CDS             68252..68677
                     /gene="osmC"
                     /locus_tag="PSPA7_0059"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02566"
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein OsmC"
                     /protein_id="YP_001345455.1"
                     /db_xref="GI:152985750"
                     /db_xref="GeneID:5356572"
                     /translation="MKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFNTRFEGAPGT
                     NPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAITAVHLVLRA
                     RVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
     misc_feature    68258..68659
                     /gene="osmC"
                     /locus_tag="PSPA7_0059"
                     /note="peroxiredoxin, OsmC subfamily; Region:
                     osmo_induc_OsmC; TIGR03562"
                     /db_xref="CDD:234260"
     gene            68788..69021
                     /locus_tag="PSPA7_0060"
                     /db_xref="GeneID:5359653"
     CDS             68788..69021
                     /locus_tag="PSPA7_0060"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF06649"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345456.1"
                     /db_xref="GI:152986213"
                     /db_xref="GeneID:5359653"
                     /translation="MKTIGLGIAALLFSATALAAPKPCEELKAEIETKIQSAGVISYT
                     LEIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
     misc_feature    68857..69009
                     /locus_tag="PSPA7_0060"
                     /note="Protein of unknown function (DUF1161); Region:
                     DUF1161; pfam06649"
                     /db_xref="CDD:253842"
     gene            complement(69034..69471)
                     /locus_tag="PSPA7_0061"
                     /db_xref="GeneID:5355571"
     CDS             complement(69034..69471)
                     /locus_tag="PSPA7_0061"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345457.1"
                     /db_xref="GI:152985842"
                     /db_xref="GeneID:5355571"
                     /translation="MRPFTRLVPLALLLLAGCAGPLPQPDPKMAWVELRSAPANTLLA
                     ERLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDG
                     FEAGRRYRLEVRPQLRRALALLSDERGAVVARSNFQTSRCPPY"
     gene            complement(69528..69944)
                     /locus_tag="PSPA7_0062"
                     /db_xref="GeneID:5358432"
     CDS             complement(69528..69944)
                     /locus_tag="PSPA7_0062"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345458.1"
                     /db_xref="GI:152989159"
                     /db_xref="GeneID:5358432"
                     /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLATQPDADLAAVE
                     VDDKTWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQ
                     RYRLEAGHIGFRPWAKLYDQDNRELARGREGRCAKV"
     gene            70153..71163
                     /locus_tag="PSPA7_0063"
                     /db_xref="GeneID:5358809"
     CDS             70153..71163
                     /locus_tag="PSPA7_0063"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345459.1"
                     /db_xref="GI:152984816"
                     /db_xref="GeneID:5358809"
                     /translation="MALSGCSTVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRE
                     RLARAEKARQFASERLDLPDNRSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAG
                     CVAYRGYYSEAAARAEAARQRALGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLA
                     TLIFHELAHQKFYLRDDTAFNESFATFVEQEGTRQWREYRGLPPADGREEKRREQFTA
                     LVLASRARLEALYAGPLDDAAKRAGKAAEFQRLRREYAALSQREWGGESPFKAWIDSP
                     FNNAKLLPFGLYDQWVPAFAVLFRQVGSNWPAFYARVRALGQLPLAERQAALQRLAAA
                     AP"
     misc_feature    70156..71121
                     /locus_tag="PSPA7_0063"
                     /note="Predicted aminopeptidase (DUF2265); Region:
                     DUF2265; cl17720"
                     /db_xref="CDD:248274"
     gene            complement(71173..72159)
                     /locus_tag="PSPA7_0064"
                     /db_xref="GeneID:5356302"
     CDS             complement(71173..72159)
                     /locus_tag="PSPA7_0064"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345460.1"
                     /db_xref="GI:152989166"
                     /db_xref="GeneID:5356302"
                     /translation="MTDNPFATPSAPVQPPTREVPATTQPYAFIAVLALVTCLSFALS
                     LGIQWYNDIGEVRQRFSEHLQLTAPHWFTGLVFYAAANLLALHAYREQRRLVEFRPLA
                     LLLIGYGLLNLVCGMLAGIGLTPLTLPFYQWATVQASYTAWLLAFNEAMSWVYLLLGS
                     LLPLGLVLLGSRVNSPRLAEGEEAGVGAWQVALAAALCFATLCFKLLQFLPYALLRYD
                     EPWLYGLYLSGVALPAALLFGAICTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVG
                     GGLALLMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLAARWCYADQLATA"
     gene            complement(72192..72857)
                     /locus_tag="PSPA7_0065"
                     /db_xref="GeneID:5358816"
     CDS             complement(72192..72857)
                     /locus_tag="PSPA7_0065"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345461.1"
                     /db_xref="GI:152985822"
                     /db_xref="GeneID:5358816"
                     /translation="MRDAALRYPHILFDLDGTLTDPREGITRSVQFALARLGIDEPDL
                     ARLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRVTGLYENRVFDGIPELLEAL
                     VGRGHTLYVATSKPGVFAREIARHFAFDRHFKAIYGSELDGTRTHKDELIRHLLDSEG
                     LAAEQCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVL
                     ESH"
     misc_feature    complement(72195..72839)
                     /locus_tag="PSPA7_0065"
                     /note="Predicted phosphatases [General function prediction
                     only]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    complement(72291..72827)
                     /locus_tag="PSPA7_0065"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(<72681..72827)
                     /locus_tag="PSPA7_0065"
                     /note="Eukaryotic phosphomannomutase; Region: PMM;
                     cl17107"
                     /db_xref="CDD:266519"
     misc_feature    complement(order(72516..72521,72810..72818))
                     /locus_tag="PSPA7_0065"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(72801..72818)
                     /locus_tag="PSPA7_0065"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(72519..72521)
                     /locus_tag="PSPA7_0065"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(72850..73392)
                     /locus_tag="PSPA7_0066"
                     /db_xref="GeneID:5357635"
     CDS             complement(72850..73392)
                     /locus_tag="PSPA7_0066"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345462.1"
                     /db_xref="GI:152985640"
                     /db_xref="GeneID:5357635"
                     /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGADSSVWPLVVIR
                     GDMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNQV
                     LVGMGSIVMDGAVIEDEVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFA
                     YTAGNYVKLKDQHIAEGYHA"
     misc_feature    complement(72868..73392)
                     /locus_tag="PSPA7_0066"
                     /note="Carbonic anhydrases/acetyltransferases, isoleucine
                     patch superfamily [General function prediction only];
                     Region: PaaY; COG0663"
                     /db_xref="CDD:223735"
     misc_feature    complement(72880..73356)
                     /locus_tag="PSPA7_0066"
                     /note="Gamma carbonic anhydrase-like: This family is
                     composed of gamma carbonic anhydrase (CA), Ferripyochelin
                     Binding Protein (FBP), E. coli paaY protein, and similar
                     proteins. CAs are zinc-containing enzymes that catalyze
                     the reversible hydration of carbon...; Region:
                     LbH_gamma_CA_like; cd04645"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(73075..73077,73111..73113,73117..73128,
                     73198..73200,73210..73215,73255..73257,73261..73263,
                     73267..73272,73279..73281,73315..73317,73324..73329,
                     73333..73335,73339..73341))
                     /locus_tag="PSPA7_0066"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(73111..73113,73126..73128,73198..73200))
                     /locus_tag="PSPA7_0066"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:100051"
     gene            73470..75515
                     /gene="prlC"
                     /locus_tag="PSPA7_0067"
                     /db_xref="GeneID:5358514"
     CDS             73470..75515
                     /gene="prlC"
                     /locus_tag="PSPA7_0067"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01432"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="YP_001345463.1"
                     /db_xref="GI:152988920"
                     /db_xref="GeneID:5358514"
                     /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLET
                     QREQPTWKGLVLAMDELNERLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTEL
                     GQNRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSR
                     LSELGSRFSNQLLDATQAWTKQVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEF
                     PSYYAVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLG
                     FANYAELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCAELQSWD
                     AGYYAEKLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADV
                     RLFEILENGEHVGRFYFDLYARANKRGGAWMDGARDRRRDARGRLIDPVAYLVCNFTP
                     AVNGKPALLTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENW
                     CWEPEGLALISAHYETGEALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHG
                     DGRSVLQVLEGIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFS
                     RFEEDGVFNPDTGRAFREAILARGGSQEPMLLFVDFRGREPSIDALLRHSGLVGEAA"
     misc_feature    73470..75503
                     /gene="prlC"
                     /locus_tag="PSPA7_0067"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    73530..75497
                     /gene="prlC"
                     /locus_tag="PSPA7_0067"
                     /note="Peptidase family M3 dipeptidyl carboxypeptidase
                     (DCP); Region: M3A_DCP; cd06456"
                     /db_xref="CDD:188995"
     misc_feature    order(74730..74738,74874..74879,74886..74888,74964..74966,
                     74973..74975,75120..75122,75240..75245,75261..75266,
                     75276..75284,75294..75296,75303..75305)
                     /gene="prlC"
                     /locus_tag="PSPA7_0067"
                     /note="active site"
                     /db_xref="CDD:188995"
     misc_feature    order(74874..74876,74886..74888,74964..74966)
                     /gene="prlC"
                     /locus_tag="PSPA7_0067"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188995"
     gene            75512..75787
                     /locus_tag="PSPA7_0068"
                     /db_xref="GeneID:5357220"
     CDS             75512..75787
                     /locus_tag="PSPA7_0068"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345464.1"
                     /db_xref="GI:152989128"
                     /db_xref="GeneID:5357220"
                     /translation="MSPVVTRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYA
                     DTLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
     misc_feature    75527..75751
                     /locus_tag="PSPA7_0068"
                     /note="Probable metal-binding protein (DUF2387); Region:
                     DUF2387; pfam09526"
                     /db_xref="CDD:150261"
     gene            75876..76139
                     /locus_tag="PSPA7_0069"
                     /db_xref="GeneID:5356187"
     CDS             75876..76139
                     /locus_tag="PSPA7_0069"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM family protein"
                     /protein_id="YP_001345465.1"
                     /db_xref="GI:152989078"
                     /db_xref="GeneID:5356187"
                     /translation="MSAPLPPRGRGTASNPLNRFAPTHSEAFDDGWEQDVPPIQLTEV
                     REEIARTVISRNQSPDLPFDRSINPYRGCEHVIVDKEMYGQSV"
     misc_feature    75984..>76100
                     /locus_tag="PSPA7_0069"
                     /note="DNA repair photolyase [DNA replication,
                     recombination, and repair]; Region: SplB; COG1533"
                     /db_xref="CDD:224450"
     gene            76186..78540
                     /locus_tag="PSPA7_0070"
                     /db_xref="GeneID:5357824"
     CDS             76186..78540
                     /locus_tag="PSPA7_0070"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase, phage integrase
                     family protein"
                     /protein_id="YP_001345466.1"
                     /db_xref="GI:152986166"
                     /db_xref="GeneID:5357824"
                     /translation="MPRKPFSKSALESRERPTLQRKLPENTPQAIQERSTARGQVDVS
                     AQGLLVRNKTTGTREYVRDFTDLVTEYPHHKLIVQQLLIGAQLHSAKRLITYQSHQDI
                     YYSIQEFVLFLNSAEPINKSVKGVADVDGQVCANFRSFLIRSYPGRTVNRKRYGALKN
                     IFLSLKNKYKGQGWVGKGFEWPTGPGMNEQITEGYSREIHNKLVEGCLIDIKFIMKWM
                     ESYNSVVEGEKPILAYDLSLENLMFDLVVKEQTKRSNGSIKATHIKGFEWVIRSTGDV
                     KEYIRANGISIERFLGIYRARAHELAAKGRPVVGTEVSERGMVYGCDREESGRIATAN
                     VGRLYPDWPMQVSFEEAGHLFSTEWSKNTAHGTNKKYSTLEKRLRSALMYMKVGPEHL
                     PYEVGQMAYFSRVAFTMGTIFPFFLFVMLQTGWNFEVVVSISDNLDDHIEEDLLDDDY
                     VIIYGYKGRSNKSQMHRSNKRDKFGTYQILRFVAAEVTKHFSSPHYLKGKLFQCVISK
                     NLWNKFGRLCTPVTTTNFGHASTEFLHRHRIKLDTDTKSPRIETKRLRTTYETRRREQ
                     GLDIDEVSTMMGHSDIDTTVNHYDSDWGSAEILNGRLRKIQRKHEEDFRRYSANLLTD
                     VSLVELREATLRCGSKEKLRSVVAPLVGRLNSSEDSVIQLLSPEGQTFIASCLNSRRP
                     DWPGAESFLRTDTPCNYFNRCPLCSQCVIFKEALPFIARRISDLDGLRERLNPLEWEK
                     SYRAEYLAWKGVLEGWGDPIEVAEAIDRSVHNDFALPLTMIGLS"
     misc_feature    <77821..77955
                     /locus_tag="PSPA7_0070"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(77839..77844,77950..77952)
                     /locus_tag="PSPA7_0070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(77842..77844,77851..77853,77920..77922,77950..77952)
                     /locus_tag="PSPA7_0070"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(77842..77844,77851..77853,77920..77922,77950..77952)
                     /locus_tag="PSPA7_0070"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(77851..77853,77950..77952)
                     /locus_tag="PSPA7_0070"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     misc_feature    78043..>78198
                     /locus_tag="PSPA7_0070"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:264487"
     gene            78537..80639
                     /locus_tag="PSPA7_0071"
                     /db_xref="GeneID:5359600"
     CDS             78537..80639
                     /locus_tag="PSPA7_0071"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase, phage integrase
                     family protein"
                     /protein_id="YP_001345467.1"
                     /db_xref="GI:152983603"
                     /db_xref="GeneID:5359600"
                     /translation="MTTPTRDQIKAVLEEIRNGLGCHEEESEPIATEEDDEILSGDSS
                     LGIICDSINLLNLSRIDKNEWSYIRVSPRSSFGDPVWDFGDYPSPNGFPIRINFDYVN
                     MYGVNVCGVGHEHWVNIARALLFYRVPHFGIHGRINAYTSLESDKTKVLRLVGLFQAE
                     GLYLGSENSPDFRTVNDLAKSSVEHYIESLPTSGIKWEFCYLMSFWQGVSSMGMLPSE
                     YSLYDSYVTKELVAKYRREYDESSRPFEPIPLDDYAEIFRYCVGFVENYSDDVLWLYK
                     NFAPTIVGAFENPGKLAAMNIGVSTASVEGVKRFRAYKPKLLDSGIPWWGIEIKERTH
                     ENDEGEYINQTAVISVVVSLIDACIVLLLCLTGMRRSEVIGLKVDCLSFKSEGYWLTY
                     TVFKTSISSQGDIKTIPIPKIAADAIEVIIEIGRDARAYGNHDYLFVKIPKLSFGNTP
                     QSTVVERACNRVANNLGIDYRVHPHRFRKSLALYIIHQDSRNLEIIKRLFSHRSLKMT
                     LRYILSLPGMNDEVKATLIEENTEILVEVLQGVISGQIGGIGGKRLAKTANSSPILRA
                     KLQNAGKESLSQYVASLLDEGVKLLHRTNLAICMRTPGLSSESPCDAKNDSPGSRLHP
                     NLFACDPYNCRYAAFVEANAPSLKNEIIFHDNMIKHRYCGATQKEYSQRRIAEAFKRL
                     HEVVGDEAHNFLKQVAHG"
     misc_feature    79602..80072
                     /locus_tag="PSPA7_0071"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(79641..79646,79722..79724,79956..79961,80067..80069)
                     /locus_tag="PSPA7_0071"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(79641..79643,79722..79724,79959..79961,79968..79970,
                     80040..80042,80067..80069)
                     /locus_tag="PSPA7_0071"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(79641..79643,79959..79961,79968..79970,80040..80042,
                     80067..80069)
                     /locus_tag="PSPA7_0071"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(79641..79643,79968..79970,80067..80069)
                     /locus_tag="PSPA7_0071"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            81409..81576
                     /locus_tag="PSPA7_0072"
                     /db_xref="GeneID:5354029"
     CDS             81409..81576
                     /locus_tag="PSPA7_0072"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345468.1"
                     /db_xref="GI:152984292"
                     /db_xref="GeneID:5354029"
                     /translation="MHCVRFSLGLDACISRAEKQFNGAALELNISSIKVVAARFEEIQ
                     FSENFDSIILA"
     gene            complement(82100..82255)
                     /locus_tag="PSPA7_0073"
                     /db_xref="GeneID:5358634"
     CDS             complement(82100..82255)
                     /locus_tag="PSPA7_0073"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345469.1"
                     /db_xref="GI:152984211"
                     /db_xref="GeneID:5358634"
                     /translation="MNKEGIKNILIHQLPVLRAKYNFSPFDWAIVQPLQKPSQDIRIV
                     SCRFITP"
     gene            82403..83269
                     /locus_tag="PSPA7_0074"
                     /db_xref="GeneID:5358903"
     CDS             82403..83269
                     /locus_tag="PSPA7_0074"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family site specific
                     recombinase"
                     /protein_id="YP_001345470.1"
                     /db_xref="GI:152989452"
                     /db_xref="GeneID:5358903"
                     /translation="MLKDQKLLAHINPVVKVTTLGFNLPSGRPAMHQREMQKFVRQTD
                     YEIALSVLNDPVYQIIAAIIRITGLRPIDLFQLPYRGRNENYGFIPYDEGEYPEGLDN
                     GAIYYYFRSKGKWRSIDFPGKLWRVICEYYLPLRRQRAKLYEAKHGIPPRNSDLFLSA
                     RGDVVTHGMLGYNFSKVVSAAKNSESATDFKAIRFNARMLRHTCATYFVYEALKAQNR
                     LGRSFVYDAALDEDLRKMLGHTDVRTTLEYYVHLVNRYVHDNLLTDLHRSRVDAGLSA
                     ILDRHNYSEIVV"
     misc_feature    82505..83146
                     /locus_tag="PSPA7_0074"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(82610..82615,82736..82738,82991..82996,83144..83146)
                     /locus_tag="PSPA7_0074"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(82610..82612,82736..82738,82994..82996,83003..83005,
                     83117..83119,83144..83146)
                     /locus_tag="PSPA7_0074"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(82610..82612,82994..82996,83003..83005,83117..83119,
                     83144..83146)
                     /locus_tag="PSPA7_0074"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(82610..82612,83003..83005,83144..83146)
                     /locus_tag="PSPA7_0074"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            83497..85473
                     /locus_tag="PSPA7_0075"
                     /db_xref="GeneID:5356369"
     CDS             83497..85473
                     /locus_tag="PSPA7_0075"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02384"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="YP_001345471.1"
                     /db_xref="GI:152988798"
                     /db_xref="GeneID:5356369"
                     /translation="MNTENHSQTAAFLWSIADLLRGDFKQSQYGRIILPFTLLRRMEC
                     VLEPTREAVIRESYAQEGRPDLVRERLLLRAAGQQFFNASKLTLGTLSDTQTAADLMS
                     YVQSFSKDAREIFEHFHFEDFVQQLSAANLLYQVVQRFAATDLSPERISNFGMGIIFE
                     ELIRKFAESSNETAGEHFTPRDIVHLTTSLVITGQDDKLKPNSIVTIYDPTAGTGGFL
                     SEGDEYIQSISQQVTVSLHGQELNPESYAICKADMLIKGQDVTSIKLGNTLSDDQLAD
                     SRFDFMLSNPPFGVEWKKVQKQITDEHSEKGFNGRFGPGLPRVSDGSLLFLLHLVSKM
                     RDPREGGSRIGIILNGSPLFTGGAGSGESEIRRYLLQNDLVEAIIALPTDMFYNTGIA
                     TYVWVLSNHKAAARQGKVQLIDGSQHFAKMRKSLGSKRQYLTEEQIDALVRLYGRFEE
                     TAQSKIFPVEAFGYRRITVERPLRLNFQVSSQRIEKVLEEKAIEKLEAPARQRLIEAL
                     QAMDASVVHRNREQFSKLLKKTLSAHDVSPSTPELKAILSGLSERDSEADICMVKGQP
                     EADAGLRDNENVPLGESVYDYFEREVKPHVADAWIDESKRDEQDGEVGIVGFEIPFNR
                     HFYVFQPPRPLEEIDRDLKGCTDRIKQMIEGLSA"
     misc_feature    83524..83916
                     /locus_tag="PSPA7_0075"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     misc_feature    83527..85035
                     /locus_tag="PSPA7_0075"
                     /note="Type I restriction-modification system
                     methyltransferase subunit [Defense mechanisms]; Region:
                     HsdM; COG0286"
                     /db_xref="CDD:223363"
     misc_feature    84112..>84360
                     /locus_tag="PSPA7_0075"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(84124..84144,84214..84219,84292..84300,84349..84351)
                     /locus_tag="PSPA7_0075"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            85470..86864
                     /locus_tag="PSPA7_0076"
                     /db_xref="GeneID:5353864"
     CDS             85470..86864
                     /locus_tag="PSPA7_0076"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01420"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system subunit
                     S"
                     /protein_id="YP_001345472.1"
                     /db_xref="GI:152984823"
                     /db_xref="GeneID:5353864"
                     /translation="MTFPCYPKYRASGVEWLDQVPDHWSSVPIKYMALERNSLFLDGD
                     WIESKDISSDGIRYITTGNVGEGAYKEQGAGFISEETFHALRCTEVYEGDVLVSRLNN
                     PIGRACVVPNLGGRVVTSVDNVIFRPDLKFYKKFIVYLFSSEEYFKHTSNLARGATMQ
                     RISRGLLGNIRVVTPSLEEQTQIARFLDHETARIDALIEEQQRLIELLKEKRQAVISH
                     AVTKGLDPTVPMKDSGVEWLGEVPAHWEVRSISSISKKITNGYVGPTRDILVDEPGVR
                     YLQSLHIKSNKIKFEVPYFVSEQWSAEHAKSILASGDVLIVQTGDIGQVAVVTEEHAG
                     CNCHALIIVSPVREVVLGEWVSWVLNSTYGYHSLLSIQTGAMHPHLNCGNVKFLNLPI
                     PPLEEQARIVSFIESGELEMDSLMSETKRSLLLLQERRTALISAAVTGKIDVRGWQPP
                     ASTQAPEPAVAEAD"
     misc_feature    <85485..86132
                     /locus_tag="PSPA7_0076"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    85596..86099
                     /locus_tag="PSPA7_0076"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     misc_feature    <85860..86792
                     /locus_tag="PSPA7_0076"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    86202..86690
                     /locus_tag="PSPA7_0076"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            86865..90068
                     /locus_tag="PSPA7_0077"
                     /db_xref="GeneID:5357729"
     CDS             86865..90068
                     /locus_tag="PSPA7_0077"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF04313; match to protein family HMM PF04851"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system subunit
                     R"
                     /protein_id="YP_001345473.1"
                     /db_xref="GI:152989118"
                     /db_xref="REBASE:PaePA7ORF75P"
                     /db_xref="GeneID:5357729"
                     /translation="MADSKEAQFQQDIITAMVAQGWLTGPASGYDRRTALYTEDFLGY
                     FKDAWPERWDKFAKANPNNPESVLVQKLVRELEQDGTLDVLRHGFKLPGVKIEACSFK
                     PDHGMNPDTLKRYQCNRLRVVQEVSYSPHCREGEYNPRLDLVLFVNGIPVATLELKSE
                     FKQSVENAKRQYRYDRPVKDPLTRKPEPLLTFKRGALVHFAVSQDEVAMTTQLAGKET
                     FFLPFNLGSLDGGAGNPPAPDDSQYATGYLWQRLFQPDAWLKVLGRFLHLQKSVKEDA
                     DGKRVTKETLIFPRYHQWEVVNRLIETTRNEGPGKRYLIQHSAGSGKSNSIAWTAHQL
                     ASLYDAEGQRLFNSVIVITDRTVLDKQLQDTIYQFEHAQGVVKCITRDIGSQSKSEQL
                     AEALAEQTRIIIVTIQTFPALFDALDKYPKLASGHYAVIADEAHSSQTGSSASKLKQI
                     LGSDAVLGKEGDAEEISAEELLDAAVAARAPNERISYYAFTATPKAKTLELFGRVPDP
                     TLPASADNKPEAFHLYSMRQAIEEGFILDVLQNYTTYSTAWKIAHPDGDDEEVDSKKA
                     RMKLARWVRLHPYNINQKVEVIVGHFRANIRHLLGGQAKAMVVTSSRQEAVRYQLAVQ
                     AYVKQMGYTDVHPLVAFSGSVLPDGVIPEEVTESSSLLNPGLNGRDLAEAFDTQDFNV
                     MIAANKYQTGFDQPKLCAMYVDKKLQGVDCVQTLSRLNRTFGDSKPTFILDFFNDPQD
                     ILDAFLPYYTKAELTDVTDPQLIYDLQKKLDAEGIYHWEEVAAFALAFFDPKAAASKL
                     SYYCAPAKERFAKRYKLAQESRQHALDFKRTAEQNGDSAGVKKAEAAVKEAGEQVDQL
                     DLFKKNLQSFVRLYEFLSQIIPYEDRELEQLCVYAKHLHPLLRVDRLDQEDVDVGELQ
                     LTHYRLTKRAEHQLRLSEEQGDYGLKPPTGLGSGKPHDPEKKRLSEIIEALNDIFGAE
                     VSDEDQLQFLTGIANRISRQEDVMAQVNNHSVEQVMHGLFPKRVLDTVLDAMTDNEKM
                     SLEVLDNETKSRAFALVILKMLTAAGGLGQGISGAAV"
     misc_feature    86880..89120
                     /locus_tag="PSPA7_0077"
                     /note="type I site-specific deoxyribonuclease, HsdR
                     family; Region: hsdR; TIGR00348"
                     /db_xref="CDD:232933"
     misc_feature    87057..87515
                     /locus_tag="PSPA7_0077"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:252519"
     misc_feature    87804..>88172
                     /locus_tag="PSPA7_0077"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    87822..87836
                     /locus_tag="PSPA7_0077"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    88161..88172
                     /locus_tag="PSPA7_0077"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     gene            complement(90100..90321)
                     /locus_tag="PSPA7_0078"
                     /db_xref="GeneID:5356177"
     CDS             complement(90100..90321)
                     /locus_tag="PSPA7_0078"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345474.1"
                     /db_xref="GI:152989688"
                     /db_xref="GeneID:5356177"
                     /translation="MDKLAKALGERIRMQRKACRISQDALALACSLDRSYVGRIERGE
                     VNITVEKLYRIAGELACDPSSLLPKPSEI"
     misc_feature    complement(90124..90297)
                     /locus_tag="PSPA7_0078"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(90196..90198,90271..90273,90283..90285))
                     /locus_tag="PSPA7_0078"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(90199..90201,90274..90276))
                     /locus_tag="PSPA7_0078"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(90193..90198,90208..90210,90217..90219,
                     90250..90255))
                     /locus_tag="PSPA7_0078"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            90573..91013
                     /locus_tag="PSPA7_0079"
                     /db_xref="GeneID:5354689"
     CDS             90573..91013
                     /locus_tag="PSPA7_0079"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345475.1"
                     /db_xref="GI:152987774"
                     /db_xref="GeneID:5354689"
                     /translation="MYEQIRRLVRAGWVSPDEDRRVRGQVYHLQPIPTHLQLELIDNG
                     FENSLMAAGMPEPGTAVRDAEALPLESSANTDLQLEALHKEIRLDFLTSMGEAERFKL
                     LLDEMPHLRDKLEGDYLEARDRSSRLLGHLRAIEKTLKTLAAPR"
     gene            91010..92410
                     /locus_tag="PSPA7_0080"
                     /db_xref="GeneID:5355264"
     CDS             91010..92410
                     /locus_tag="PSPA7_0080"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00271"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase domain-containing protein"
                     /protein_id="YP_001345476.1"
                     /db_xref="GI:152986233"
                     /db_xref="GeneID:5355264"
                     /translation="MSSSLRSWQNSCITRALEHFTVTPHFFCQATPGAGKTRMAAELA
                     IRLLEQDRIDLVLCFAPSCQVVEGFRSTFAAVLGRRLDGQIGAVGAAYTYQAMEYRDE
                     GFWQLLDDYRVFVVFDEIHHCAGHDPLLSNAWGQQILHRIQDRAAFTLALSGTPWRSD
                     DKAIALARYSSPEGHLICDYRYGLKDAIADDVCRSPRIVLLDNQKVKLTEELGADSSV
                     RLFPSIAKLLGESPVTYEELLRHDEVINPILDLGCSKLNELRQIKPDAAGLVVATDIE
                     HAQQVVLALEAMGEECRIVTNKTPDAQQVINAFRSSACRWIVAVGMISEGTDIPRLQV
                     CCYLSRIRTELHYRQVLGRVLRRTGESDDQAWLFMLAEPTLQSFAERIADDLPDDLAV
                     LNEVQMPASTSGSKAGLIGAAGNIDGLDDSMKIGVEQVIGADTANIVSLGGGAAGPSY
                     QVSFSQHYRQQLLACF"
     misc_feature    91019..91477
                     /locus_tag="PSPA7_0080"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     misc_feature    91844..92080
                     /locus_tag="PSPA7_0080"
                     /note="Helicase conserved C-terminal domain; Region:
                     Helicase_C; cl17351"
                     /db_xref="CDD:266641"
     gene            92565..92828
                     /locus_tag="PSPA7_0081"
                     /db_xref="GeneID:5355591"
     CDS             92565..92828
                     /locus_tag="PSPA7_0081"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345477.1"
                     /db_xref="GI:152983764"
                     /db_xref="GeneID:5355591"
                     /translation="MTLPRERTRSVIKTEEFLRELSRNTELPQDIRSYAKSLLRHYPS
                     ADQIYSLGRLEECLVGDAPDDVYRRRVIALHWPLFSSSLDFIE"
     gene            93260..93445
                     /locus_tag="PSPA7_0082"
                     /db_xref="GeneID:5356385"
     CDS             93260..93445
                     /locus_tag="PSPA7_0082"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345478.1"
                     /db_xref="GI:152987146"
                     /db_xref="GeneID:5356385"
                     /translation="MVMQQAGTEVGMAISALFYLGKDGSTPECIAAIKKVLRPEDLTT
                     LMACKMPKWMRMALELT"
     gene            complement(93623..93739)
                     /locus_tag="PSPA7_0083"
                     /db_xref="GeneID:5357271"
     CDS             complement(93623..93739)
                     /locus_tag="PSPA7_0083"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345479.1"
                     /db_xref="GI:152989392"
                     /db_xref="GeneID:5357271"
                     /translation="MVLETGSMKFRHVDGKCTGSSMKLLARDPWVCAWNDIW"
     gene            complement(93779..93901)
                     /locus_tag="PSPA7_0084"
                     /db_xref="GeneID:5356309"
     CDS             complement(93779..93901)
                     /locus_tag="PSPA7_0084"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345480.1"
                     /db_xref="GI:152986039"
                     /db_xref="GeneID:5356309"
                     /translation="MFPPNSNQVFCCANPEQEAVLPQTSNVTANAFLTQVPTLF"
     gene            93984..94133
                     /locus_tag="PSPA7_0085"
                     /db_xref="GeneID:5356542"
     CDS             93984..94133
                     /locus_tag="PSPA7_0085"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345481.1"
                     /db_xref="GI:152985098"
                     /db_xref="GeneID:5356542"
                     /translation="MTDVEGSIAMFALVNRNKPLIVVSESHPILEEGMEWSPPATQET
                     CSGQP"
     gene            complement(95398..96480)
                     /locus_tag="PSPA7_0086"
                     /db_xref="GeneID:5356547"
     CDS             complement(95398..96480)
                     /locus_tag="PSPA7_0086"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00817"
                     /codon_start=1
                     /transl_table=11
                     /product="ultraviolet light resistance protein B"
                     /protein_id="YP_001345482.1"
                     /db_xref="GI:152984582"
                     /db_xref="GeneID:5356547"
                     /translation="MRSSKGEHGPVLIDFLLHINGDVSARVVRVLRELAPRLEVYSID
                     ESFLDLAGLGRPLAGYGRHIRAEVQRLTGMPVGVGISTTKTLAKLANWAAKRRSQSGV
                     VVATRPEQQAALLKDAPLGEVWGVGRKLQAHLGALGVKTAWDLAQQDAWTMRKQFSVV
                     LEKTIRELRGEACFALDEGPEPKQMITCSRSFSRRVTELAPLREAVASYACRAAEKLR
                     AQGDVCQLLQVYIRTGVFNPDEPRYARTASVPLHTPSNDSRDLVQAALAGLEGIYRPG
                     YRYQKAGVMLMNLASPGQVQADLFAPAPRPRSAALMATVDRINTNMGRGTVRLARVPA
                     LGGWSMKQELRSPGYTCRWDELPRVL"
     misc_feature    complement(95617..>96420)
                     /locus_tag="PSPA7_0086"
                     /note="umuC subunit of DNA Polymerase V; Region:
                     PolY_Pol_V_umuC; cd01700"
                     /db_xref="CDD:176454"
     misc_feature    complement(order(95758..95760,95764..95778,95833..95835,
                     95914..95931,96004..96006,96091..96111,96346..96348,
                     96355..96357))
                     /locus_tag="PSPA7_0086"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176454"
     misc_feature    complement(95404..95559)
                     /locus_tag="PSPA7_0086"
                     /note="Domain of unknown function (DUF4113); Region:
                     DUF4113; pfam13438"
                     /db_xref="CDD:257763"
     gene            complement(98024..100189)
                     /locus_tag="PSPA7_0087"
                     /db_xref="GeneID:5359150"
     CDS             complement(98024..100189)
                     /locus_tag="PSPA7_0087"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family site specific
                     recombinase"
                     /protein_id="YP_001345483.1"
                     /db_xref="GI:152983696"
                     /db_xref="GeneID:5359150"
                     /translation="MSTPSVTPYVPFDASKYVRQSDLSKIELSILSNRSHRSDWGYLQ
                     SEIPELMRPLADIAAHSGVSQRLAISSVAVILWNVSKTGKPYWCWSESQWLTLLSNRA
                     GSRPYLASVAYHLGDFRTPQRIAKFRQPAIYASFIFGHAVFRHEHVRLSQALRSLGYA
                     ARHLEQFLSNVLGALMLENGDPRLETFTEELLLKGQQHRSEGVARSVGKVSHGLAAMG
                     ILAKPLRMRGYTCWRAKSIEGIDPTWAMWCRRWRDTSTLRPRTRESNYSFILRTGVWL
                     AREQSGMAAPTDWSMSTCAAFIAAVDRMTVGEWALESAKGTQLKGLGQPIAANSKRGF
                     LHALRRFFTDFELWGWGRLKFSPRHHLATPRSVTFNSGINPRVIDDSTWLKLIWASLN
                     LERSDLLSEIHYPLSMVQAIAVVWTHAGLRSNEIMRLDKRCAHPQTNDVVHEDGTIVP
                     AKTLCYLDIPASKTFKAFVKPVAVVVKERIDAWLEDRPANQAALLDERTGEKVSYLFQ
                     FRGKRIGSSVINGTIIPMLCAKAGVPLEDSRGRITSHRGRASAVTALASVPQGMSLIE
                     LMQWSGHSSPNSTLHYIRIRPTKLAASFVKADQMAHMVSVLIDHDVIVRHSDAPYTFY
                     DLGDSYCSNPFWSSCPHRMACAGCDFNLPKASARAQALESKSSIGRYLEAVPLTPDER
                     AIAEGDLEKLESLIRKLDNVPALDGRMPRRSMRERGGYK"
     misc_feature    complement(98438..98968)
                     /locus_tag="PSPA7_0087"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(98444..98446,98555..98560,98801..98803,
                     98921..98926))
                     /locus_tag="PSPA7_0087"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(98444..98446,98471..98473,98546..98548,
                     98555..98557,98801..98803,98924..98926))
                     /locus_tag="PSPA7_0087"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(98444..98446,98471..98473,98546..98548,
                     98555..98557,98924..98926))
                     /locus_tag="PSPA7_0087"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(98444..98446,98546..98548,98924..98926))
                     /locus_tag="PSPA7_0087"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(101261..101386)
                     /locus_tag="PSPA7_0088"
                     /db_xref="GeneID:5356705"
     CDS             complement(101261..101386)
                     /locus_tag="PSPA7_0088"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="protein UmuC"
                     /protein_id="YP_001345484.1"
                     /db_xref="GI:152988461"
                     /db_xref="GeneID:5356705"
                     /translation="MVSRSNEAKALGIGMGEPFFKIRDLVQAHGVLAFSSNYALY"
     misc_feature    complement(<101264..101383)
                     /locus_tag="PSPA7_0088"
                     /note="Y-family of DNA polymerases; Region: PolY; cl12025"
                     /db_xref="CDD:264514"
     gene            complement(101758..102012)
                     /locus_tag="PSPA7_0089"
                     /db_xref="GeneID:5358381"
     CDS             complement(101758..102012)
                     /locus_tag="PSPA7_0089"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345485.1"
                     /db_xref="GI:152987476"
                     /db_xref="GeneID:5358381"
                     /translation="MGGACLVNAARCRRLHCYLTAPYFLLLALGGLLAYGFDPHGEQF
                     SRLWLLLALGAAPLLIWLPERLAGRKYLGAPGCGEGRECR"
     gene            complement(102193..103875)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /db_xref="GeneID:5359448"
     CDS             complement(102193..103875)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /EC_number="1.16.1.1"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00070; match to protein family HMM PF00403; match to
                     protein family HMM PF01266; match to protein family HMM
                     PF02852; match to protein family HMM PF07992; match to
                     protein family HMM TIGR02053"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercuric reductase"
                     /protein_id="YP_001345486.1"
                     /db_xref="GI:152985903"
                     /db_xref="GeneID:5359448"
                     /translation="MTELKIIGMTCASCVVHVKEALEKIPGVHRADVSYASGRAELKV
                     DEAVSREQMQAAVEALGYRAAFEDITLPTRPGLLDKARGWLSGGTDAGKEGDRLHVAV
                     IGSGGAAMAAALKAVERGARVTLIERGIIGGTCVNVGCVPSKIMIRAAHVAHLRRESP
                     FDGGLPATPPLVLRERLLAQQQGRVDELRHAKYEGILESTPAITVLRGSARFQDSHTL
                     SVELVEGGERIVTFDRCLIATGASAAVPPIPGLQDTPFWNSEKALASSSIPQRLAVIG
                     SSVVALELAQAFARLGSRVTILARNSLFFREDPAIGAALTAAFRLEGIEVLEQTQASQ
                     VAHANGEFVLTTKHGEVRVDQLLVATGRTPNTHGLNLEAAGVQLDERGAIQIDQGMRS
                     SKADIYAAGDCTNQPQFVYVAAAAGNRAAINMTGGEAMLNLDTMPAVVFTDPQVATVG
                     FSEAEAHQAGLETDSRTLTLDNVPRALANFDTRGFIKLVAETGSGRLLGVQAVTPEAG
                     ELIQTAALAIRARMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSCCAG"
     misc_feature    complement(102196..103875)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /note="putative mercuric reductase; Provisional; Region:
                     PRK13748"
                     /db_xref="CDD:184298"
     misc_feature    complement(103681..103869)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(103834..103836,103843..103851))
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(102973..>103290)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(102835..103065)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(102241..102570)
                     /gene="merA2"
                     /locus_tag="PSPA7_0090"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            complement(103908..104342)
                     /locus_tag="PSPA7_0091"
                     /db_xref="GeneID:5359338"
     CDS             complement(103908..104342)
                     /locus_tag="PSPA7_0091"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF03203"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercury transport protein MerC"
                     /protein_id="YP_001345487.1"
                     /db_xref="GI:152986621"
                     /db_xref="GeneID:5359338"
                     /translation="MANSFNLFTRIGDKAGSVGVLVSAIGCASCFPALASLGATIGLG
                     FLSQWEGLFITTLLPLFAGVALLVNALGWFSHRQWRRAAPGLIGPALVLVAVFLMLAH
                     GWRSGWLLYIGLAVMFGVSIWDFVSPAHRRCSPASCPTPPNQ"
     misc_feature    complement(103911..104330)
                     /locus_tag="PSPA7_0091"
                     /note="putative mercury transport protein MerC;
                     Provisional; Region: PRK13755"
                     /db_xref="CDD:237490"
     gene            complement(104355..104630)
                     /gene="merP3"
                     /locus_tag="PSPA7_0092"
                     /db_xref="GeneID:5356453"
     CDS             complement(104355..104630)
                     /gene="merP3"
                     /locus_tag="PSPA7_0092"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00403; match to protein family HMM TIGR02052"
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transport periplasmic protein"
                     /protein_id="YP_001345488.1"
                     /db_xref="GI:152984115"
                     /db_xref="GeneID:5356453"
                     /translation="MKKLLAALALIAVVSPVWAASQIITLSVPGMTCAACPITVKKAL
                     TKVEGVTKAEVSYEKREAIVTFDDAKTSAQALTKATEDAGYPSSVKQ"
     misc_feature    complement(104367..104558)
                     /gene="merP3"
                     /locus_tag="PSPA7_0092"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(104523..104525,104532..104540))
                     /gene="merP3"
                     /locus_tag="PSPA7_0092"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            complement(104644..104994)
                     /locus_tag="PSPA7_0093"
                     /db_xref="GeneID:5358164"
     CDS             complement(104644..104994)
                     /locus_tag="PSPA7_0093"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02411"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercuric transport protein"
                     /protein_id="YP_001345489.2"
                     /db_xref="GI:229577673"
                     /db_xref="GeneID:5358164"
                     /translation="MSESRNGRGALLTGGLAAILASTCCLGPLVLIALGFSGAWIGSL
                     TVLEPYRPFFIGAALVALFFAYRRIFRPAQVCIPGEVCADPQVSTIYKLVFWVVTALV
                     LVALAFPYILPLFY"
     misc_feature    complement(104647..104994)
                     /locus_tag="PSPA7_0093"
                     /note="putative mercuric transport protein; Provisional;
                     Region: PRK13751"
                     /db_xref="CDD:184301"
     gene            105066..105476
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /db_xref="GeneID:5359143"
     CDS             105066..105476
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00376; match to protein family HMM PF09278; match to
                     protein family HMM TIGR02051"
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="YP_001345490.1"
                     /db_xref="GI:152989484"
                     /db_xref="GeneID:5359143"
                     /translation="MHNAVESLTIGAFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIR
                     RYGEADVARVRFVKSAQRLGFSLDEVAGLLRLDDGAHCDEARVLAEQKLEDVREKLAD
                     LQRIESVLAQLVDDCCASQGTVSCPLIVSLQASK"
     misc_feature    105066..105473
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /note="putative transcriptional regulator MerR;
                     Provisional; Region: PRK13752"
                     /db_xref="CDD:184302"
     misc_feature    105087..105464
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /note="Helix-Turn-Helix DNA binding domain of the MerR1
                     transcription regulator; Region: HTH_MerR1; cd04783"
                     /db_xref="CDD:133410"
     misc_feature    order(105090..105098,105138..105140,105189..105197)
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133410"
     misc_feature    order(105231..105233,105240..105242,105252..105257,
                     105282..105284,105309..105314,105321..105323,
                     105330..105332,105342..105344,105360..105362,
                     105372..105374,105381..105386,105405..105407,
                     105420..105425,105441..105443,105447..105449)
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133410"
     misc_feature    order(105309..105311,105414..105416,105441..105443)
                     /gene="merR3"
                     /locus_tag="PSPA7_0094"
                     /note="mercury binding site [ion binding]; other site"
                     /db_xref="CDD:133410"
     gene            complement(105619..105801)
                     /locus_tag="PSPA7_0095"
                     /db_xref="GeneID:5356805"
     CDS             complement(105619..105801)
                     /locus_tag="PSPA7_0095"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345491.1"
                     /db_xref="GI:152987049"
                     /db_xref="GeneID:5356805"
                     /translation="MRDKADAILVAETVKKIEQLGATAAGRGEAKRSPAVRLQGRYVL
                     LDQMQRGPAPLMHKGK"
     gene            complement(106040..106180)
                     /locus_tag="PSPA7_0096"
                     /db_xref="GeneID:5354942"
     CDS             complement(106040..106180)
                     /locus_tag="PSPA7_0096"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345492.1"
                     /db_xref="GI:152987639"
                     /db_xref="GeneID:5354942"
                     /translation="MRAENAQLSQDLARLASVNQTLILELAQLKGVATGKVVLLSSKP
                     AS"
     gene            complement(106465..108318)
                     /locus_tag="PSPA7_0097"
                     /db_xref="GeneID:5357552"
     CDS             complement(106465..108318)
                     /locus_tag="PSPA7_0097"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase, phage integrase
                     family protein"
                     /protein_id="YP_001345493.1"
                     /db_xref="GI:152985228"
                     /db_xref="GeneID:5357552"
                     /translation="MTLLSANRNSRAALKAYDVLFAQPVTASGLSKAERDAIVISAIV
                     NDRGETLVLSRFGDARWDLRPFFDQSNVNEGHKYVSWDFNLPPEMIDDCKAVAYAWFK
                     RGLPGSKPPVARGITTLVSASVIPFIRWLSDLELERFSDVRPIHISNYIHHCKSESLR
                     PMPLYSRLRIIDFLWIFSAETLSPLQCFPWGDSSLWRVSGIGEARGTSAANKNTGRTD
                     IIPPDDQAKIFNYCEQIVHKTKEDLKATGIDTFTRRSPKMIRCRDAVLYIASITSGMR
                     NEEVIGIEVGAWRKEVVDGVTYCWVTTTEHKTGKGRVDYLVPELTLDALNLFAMCSTP
                     MRRELEAELSDLELSCNSVDSADLLLRLEKARKDSKRLFLCLNGYGNKAERVGHIEVL
                     SAAGSNEAFKRVAKAAGSDWPLRTHQCRRTYARCFVESRMGRTSLVFLKWQFKHSSMS
                     MTQLYASNPLQDLTLFDEILQQMTEFKIDLIESWLDDQPLAGGAGERIMELRAIPIKD
                     RSALLAQTAPHANIRATGHGWCIATERGCGGAGLYEATRCPGCKHSVIDETFATTWQG
                     IYSHQLELMEIDDAGPAVRQRAKRDMQVAFDVISSLGLSPLDARDSDPTRT"
     misc_feature    complement(106951..107577)
                     /locus_tag="PSPA7_0097"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(106954..106956,107068..107073,
                     107398..107400,107488..107493))
                     /locus_tag="PSPA7_0097"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(106954..106956,106981..106983,
                     107059..107061,107068..107070,107398..107400,
                     107491..107493))
                     /locus_tag="PSPA7_0097"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(106954..106956,106981..106983,
                     107059..107061,107068..107070,107491..107493))
                     /locus_tag="PSPA7_0097"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(106954..106956,107059..107061,
                     107491..107493))
                     /locus_tag="PSPA7_0097"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(108299..109915)
                     /locus_tag="PSPA7_0098"
                     /db_xref="GeneID:5355331"
     CDS             complement(108299..109915)
                     /locus_tag="PSPA7_0098"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345494.1"
                     /db_xref="GI:152983668"
                     /db_xref="GeneID:5355331"
                     /translation="MARKKNYKAEMQSVTKGFETVENELRIDLPKNPRNVTKIDHSQY
                     IGFGFDAWAIQSIHVIRALVNGGNFSLATLVGYSSNGLRYFMAFLKSGTIDSPPSTPN
                     SLTKRHLERYVSWLKLKYPNGSTAKNYYTSLKSLIISLIEYGFVEADKDDLLPAVPFP
                     HTAKSTNDAKPLSLSEMQGLITALKSDLVAIHKGLFSGNDAEAMTVLLLITAARSGIN
                     TTPLLEMSRDALQPHPFIPNLWLLNTVKRRGKGAQSKTIRKTELHDGYNPIPLDGVAV
                     VNKALAISEPLVGFAPEKLKSHVWLYRAGQNGHGHRVVALASSTLFQSTKSICARHAL
                     KDDQGQPLIVNLSRLRKTMESRLWKLSGGDLLEVSAVMGHSPSVADNHYLKINDEIKV
                     EGATFVGEAFTDQLRGINVTPTPPGGCKDSLYGSLAPKDGVTHCSEFIHCLTCPSYAI
                     VGTLGDLYRLFSYQQFLHAEMEYFLTDEWAAWRKRQGDFIRLIDEFTSRKFKIELIEA
                     AKAKAKASPHPFWGCKIEFMRKVRGDALVG"
     misc_feature    complement(108761..109390)
                     /locus_tag="PSPA7_0098"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(108767..108769,108875..108880,
                     109166..109168,109271..109276))
                     /locus_tag="PSPA7_0098"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(108767..108769,108794..108796,
                     108866..108868,108875..108877,109166..109168,
                     109274..109276))
                     /locus_tag="PSPA7_0098"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(108767..108769,108794..108796,
                     108866..108868,108875..108877,109274..109276))
                     /locus_tag="PSPA7_0098"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(108767..108769,108866..108868,
                     109274..109276))
                     /locus_tag="PSPA7_0098"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(111181..111309)
                     /locus_tag="PSPA7_0099"
                     /db_xref="GeneID:5358032"
     CDS             complement(111181..111309)
                     /locus_tag="PSPA7_0099"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="ultraviolet light resistance protein B"
                     /protein_id="YP_001345495.1"
                     /db_xref="GI:152988752"
                     /db_xref="GeneID:5358032"
                     /translation="MPTYALVDCNNFYVSCERLFRPDLRAVPMVVLSNNDLRDCFR"
     misc_feature    complement(<111202..111297)
                     /locus_tag="PSPA7_0099"
                     /note="Y-family of DNA polymerases; Region: PolY; cl12025"
                     /db_xref="CDD:264514"
     gene            complement(111309..111752)
                     /locus_tag="PSPA7_0100"
                     /db_xref="GeneID:5353818"
     CDS             complement(111309..111752)
                     /locus_tag="PSPA7_0100"
                     /EC_number="3.4.21.-"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00717"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MucA"
                     /protein_id="YP_001345496.1"
                     /db_xref="GI:152987517"
                     /db_xref="GeneID:5353818"
                     /translation="MRLSMALTVIGRPSRPGLRLPLFLSRVAAGFPSPAEDHIEASLS
                     LDELCVVHPAATFFLRVVGDSMTGLGIFDGDILVVDRSITPRAGMVVVAVVNGEFTCK
                     QLAYEHGAPVLRAANKAYPDIRLRDGEDLEVFGVVTRCIHKLPGF"
     misc_feature    complement(111339..111584)
                     /locus_tag="PSPA7_0100"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    complement(order(111447..111449,111558..111560))
                     /locus_tag="PSPA7_0100"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            complement(111876..112310)
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /db_xref="GeneID:5353952"
     CDS             complement(111876..112310)
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00376; match to protein family HMM PF09278; match to
                     protein family HMM TIGR02051"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator MerR"
                     /protein_id="YP_001345497.1"
                     /db_xref="GI:152986692"
                     /db_xref="GeneID:5353952"
                     /translation="MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLLEPDKPYGSIR
                     RYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASSLAEHKLKDVREKMAD
                     LARMEAVLSELVCACHARRGNVSCPLIASLQGGASLAGSAMP"
     misc_feature    complement(111879..112310)
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /note="putative transcriptional regulator MerR;
                     Provisional; Region: PRK13752"
                     /db_xref="CDD:184302"
     misc_feature    complement(111912..112289)
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /note="Helix-Turn-Helix DNA binding domain of the MerR1
                     transcription regulator; Region: HTH_MerR1; cd04783"
                     /db_xref="CDD:133410"
     misc_feature    complement(order(112179..112187,112236..112238,
                     112278..112286))
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133410"
     misc_feature    complement(order(111927..111929,111933..111935,
                     111951..111956,111969..111971,111990..111995,
                     112002..112004,112014..112016,112032..112034,
                     112044..112046,112053..112055,112062..112067,
                     112092..112094,112119..112124,112134..112136,
                     112143..112145))
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133410"
     misc_feature    complement(order(111933..111935,111960..111962,
                     112065..112067))
                     /gene="merR2"
                     /locus_tag="PSPA7_0101"
                     /note="mercury binding site [ion binding]; other site"
                     /db_xref="CDD:133410"
     gene            112382..112732
                     /locus_tag="PSPA7_0102"
                     /db_xref="GeneID:5355927"
     CDS             112382..112732
                     /locus_tag="PSPA7_0102"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02411"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercuric transport protein"
                     /protein_id="YP_001345498.2"
                     /db_xref="GI:229577672"
                     /db_xref="GeneID:5355927"
                     /translation="MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNL
                     AVLEPYRPIFIGVALVALFFAWRRIYRQAAACKPGEVCAIPQVRATYKLIFWIVAALV
                     LVALGFPYVMPFFY"
     misc_feature    112382..112729
                     /locus_tag="PSPA7_0102"
                     /note="putative mercuric transport protein; Provisional;
                     Region: PRK13751"
                     /db_xref="CDD:184301"
     gene            112745..113020
                     /gene="merP2"
                     /locus_tag="PSPA7_0103"
                     /db_xref="GeneID:5357679"
     CDS             112745..113020
                     /gene="merP2"
                     /locus_tag="PSPA7_0103"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00403; match to protein family HMM TIGR02052"
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transport periplasmic protein"
                     /protein_id="YP_001345499.1"
                     /db_xref="GI:152988491"
                     /db_xref="GeneID:5357679"
                     /translation="MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAI
                     SKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ"
     misc_feature    112817..113008
                     /gene="merP2"
                     /locus_tag="PSPA7_0103"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(112835..112843,112850..112852)
                     /gene="merP2"
                     /locus_tag="PSPA7_0103"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            113092..114777
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /db_xref="GeneID:5355767"
     CDS             113092..114777
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /EC_number="1.16.1.1"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00070; match to protein family HMM PF00403; match to
                     protein family HMM PF01266; match to protein family HMM
                     PF02852; match to protein family HMM PF07992; match to
                     protein family HMM TIGR02053"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercuric reductase"
                     /protein_id="YP_001345500.1"
                     /db_xref="GI:152983768"
                     /db_xref="GeneID:5355767"
                     /translation="MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAI
                     VPGTSPDALTAAVAGLGYKATLADAPLADNRVGLLDKVRGWMAAAEKHSGNEPPVQVA
                     VIGSGGAAMAAALKAVEQGAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRES
                     PFDGGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQS
                     LTVRLNEGGERVVMFDRCLVATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVI
                     GSSVVALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAFRAEGIEVLEHTQAS
                     QVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIAIDQGMR
                     TSNPNIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATV
                     GYSEAEAHHDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEA
                     GELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
     misc_feature    113092..114774
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /note="putative mercuric reductase; Provisional; Region:
                     PRK13748"
                     /db_xref="CDD:184298"
     misc_feature    113101..113286
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(113116..113124,113131..113133)
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    <113731..114003
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    113905..114135
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    114400..114729
                     /gene="merA1"
                     /locus_tag="PSPA7_0104"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            114795..115160
                     /gene="merD"
                     /locus_tag="PSPA7_0105"
                     /db_xref="GeneID:5356389"
     CDS             114795..115160
                     /gene="merD"
                     /locus_tag="PSPA7_0105"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00376; match to protein family HMM TIGR02054"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator MerD"
                     /protein_id="YP_001345501.1"
                     /db_xref="GI:152986403"
                     /db_xref="GeneID:5356389"
                     /translation="MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDD
                     AALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLALLRQFVERRREALADL
                     EVQLATLPTEPAQHAESLP"
     misc_feature    114795..115157
                     /gene="merD"
                     /locus_tag="PSPA7_0105"
                     /note="transcriptional regulator MerD; Provisional;
                     Region: PRK13749"
                     /db_xref="CDD:184299"
     misc_feature    114804..115124
                     /gene="merD"
                     /locus_tag="PSPA7_0105"
                     /note="Helix-Turn-Helix DNA binding domain of the MerD
                     transcription regulator; Region: HTH_MerD; cd01111"
                     /db_xref="CDD:133386"
     misc_feature    order(114807..114815,114855..114857,114906..114914)
                     /gene="merD"
                     /locus_tag="PSPA7_0105"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133386"
     misc_feature    order(114948..114950,114957..114959,114969..114974,
                     114999..115001,115056..115058,115068..115070,
                     115086..115088,115098..115100,115107..115112)
                     /gene="merD"
                     /locus_tag="PSPA7_0105"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133386"
     gene            115157..115393
                     /locus_tag="PSPA7_0106"
                     /db_xref="GeneID:5355498"
     CDS             115157..115393
                     /locus_tag="PSPA7_0106"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF05052"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercury resistance protein"
                     /protein_id="YP_001345502.1"
                     /db_xref="GI:152988141"
                     /db_xref="GeneID:5355498"
                     /translation="MNNPERLPSETHKPITGYLWGGLAVLTCPCHLPILAVVLAGTTA
                     GAFLGEHWVIAALGLTGLFLLSLSRALRAFRERE"
     misc_feature    115157..115390
                     /locus_tag="PSPA7_0106"
                     /note="putative mercury resistance protein; Provisional;
                     Region: PRK13747"
                     /db_xref="CDD:184297"
     gene            115390..116391
                     /locus_tag="PSPA7_0107"
                     /db_xref="GeneID:5353716"
     CDS             115390..116391
                     /locus_tag="PSPA7_0107"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00563"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345503.1"
                     /db_xref="GI:152985522"
                     /db_xref="GeneID:5353716"
                     /translation="MSAFRPDGWTTPELAQAVERGQLELHYQPVVDLRSGGIVGAEAL
                     LRWRHPTLGLLPPGQFLPVVESSGLMPEIGAWVLGEACRQMRDWRMLAWRPFRLAVNV
                     SASQVGPDFDGWVKGVLADAELPAEYLEIELTESVAFGDPAIFPALDALRQIGVRFAA
                     DDFGTGYSCLQHLKCCPISTLKIDQSFVAGLANDRRDQTIVHTVIQLAHGLGMDVVAE
                     GVETSASLDLLRQADCDTGQGFLFAKPMPAAAFAVFVSQWRGATMNASDSTTTSCCVC
                     CKEIPLDAAFTPEGAEYVEHFCGLECYQRFEARAKTGNETDADPNAGFGEQWNQKPT"
     misc_feature    115426..116139
                     /locus_tag="PSPA7_0107"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     misc_feature    116167..116358
                     /locus_tag="PSPA7_0107"
                     /note="Domain of unknown function (DUF3330); Region:
                     DUF3330; pfam11809"
                     /db_xref="CDD:152245"
     gene            complement(116395..117324)
                     /locus_tag="PSPA7_0108"
                     /db_xref="GeneID:5358102"
     CDS             complement(116395..117324)
                     /locus_tag="PSPA7_0108"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00239"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345504.1"
                     /db_xref="GI:152989670"
                     /db_xref="GeneID:5358102"
                     /translation="MKIGYARVSTRDQKADLQVDALKQAGCERIYQDIASGAKSARPE
                     LDKLLANVRPGDAVVIWKLDRLGRSLKHLVELVGELAERKVGLQSLNDPIDTTHAQGR
                     LVFNLFASLAEFERELIRERTQAGLSAARARGRIGGRPKGLPAKAEATAMAAETLYRE
                     GRLSVSAIGEKLHISKSTLYSYLRHRGVEIGAYQKSARSRDQQPSAASPAEPPAAERV
                     ATVTLRLAVVNNSKFVRGRKRATENIERYCLEPYGMKRLDAGHYELTIPYRSDDELDK
                     SVHDLLTEISQEADMRNCFVEMGAWEEDTEKRW"
     misc_feature    complement(116755..117324)
                     /locus_tag="PSPA7_0108"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    complement(116947..117321)
                     /locus_tag="PSPA7_0108"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(117121..117123,117130..117135,
                     117298..117300,117304..117306))
                     /locus_tag="PSPA7_0108"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(117298..117300)
                     /locus_tag="PSPA7_0108"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(116980..116982,116992..116997,
                     117001..117006,117136..117138))
                     /locus_tag="PSPA7_0108"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(116974..116976,116983..116985,
                     116992..116997,117004..117009,117016..117018,
                     117100..117105,117118..117120))
                     /locus_tag="PSPA7_0108"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(116959..116961,116971..116973,
                     116980..116982,116992..116994,117001..117006,
                     117013..117018,117043..117051))
                     /locus_tag="PSPA7_0108"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(116959..116961,116971..116973,
                     116980..116982,116992..116994,117001..117003,
                     117049..117051))
                     /locus_tag="PSPA7_0108"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(116956..116961,116977..116979))
                     /locus_tag="PSPA7_0108"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     gene            117526..117765
                     /locus_tag="PSPA7_0109"
                     /db_xref="GeneID:5354670"
     CDS             117526..117765
                     /locus_tag="PSPA7_0109"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345505.1"
                     /db_xref="GI:152989215"
                     /db_xref="GeneID:5354670"
                     /translation="MNTIRWNVAVSADTDQSLRMFLASQGGGRKGDLSRFIEEAVRAH
                     ILELSAEQAKAANAHLSEAELTNAVDEALDWARKR"
     gene            117765..118175
                     /locus_tag="PSPA7_0110"
                     /db_xref="GeneID:5358865"
     CDS             117765..118175
                     /locus_tag="PSPA7_0110"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01850; match to protein family HMM TIGR00305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345506.1"
                     /db_xref="GI:152984370"
                     /db_xref="GeneID:5358865"
                     /translation="MRVVLDTNILFSALISPHGAPDAIYRAWRAARFEVVTSRMQLDE
                     IRRASRYPKLQAILQPAKVGAMINNLQRAVVLERLTIEVEADDPDDSFLLAMALAGDA
                     DYLVTGDRRAGLLQRGHIERTRIVTPAVFCVEVL"
     misc_feature    117765..118172
                     /locus_tag="PSPA7_0110"
                     /note="PIN domain; Region: PIN_3; cl17397"
                     /db_xref="CDD:266665"
     gene            118179..121172
                     /locus_tag="PSPA7_0111"
                     /db_xref="GeneID:5356670"
     CDS             118179..121172
                     /locus_tag="PSPA7_0111"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01526"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_001345507.1"
                     /db_xref="GI:152988195"
                     /db_xref="GeneID:5356670"
                     /translation="MPVGFLTQEQRDGFGRYVDSPSREELERYFHLSDEDREAIQVLR
                     GNHNRLGYAVLLTTVRFVGVLPDKPAAVPVEVLQVLCRQLAIPDPDCLQRYSDHRRWI
                     HATDIQNRFGYRHFTDPGIGFRLSRWLYALCWTGTDRPGVLFERATSWLFTQKVLLPG
                     VSQLERFIAQLRSRVEERLWFTLGRSVTEEQRLQLQDLLTVAEGNRSSRLDQLRSGPV
                     MVSGPALIRALRRLDDVRGIGITLPAAAHIPPSRIAALARFANTAKVTAINRLPASRR
                     MATLVAFALCLEATAHDDALEVLEALLRDLFSNAEKADKKARMRSLKDLDRSAATLAA
                     ACKVVLDSSISDDNVRARLFNDLPRTTLEKALEEVNALIRPVDDVYFLALEARYRSVR
                     RFLPDLLKHIRFGFSPAGKGVAASLEWLQLNLPRRKPEDDAPQEIVAKAWQKHITRED
                     GSLDMGAYVFCTLDALRTALRRRDVFVSPSWRYADPRLGLLDGAEWLAARPIICRSLG
                     LTIDAKTTLDALSVELDATWLAVAARLPDNPAIQLSENTEGKTELSLGALDKLDEPCS
                     LLQLRAAVSDLMPRVDLPEILLEIAARTGFSEAFTHVSERNARADNLVTSLCAVLLGG
                     ACNTGLEPLIRTDNPALRRDRLSWVSQNYIRDDTLSAANAILVGAQSQLELAQVWGGG
                     EVASADGMRFVVPVRTVHAGPNPKYFGTGRGVTWYNLISDQFSGLNAITVPGTLRDSL
                     VLLAVVLEQQTELQPTQIMTDTGAYSDVVFGLFRLLGYHFSPRLADVGGTRFWRTRPD
                     ADYGKLNGLARQSVKLDLIAEHWDDLLRLAGSLKLGRVPATGIMRTLQTGDRPTRLAQ
                     ALAEFGRIEKTLHTLTYIDDESKRRATLTQLNRGEGRHSLARAVFHGKRGELRQRYRE
                     GQEDQLGALGLVVNIIVLWNTLYMTAAVERLKQHGYPVLEEDLARLSPLIYEHINMLG
                     RYSFAVPEEVARGELRPLRNPDDDL"
     misc_feature    118191..118694
                     /locus_tag="PSPA7_0111"
                     /note="Domain of unknown function (DUF4158); Region:
                     DUF4158; pfam13700"
                     /db_xref="CDD:257998"
     misc_feature    119931..121100
                     /locus_tag="PSPA7_0111"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     pfam01526"
                     /db_xref="CDD:250685"
     gene            complement(121185..121397)
                     /locus_tag="PSPA7_0112"
                     /db_xref="GeneID:5357334"
     CDS             complement(121185..121397)
                     /locus_tag="PSPA7_0112"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345508.1"
                     /db_xref="GI:152988961"
                     /db_xref="GeneID:5357334"
                     /translation="MSAIVLESVLTCPRCGFAKPETMPTDACQFYYECSNCKALLRPN
                     PGDCCVFCSFGSVKCPPIQQQLGCCS"
     gene            complement(121405..121680)
                     /gene="merP1"
                     /locus_tag="PSPA7_0113"
                     /db_xref="GeneID:5356996"
     CDS             complement(121405..121680)
                     /gene="merP1"
                     /locus_tag="PSPA7_0113"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00403; match to protein family HMM TIGR02052"
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transport periplasmic protein"
                     /protein_id="YP_001345509.1"
                     /db_xref="GI:152989573"
                     /db_xref="GeneID:5356996"
                     /translation="MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSL
                     EKVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEATANAGYPSTVQK"
     misc_feature    complement(121417..121608)
                     /gene="merP1"
                     /locus_tag="PSPA7_0113"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(121573..121575,121582..121590))
                     /gene="merP1"
                     /locus_tag="PSPA7_0113"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            complement(121693..122043)
                     /locus_tag="PSPA7_0114"
                     /db_xref="GeneID:5355028"
     CDS             complement(121693..122043)
                     /locus_tag="PSPA7_0114"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02411"
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transport protein"
                     /protein_id="YP_001345510.1"
                     /db_xref="GI:152987883"
                     /db_xref="GeneID:5355028"
                     /translation="MGMQLTGKGSLVASSLTAIGASVCCVGPLVLLALGVGGTWVGAL
                     TMMEPLRPLFIGLTLLFLGLAFRKLYLVPQVCTPGTPCADPRTLVRQRLVFWIVSVLL
                     LGLLAVPWLAPLFY"
     misc_feature    complement(121696..122028)
                     /locus_tag="PSPA7_0114"
                     /note="MerT mercuric transport protein; Region: MerT;
                     cl03578"
                     /db_xref="CDD:186578"
     gene            122118..122516
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /db_xref="GeneID:5357060"
     CDS             122118..122516
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00376; match to protein family HMM PF09278; match to
                     protein family HMM TIGR02051"
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="YP_001345511.1"
                     /db_xref="GI:152985495"
                     /db_xref="GeneID:5357060"
                     /translation="MATELTIGKLADAAGVNVETIRYYQRRGLLDEPAKPLGGHRRYP
                     VDMVKRLRFIKRAQALGFTLSEVGGLLTLDESCACAETRARAARKLALIEQKMADLVV
                     MQQLLGELVQQCDAGDGGTICPIIEALIRE"
     misc_feature    122130..122507
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /note="Helix-Turn-Helix DNA binding domain of the MerR1
                     transcription regulator; Region: HTH_MerR1; cd04783"
                     /db_xref="CDD:133410"
     misc_feature    122133..122504
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /note="Hg(II)-responsive transcriptional regulator;
                     Region: MerR; TIGR02051"
                     /db_xref="CDD:131106"
     misc_feature    order(122133..122141,122181..122183,122232..122240)
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133410"
     misc_feature    order(122274..122276,122283..122285,122295..122300,
                     122325..122327,122352..122357,122364..122366,
                     122373..122375,122385..122387,122403..122405,
                     122415..122417,122424..122429,122448..122450,
                     122463..122468,122484..122486,122490..122492)
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133410"
     misc_feature    order(122352..122354,122457..122459,122484..122486)
                     /gene="merR1"
                     /locus_tag="PSPA7_0115"
                     /note="mercury binding site [ion binding]; other site"
                     /db_xref="CDD:133410"
     gene            122641..122835
                     /locus_tag="PSPA7_0116"
                     /db_xref="GeneID:5359505"
     CDS             122641..122835
                     /locus_tag="PSPA7_0116"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345512.1"
                     /db_xref="GI:152986205"
                     /db_xref="GeneID:5359505"
                     /translation="MLVLSNNGVVFLTAELEREAELLSDHFIRWLIYAGMFATGTERQ
                     RRWYGLCVLTRQGSANGSFV"
     gene            122819..123664
                     /locus_tag="PSPA7_0117"
                     /db_xref="GeneID:5355563"
     CDS             122819..123664
                     /locus_tag="PSPA7_0117"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00165"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_001345513.1"
                     /db_xref="GI:152983681"
                     /db_xref="GeneID:5355563"
                     /translation="MDRLSNLLSRFGVRANLFYDGDLCGSASYDGAERRGYIHLLQAG
                     SVTLLGPDRKDLQLTRPSLIFMPRPAKHQLFAGESDGAKLLCASMEFEGGIDNPLSAS
                     LPDCLVLALDDLPMLADTLEWMFAEAANVHCGREAALERLFELLIILLLRYLLDHHQL
                     RTGMMAGLADMRLARSLLQMHNSPEHAWSIAELASESNMSRAAYAVHFKSVIGQTPAD
                     YLLSWRVSLAQKLMREGRSITLIAAQVGYESPSALSRAFRRKTGLSPRDWLKDLAGEN
                     DGKKA"
     misc_feature    122822..123259
                     /locus_tag="PSPA7_0117"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    123356..123481
                     /locus_tag="PSPA7_0117"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    123380..123625
                     /locus_tag="PSPA7_0117"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    <123527..123628
                     /locus_tag="PSPA7_0117"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(123694..124143)
                     /locus_tag="PSPA7_0118"
                     /db_xref="GeneID:5358009"
     CDS             complement(123694..124143)
                     /locus_tag="PSPA7_0118"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF04224"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345514.1"
                     /db_xref="GI:152988515"
                     /db_xref="GeneID:5358009"
                     /translation="MGLGIYGAYLALAIIYFWFGGMKFTHYEAEGLVPLVSNSPLLGW
                     VYSIFSVDMFSSLLGILEISIGTLIAGRMLSPKLSVVGGALSAGLFFTTLSFMFSTPG
                     VIEPSLGFPAISVAPGQFLLKDLGLLAVSIFVAGHSLVELEKRKINA"
     misc_feature    complement(123727..124137)
                     /locus_tag="PSPA7_0118"
                     /note="Protein of unknown function, DUF417; Region:
                     DUF417; cl01162"
                     /db_xref="CDD:260815"
     gene            complement(124955..126226)
                     /locus_tag="PSPA7_0119"
                     /db_xref="GeneID:5355791"
     CDS             complement(124955..126226)
                     /locus_tag="PSPA7_0119"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01609"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase DDE domain-containing protein"
                     /protein_id="YP_001345515.1"
                     /db_xref="GI:152984687"
                     /db_xref="GeneID:5355791"
                     /translation="MKIVQKITSPLDCPAFIAAHRQNPQDFTRRRQLTFKNLVLFLLN
                     QPRTALQTELDQFYRVLNQASTETQMVTAQAFCKARKKLNPEVFESLNRLLQQQIDCF
                     GLRQKWRGLRVLAVDGSTVHLPLESTMATFFGSHSGFPMARLSTLYEVADGQTLHSLI
                     VPLTVGERDCAHLHLEHLPADSLTLFDRGYPGHWLFALFAQQQRHFLMRLPCGYNAQV
                     KAFLHSGQVEDTQLFVANHPEARLFCSEAGVDPASQIELRLIRVELANGESEVLLTSL
                     LDREAFPAEVFAELYHRRWGIETDFRRLKQTLTLDNFSGRSVTAVKQDFHAAQLLKNL
                     ALLMQHLLQPVIEQRHKGRKLRWKVNFTQGVSRLKNTLVELLVRHCAQGLSNVLALMA
                     KSLSAVRSGRSFARQRKRAASRGCEGYKPTR"
     misc_feature    complement(125225..125905)
                     /locus_tag="PSPA7_0119"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(128608..128880)
                     /locus_tag="PSPA7_0120"
                     /db_xref="GeneID:5353760"
     CDS             complement(128608..128880)
                     /locus_tag="PSPA7_0120"
                     /note="identified by match to protein family HMM PF00462;
                     match to protein family HMM TIGR02181"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="YP_001345516.1"
                     /db_xref="GI:152985848"
                     /db_xref="GeneID:5353760"
                     /translation="MTTDVLLYTTNWCPFCRRAKALLKEKGVRWKELDIEADPAHRQA
                     MAEASGRSSVPQIFINGTLIGGSDELFALDVRGELDKLLGRNPPAT"
     misc_feature    complement(128650..128871)
                     /locus_tag="PSPA7_0120"
                     /note="Glutaredoxin (GRX) family, GRX bacterial class 1
                     and 3 (b_1_3)-like subfamily; composed of bacterial GRXs,
                     approximately 10 kDa in size, and proteins containing a
                     GRX or GRX-like domain. GRX is a glutathione (GSH)
                     dependent reductase, catalyzing the...; Region:
                     GRX_GRXb_1_3_like; cd03418"
                     /db_xref="CDD:239510"
     misc_feature    complement(order(128719..128724,128836..128844,
                     128851..128853))
                     /locus_tag="PSPA7_0120"
                     /note="GSH binding site [chemical binding]; other site"
                     /db_xref="CDD:239510"
     misc_feature    complement(order(128833..128835,128842..128844))
                     /locus_tag="PSPA7_0120"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239510"
     gene            complement(129334..130080)
                     /locus_tag="PSPA7_0121"
                     /db_xref="GeneID:5358438"
     CDS             complement(129334..130080)
                     /locus_tag="PSPA7_0121"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00175; match to protein family HMM PF00970"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD-binding region"
                     /protein_id="YP_001345517.1"
                     /db_xref="GI:152986516"
                     /db_xref="GeneID:5358438"
                     /translation="MTENEAQVRSWQSCVIDDIIQQTPSIKSFFLRLSKPFAHTAGQH
                     VDIRLTAPDGYSAMRSYSIASSAVSTPIVEIAIERMPDAEVSPFFHDIAAIGDEIEVR
                     GPLGGHFLWPEPAIDPVLLIGGGSGLVPLMAMIRQRRALAQAVPTALLLSARTAEDVL
                     FSEELHCIEISDPAFVLALAITREKPVRASDFARRIDGMMVQEILTRLQGKPTQVFVC
                     GSNGFVNIATDSALLAGLDASIIKTERYGG"
     misc_feature    complement(129343..130050)
                     /locus_tag="PSPA7_0121"
                     /note="Iron-sulfur binding ferredoxin reductase (FNR)
                     proteins combine the FAD and NAD(P) binding regions of FNR
                     with an iron-sulfur binding cluster domain.
                     Ferredoxin-NADP+ (oxido)reductase is an FAD-containing
                     enzyme that catalyzes the reversible electron...; Region:
                     FNR_iron_sulfur_binding_3; cd06217"
                     /db_xref="CDD:99813"
     misc_feature    complement(order(129343..129345,129349..129351,
                     129694..129696,129703..129705,129823..129831,
                     129841..129843,129847..129855,129895..129906,
                     129949..129951))
                     /locus_tag="PSPA7_0121"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99813"
     misc_feature    complement(order(129895..129900,129904..129906))
                     /locus_tag="PSPA7_0121"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99813"
     misc_feature    complement(order(129760..129762,129769..129771,
                     129793..129795,129814..129816,129823..129825,
                     129832..129834))
                     /locus_tag="PSPA7_0121"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99813"
     misc_feature    complement(order(129691..129693,129697..129708,
                     129718..129720))
                     /locus_tag="PSPA7_0121"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99813"
     misc_feature    complement(order(129421..129426,129619..129627,
                     129700..129705))
                     /locus_tag="PSPA7_0121"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99813"
     gene            complement(130073..130720)
                     /locus_tag="PSPA7_0122"
                     /db_xref="GeneID:5357946"
     CDS             complement(130073..130720)
                     /locus_tag="PSPA7_0122"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin binding oxidoreductase"
                     /protein_id="YP_001345518.1"
                     /db_xref="GI:152983962"
                     /db_xref="GeneID:5357946"
                     /translation="MKAGFGLPYRARGVTMVTRGFTGRGSGDQSDRIPPGQHLVEDFP
                     VLSAGPTPRVEPSDWKFTVKIGPKPVKTWNWGEFNTLPKTQVTKDIHCVTSWSKLDTV
                     WEGVLIEDILADAELDRPTDFVLAHCYDNYSTNVPLTDLLSGKAMVALSYAGKPLSRD
                     HGGPARLLVPHLYFWKSAKWVNALQFTTRDEAGFWELHGYHIYGDPWREQRYTHD"
     misc_feature    complement(130082..130678)
                     /locus_tag="PSPA7_0122"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(130085..130624)
                     /locus_tag="PSPA7_0122"
                     /note="bacterial and archael members of the sulfite
                     oxidase (SO) family of molybdopterin binding domains. This
                     molybdopterin cofactor (Moco) binding domain is found in a
                     variety of oxidoreductases, main members of this family
                     are nitrate reductase (NR) and...; Region:
                     arch_bact_SO_family_Moco; cd02109"
                     /db_xref="CDD:239027"
     misc_feature    complement(order(130181..130186,130190..130192,
                     130199..130201,130223..130225,130238..130240,
                     130325..130327,130445..130447,130580..130582,
                     130586..130588,130592..130594))
                     /locus_tag="PSPA7_0122"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:239027"
     misc_feature    complement(130445..130447)
                     /locus_tag="PSPA7_0122"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:239027"
     gene            131359..131613
                     /locus_tag="PSPA7_0123"
                     /db_xref="GeneID:5355831"
     CDS             131359..131613
                     /locus_tag="PSPA7_0123"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345519.1"
                     /db_xref="GI:152984734"
                     /db_xref="GeneID:5355831"
                     /translation="MIQTVFEGTHENTFEKLRVNQLKYELPIVFGHDEQPTGSPFPTF
                     MEDYRTRGTPWFTVIDAGGSIVFSDFHLDAERLVKQLEQG"
     gene            complement(132291..132722)
                     /locus_tag="PSPA7_0124"
                     /db_xref="GeneID:5354610"
     CDS             complement(132291..132722)
                     /locus_tag="PSPA7_0124"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF03928"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345520.1"
                     /db_xref="GI:152988539"
                     /db_xref="GeneID:5354610"
                     /translation="MTKSIATASINRETAVALIDAALAAARAIGIPAAVAVVDATGNL
                     RAFERTDDAPFLTVDVAIDKAWSSASFGFPTHVWNDYVTNDPKVAPLAYRPRMVAVGG
                     GYPILEDGKLIGGIGISGGNYQQDQDACVEALMKIGFQLPA"
     misc_feature    complement(132387..132635)
                     /locus_tag="PSPA7_0124"
                     /note="Domain of unknown function (DUF336); Region:
                     DUF336; cl01249"
                     /db_xref="CDD:260854"
     gene            complement(132795..133808)
                     /locus_tag="PSPA7_0125"
                     /db_xref="GeneID:5355815"
     CDS             complement(132795..133808)
                     /locus_tag="PSPA7_0125"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00107; match to protein family HMM PF08240; match to
                     protein family HMM TIGR02817"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_001345521.1"
                     /db_xref="GI:152989184"
                     /db_xref="GeneID:5355815"
                     /translation="MKAIGYKVPGPIAADAALVDINLPRPVAAGYDILVEVKAVSVNP
                     VDYKVRNSTPPADGDWKVLGWDAAGIVREVGPDVTQFELGDEVYYAGSITRPGTNAEF
                     HLVDARIVGHKPASLSWAEAAALPLTTLTAWEAMFDRLDVAKPVPGAAEAILIIGGAG
                     GVGSIAVQIARQRTDLTVIATASRPETQEWVRGLGAHHVIDHSRPLAPQIAELGIGAP
                     AFVFSTTHTEQHVADIAELIAPQGRFGLIDDPKAFDIMVFKRKAVSIHHELMFTRSIY
                     GTPDMNEQGEILDAMAALVDDGKIRTTLTRRLSPINAANLKTVHALIESGAAKGKIVL
                     EGF"
     misc_feature    complement(132804..133808)
                     /locus_tag="PSPA7_0125"
                     /note="Arginate lyase and other MDR family members;
                     Region: AL_MDR; cd08252"
                     /db_xref="CDD:176214"
     misc_feature    complement(132798..133805)
                     /locus_tag="PSPA7_0125"
                     /note="zinc-binding alcohol dehydrogenase family protein;
                     Region: adh_fam_1; TIGR02817"
                     /db_xref="CDD:234024"
     misc_feature    complement(order(132999..133007,133065..133070,
                     133128..133130,133134..133139,133203..133205,
                     133248..133250,133260..133265,133320..133325,
                     133329..133340,133416..133418,133428..133430,
                     133665..133667,133674..133682))
                     /locus_tag="PSPA7_0125"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176214"
     misc_feature    complement(order(132975..132977,132981..132983,
                     132990..132995,133002..133037,133041..133055,
                     133062..133064,133086..133091,133116..133118,
                     133392..133397,133407..133409))
                     /locus_tag="PSPA7_0125"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176214"
     gene            complement(134256..135224)
                     /locus_tag="PSPA7_0126"
                     /db_xref="GeneID:5358834"
     CDS             complement(134256..135224)
                     /locus_tag="PSPA7_0126"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01544"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt transport protein CorA"
                     /protein_id="YP_001345522.1"
                     /db_xref="GI:152988100"
                     /db_xref="GeneID:5358834"
                     /translation="MSIIAAYYYNEGKRVREIALDEHVKLGESRSGFCWIALSEPTPE
                     ELLAIQRTYNLHPLAIDNAMHPLCPPKLEVYNDELYVVAQTAELVGDRISYGKMAIFT
                     GHNHLITVRHGNAGALGKLREQLEASPTQFGKGVDYVLHAILHRVVDQYLPIFEMIED
                     DVLAMERRSLHDFLGPEEVARIFELRSELTRFQRTLRAMAELVRKLVRGHFPCISAEM
                     TPYFHDVADHVHRVQSMVDGLLLVLSTVFEASSLLEAQRIGVVTRQLAAWAAILAVPT
                     AIAGIYGMNFKHMPELDTAYGYFVVLGVIAISCVFLFVRFKKAKWL"
     misc_feature    complement(134271..135134)
                     /locus_tag="PSPA7_0126"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    complement(134259..135131)
                     /locus_tag="PSPA7_0126"
                     /note="Mycobacterium tuberculosis CorA-like subfamily;
                     Region: MtCorA-like; cd12830"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134268..134270,134277..134279,
                     134310..134312,134319..134324,134331..134336,
                     134367..134390,134394..134411,134415..134423,
                     134427..134465,134469..134492,134499..134507,
                     134511..134516,134520..134525,134532..134537,
                     134541..134546,134553..134558,134562..134567,
                     134643..134645,134655..134657,134664..134669,
                     134676..134678,134685..134690,134727..134729,
                     134736..134741,134757..134759,134769..134771,
                     134778..134780,134802..134804,134811..134813,
                     134853..134855,134865..134867,135006..135008,
                     135012..135014,135039..135044,135051..135053))
                     /locus_tag="PSPA7_0126"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134553..134555,134790..134792,
                     135042..135044))
                     /locus_tag="PSPA7_0126"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134553..134555,135039..135041))
                     /locus_tag="PSPA7_0126"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134811..134813,134853..134855))
                     /locus_tag="PSPA7_0126"
                     /note="putative Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134265..134276,134436..134438,
                     134454..134456))
                     /locus_tag="PSPA7_0126"
                     /note="basic sphincter; other site"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134430..134432,134439..134441))
                     /locus_tag="PSPA7_0126"
                     /note="hydrophobic gate; other site"
                     /db_xref="CDD:213364"
     misc_feature    complement(order(134376..134381,134385..134387))
                     /locus_tag="PSPA7_0126"
                     /note="periplasmic entrance; other site"
                     /db_xref="CDD:213364"
     gene            complement(135221..135925)
                     /locus_tag="PSPA7_0127"
                     /db_xref="GeneID:5353675"
     CDS             complement(135221..135925)
                     /locus_tag="PSPA7_0127"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02798"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="YP_001345523.1"
                     /db_xref="GI:152987521"
                     /db_xref="GeneID:5353675"
                     /translation="MPDLSSFPITQRWPASHPDRLQLYAAPTPNGVKVSIMLEETGLA
                     YEPHLIDISNNESKDPAFVSLNPNGRIPAIIDPAGPDGRPIALWESGAILLYLADKTG
                     QFISTEPGQRYETLAWVFFQMSAIGPMFGQLGFFLRFGGKDYEDKRPQQRFIDESTRL
                     LGILDRRLEGRDWIVDDYSIADIATLGWVNALVEFYAAGDILGLSSFSNVRAWLGRGL
                     ARPAVQRGLHIPARPA"
     misc_feature    complement(135260..135865)
                     /locus_tag="PSPA7_0127"
                     /note="GSH-dependent disulfide bond oxidoreductase;
                     Provisional; Region: PRK13972"
                     /db_xref="CDD:172475"
     misc_feature    complement(135617..135865)
                     /locus_tag="PSPA7_0127"
                     /note="GST_N family, Ure2p-like subfamily; composed of the
                     Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is
                     a regulator for nitrogen catabolism in yeast. It represses
                     the expression of several gene products involved in the
                     use of poor nitrogen sources...; Region: GST_N_Ure2p_like;
                     cd03048"
                     /db_xref="CDD:239346"
     misc_feature    complement(order(135641..135643,135806..135811,
                     135818..135820,135827..135829,135836..135841))
                     /locus_tag="PSPA7_0127"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239346"
     misc_feature    complement(order(135656..135661,135710..135718,
                     135836..135838))
                     /locus_tag="PSPA7_0127"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239346"
     misc_feature    complement(order(135650..135652,135659..135664,
                     135668..135670,135716..135718,135722..135727))
                     /locus_tag="PSPA7_0127"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239346"
     misc_feature    complement(135251..135592)
                     /locus_tag="PSPA7_0127"
                     /note="C-terminal, alpha helical domain of Ure2p and
                     related Glutathione S-transferase-like proteins; Region:
                     GST_C_Ure2p_like; cd03178"
                     /db_xref="CDD:198288"
     misc_feature    complement(order(135437..135439,135449..135451,
                     135467..135472,135482..135484,135488..135490,
                     135506..135508,135518..135523,135530..135532,
                     135554..135559,135563..135568,135572..135577,
                     135584..135589))
                     /locus_tag="PSPA7_0127"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198288"
     misc_feature    complement(order(135251..135253,135260..135262,
                     135266..135268,135362..135367,135374..135376,
                     135557..135562,135578..135580))
                     /locus_tag="PSPA7_0127"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198288"
     gene            complement(136066..136605)
                     /gene="msrA2"
                     /locus_tag="PSPA7_0128"
                     /db_xref="GeneID:5353956"
     CDS             complement(136066..136605)
                     /gene="msrA2"
                     /locus_tag="PSPA7_0128"
                     /EC_number="1.8.4.11"
                     /note="this stereospecific enzymes reduces the S isomer of
                     methionine sulfoxide while MsrB reduces the R form;
                     provides protection against oxidative stress"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="YP_001345524.1"
                     /db_xref="GI:152986408"
                     /db_xref="GeneID:5353956"
                     /translation="MHQRAVLAGGCFWGMQDLIRKRPGIISTRVGYTGGDIPNATYRN
                     HGTHAEGIEIVFDPTVTSYRNILEFFFQIHDPTTLNRQGNDRGLSYRSGIYYVDEEQK
                     RVAEDTIADVDASGLWDGKVVTEVQPVGEFWEAEPDHQDYLEKRPGGYTCHFVRPGWV
                     LPKRQKVDDVQPAAGTAAE"
     misc_feature    complement(136108..136605)
                     /gene="msrA2"
                     /locus_tag="PSPA7_0128"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK14054"
                     /db_xref="CDD:237597"
     gene            complement(137571..138374)
                     /locus_tag="PSPA7_0129"
                     /db_xref="GeneID:5355503"
     CDS             complement(137571..138374)
                     /locus_tag="PSPA7_0129"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01695"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_001345525.1"
                     /db_xref="GI:152988519"
                     /db_xref="GeneID:5355503"
                     /translation="MRDLMAELKELRLHGMATAWAELTAQGESNTASSKWLLEHLLEQ
                     EHTDRAMRSVSHQMNMAKLPMHRDLASFDFNASSADARLISELASLAFTDTAQNVVLI
                     GGPGTGKTHLATALAVSGITRHGKRVRFYSTVDLVNLLEREKHDGKAGRIAQALLRMD
                     LVILDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSSVFGDAKMTTALL
                     DRLTHHCHIVETGNESYRLQHSSLAAQAKIKSRERKRKGGQEPEDDEPF"
     misc_feature    complement(137658..138362)
                     /locus_tag="PSPA7_0129"
                     /note="transposase/IS protein; Provisional; Region:
                     PRK09183"
                     /db_xref="CDD:181681"
     misc_feature    complement(137694..138134)
                     /locus_tag="PSPA7_0129"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(138045..138068)
                     /locus_tag="PSPA7_0129"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(137781..137783,137880..137882,
                     138042..138065))
                     /locus_tag="PSPA7_0129"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(137877..137894)
                     /locus_tag="PSPA7_0129"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(137715..137717)
                     /locus_tag="PSPA7_0129"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(138367..139875)
                     /locus_tag="PSPA7_0130"
                     /db_xref="GeneID:5355795"
     CDS             complement(138367..139875)
                     /locus_tag="PSPA7_0130"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00665"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_001345526.1"
                     /db_xref="GI:152984963"
                     /db_xref="GeneID:5355795"
                     /translation="MISMEMMGKIRRMYFRDKLSLHEIAKRTGLARNTIRKWVRAPEA
                     KPPVYQRRAIFNKLSPFHATLEQALKADSLRPKQQRRSAKALLAQIKAEGYDGGYSQL
                     TAFIRAWRGGQGKASQAFVPLTFALGEAFQFDWSEEGLLVGGIYRRMQVAHLKLCASR
                     AFWLVAYPSQGHEMLFDAHTRSFGSLGGVPRRGIYDNMKTAVDKVNKGKGRAVNARFA
                     VMCAHYLFDPDFCNVAAGWEKGIVEKNVQDSRRRIWLDAQDCQFHSFEELNAWLGQRC
                     RALWNELTHPQYSGLSVAEVLELERAELMPMPAAFDGYVERPARVSSTCLVSVGRNRY
                     SVPCEYAGKWVSSRLYPTRIEVVADDALIASHARLLDREQVSYDWQHYIPLIERKPGA
                     LRNGAPFTDLPAPLRQLKHGLGRHAGGDRIMAQVLAAVPVAGLDAVLVAVELVLESGS
                     LSAEHILNVVARLTASEPPPSVETHLSLKEAPVANTARYDRLRGQTKEIGHA"
     misc_feature    complement(139042..139845)
                     /locus_tag="PSPA7_0130"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(139117..139494)
                     /locus_tag="PSPA7_0130"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            139879..139998
                     /locus_tag="PSPA7_0132"
                     /db_xref="GeneID:5355726"
     CDS             139879..139998
                     /locus_tag="PSPA7_0132"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345527.1"
                     /db_xref="GI:152985234"
                     /db_xref="GeneID:5355726"
                     /translation="MFSCSKIEQKQLNTWVSFQSAEQPLLGQFSVSGNSLAAQ"
     gene            complement(139970..140125)
                     /locus_tag="PSPA7_0131"
                     /db_xref="GeneID:5355337"
     CDS             complement(139970..140125)
                     /locus_tag="PSPA7_0131"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345528.1"
                     /db_xref="GI:152989489"
                     /db_xref="GeneID:5355337"
                     /translation="MPMILRYLSVSLASALVAGYVALWLANPVPLEQPHAVVRPPLTI
                     EQQGCCR"
     gene            complement(140943..141149)
                     /locus_tag="PSPA7_0133"
                     /db_xref="GeneID:5356810"
     CDS             complement(140943..141149)
                     /locus_tag="PSPA7_0133"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase subunit; putative"
                     /protein_id="YP_001345529.1"
                     /db_xref="GI:152989223"
                     /db_xref="GeneID:5356810"
                     /translation="MAETINGLYKAELIYRQSWKSREAVEMATLKWVHWYNHQRLLSS
                     IGYIPPAEAEANFHQQQADQAMAA"
     misc_feature    complement(141000..>141146)
                     /locus_tag="PSPA7_0133"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(142440..144224)
                     /locus_tag="PSPA7_0134"
                     /db_xref="GeneID:5358873"
     CDS             complement(142440..144224)
                     /locus_tag="PSPA7_0134"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00899"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiF family protein"
                     /protein_id="YP_001345530.1"
                     /db_xref="GI:152986691"
                     /db_xref="GeneID:5358873"
                     /translation="MGVLVDQTDTSLQRGIAALRGALGEDAAHALLQPAVPRTGEAAS
                     YYFPLPVDYTGTERRLRISFPKNFPRGGLRLTVEPSPWLVWPHAMEVGLCLHGFQERP
                     VMGTPEYVVSDSLARLAKIVNLSRMGSCAATRDAEFRREITSYWSRQQGQSLQNLILL
                     DRPQAASKLYALSDPRQTLPSGQETVWLAPDLASLKRHYRRTIGRSPRMRAPEAPGFY
                     AKLRSYPDLRLPAPELLLTWLLPHLAPNDRTQLVAWFNERGSLPNRWIALELPGDASA
                     PIYCLNVRAYGPRLDRGSRFYLRSARRRPAVVVNHPPVLIRATTLDVLDRTEILSRDL
                     SGVAQKLEGARVVCVGVGSLGSTVALQLARSGVGHLTLIDPDHLVSANLGRHVLGADD
                     LGLPKAEALQERIRKDLPTTDVAAFATFAEVVMYKNPEVFDKADLVVVTTADWQSEVA
                     LWGAKSNGTSWGLLQAWSEPHTQVGHVLLAPSGAFDARGLFTDNGDFKHKFTEWPEGG
                     VVALPACGESFIPGGSLGMVNIASMVSQAALRALNGNIGSPSWVSSINRPDDVVTLGG
                     NYLGPELPAGMQQALLERDWPEISERSK"
     misc_feature    complement(143781..144092)
                     /locus_tag="PSPA7_0134"
                     /note="Prokaryotic E2 family B; Region: Prok-E2_B;
                     pfam14461"
                     /db_xref="CDD:258606"
     misc_feature    complement(<142872..143195)
                     /locus_tag="PSPA7_0134"
                     /note="ThiF family; Region: ThiF; pfam00899"
                     /db_xref="CDD:250212"
     misc_feature    complement(order(143034..143036,143070..143072,
                     143097..143099,143103..143105,143163..143165,
                     143169..143171,143175..143177))
                     /locus_tag="PSPA7_0134"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238760"
     gene            complement(144208..145461)
                     /locus_tag="PSPA7_0135"
                     /db_xref="GeneID:5355926"
     CDS             complement(144208..145461)
                     /locus_tag="PSPA7_0135"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345531.1"
                     /db_xref="GI:152987719"
                     /db_xref="GeneID:5355926"
                     /translation="MSMSNEQTKRGSWEHFLLRAAKEISLSEAQYEKINDRYSQLEKI
                     LNASDNPLLAEAHIFVQGSMRLKTTIKPVSGAPEDLDTIDADAIIWLPHAQDAGAREV
                     LDAIEERFKAGSRVQEEIKQLRRGIRIVYADENPGFHIDVTPARAINGNSQGNGEGKL
                     EVPDRETGWKASSPIPYSKWLQVASTQTISLAEHMAVAKSQRAFDAATQDPLPQYQDY
                     LDQDPLRATIKLLKRHRDEWAIRTKNTDHRPISAVITTLATHAYLDVAKESQSTPLRP
                     LDAILEIVRRMPDHVKYRGNECQVCNPADSGENFAEKWNRPLDGHRYRRAFQEWHENA
                     SVSVSLGLESFESAEAFAKAVNENFGIGPTFISAVNSEIPPNWTMPGRPDGTTRNATL
                     MGTMFGGASGTASSQEDVKPVGRLG"
     misc_feature    complement(144916..145374)
                     /locus_tag="PSPA7_0135"
                     /note="Nucleotidyltransferase (NT) domain of
                     2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I
                     CCA-adding enzyme; Region: NT_2-5OAS_ClassI-CCAase;
                     cd05400"
                     /db_xref="CDD:143390"
     misc_feature    complement(order(144934..144936,144943..144945,
                     144955..144957,145039..145041,145084..145086,
                     145093..145098,145204..145206,145210..145212,
                     145252..145260,145264..145266,145273..145281))
                     /locus_tag="PSPA7_0135"
                     /note="active site"
                     /db_xref="CDD:143390"
     misc_feature    complement(order(144934..144936,144943..144945,
                     144955..144957,145093..145095,145204..145206,
                     145210..145212,145273..145278))
                     /locus_tag="PSPA7_0135"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143390"
     misc_feature    complement(order(145039..145041,145204..145206,
                     145210..145212))
                     /locus_tag="PSPA7_0135"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143390"
     gene            complement(145461..146663)
                     /locus_tag="PSPA7_0136"
                     /db_xref="GeneID:5355209"
     CDS             complement(145461..146663)
                     /locus_tag="PSPA7_0136"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345532.1"
                     /db_xref="GI:152985712"
                     /db_xref="GeneID:5355209"
                     /translation="MVLMFLGGLVGKQEKANAATGRYDTDDVTKRVVWTQAAGHCELC
                     GTDLMYDYRAGKPMKWGEVAHILPASPKGPRGRSDHDEAKAASLTNDPANLMLLCPGC
                     HDKIDRDAEGYPESDLSGLHQAYLERVRLAATTPDGGRAIPVIVQSQHFATNNDIPVR
                     DLLVAMSSEGLTAFDHPIKITFPAPSHRGRDAHYWQSIKDNIQHELEQQLKRRGGAYG
                     DVPALAVVGVADIPALIMLGQSLGDRSKRLLFSFNREHQLRWPDQSAEPPEFVFTPPS
                     DGEGPLALVLSISAQVPTRDVEEALPGARIAELSIPVPSYAMVQNRRVIHAFRDALQT
                     HLSRLEAMTADTIHVFAAIPAALAIEFGALLTTQHQHAYLIFDRDKDNQNRFTPTLQL
                     GHQAQEVR"
     misc_feature    complement(146346..146576)
                     /locus_tag="PSPA7_0136"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(146355..146357,146364..146369,
                     146379..146384,146460..146462,146466..146474,
                     146478..146480))
                     /locus_tag="PSPA7_0136"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            complement(147202..148725)
                     /locus_tag="PSPA7_0137"
                     /db_xref="GeneID:5359487"
     CDS             complement(147202..148725)
                     /locus_tag="PSPA7_0137"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345533.1"
                     /db_xref="GI:152986583"
                     /db_xref="GeneID:5359487"
                     /translation="MTKKKKKSRSGKITTPLAGHKRVGKALVPPMLQLEGVSFSSWVN
                     DRLPEMLWASLVITVIPRDQALEAFRDIAALGLRYRKDEREQATGWTLRHTHLPAQPR
                     ELFEALVGRVLRCHAGAQALRPLLLLENLPGITWWKAALGSEPIEDDWQTLGQAVQKT
                     FDHQSQEATDVRWVSILFKIALGEMLFPAGFEEHLLEIVEYPNRGDMRSVRPSIRAME
                     MTFTHLGQSSWSESFWTDMLQQTGCTPAPLLPREKPSNDLQAVRLGLVEVRKALLEHW
                     FTTLSTSGIDPKQDGVFGFGFFALSCFAEMSSGPLNEGIAGRLLLRALTECRISLAFL
                     VRCGDDAMWKKFRSYGAGQAKLALLKHEEMTGERPRFVTLETLERLANEDYFQEYVEI
                     DLGHWCGKDLRKLAEESGTKEDYDRYYGWASGFVHGQWGAMRDSNFTHCLNPLHRFHR
                     VPLPFHRKLEPTLDDGLQLVNSILDDVSTAYPGFNARIKISSDSMERQEDAATVEPT"
     gene            complement(148828..150540)
                     /locus_tag="PSPA7_0138"
                     /db_xref="GeneID:5356415"
     CDS             complement(148828..150540)
                     /locus_tag="PSPA7_0138"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345534.1"
                     /db_xref="GI:152985697"
                     /db_xref="GeneID:5356415"
                     /translation="MRRFEAKDLIALATAPMNPDDHWYVDAEQASQYLVANANADEIV
                     IYASAPAVLIVGALVPTVNVTPVDGGALQNTSLCTDAAWKIQKSWNAAEGYRVYLEPP
                     FPNDRVSALSGGETLVTRRYLSGVHKGPAPIEVSQKLVHCLDIHYIPERNAYCRLDGN
                     GDIEDVIRVLTLPIDEQLEGREVVTILRKDLDTYMAVADLALVIKFDFTRTVRGSFSG
                     WNDVSRYHRDGEDLFYHGGSAARASFMHGAMVVRSRTTLAEQEEAWRRDFEGAPDREY
                     AVFKIYDRKNDRNVETSASPLHIVSYFEQSDLPWQISPAFFRPEVLQRFKADPEKYTL
                     EDRSISCRGAWHIKSYDINEAGQVHVYIGDLAKLPIAEQNYWKAFNEWPKSSISARAH
                     RTDIEGQWCTTYDPLNSLRNKVRALDKACPEWWNRRGDALMDSVLAPATDSPKEWGDE
                     ILALDQLLVEGFLDKPLRKIAQEKGREIEPVWRSLKLLHEILLGSTLSEEAAKQLLAP
                     MKKLHELRNEIRGHATHEKKEVAIREARTTHGNFRAHFFHLAEGCDQALIGVLKALEF
                     EMED"
     gene            150805..151089
                     /locus_tag="PSPA7_0139"
                     /db_xref="GeneID:5354560"
     CDS             150805..151089
                     /locus_tag="PSPA7_0139"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="ISPsy6 transposase"
                     /protein_id="YP_001345535.1"
                     /db_xref="GI:152988164"
                     /db_xref="GeneID:5354560"
                     /translation="MKRFIQGEHRGQSALLPESLDDYVADTNPVRVVDVFVDELNLGQ
                     LGFEGVVPAETGRPAYHPADLLKIYIYGYLNRIQSSRRLEREAHTSVSRG"
     misc_feature    150811..>151077
                     /locus_tag="PSPA7_0139"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     gene            151320..151940
                     /locus_tag="PSPA7_0140"
                     /db_xref="GeneID:5353739"
     CDS             151320..151940
                     /locus_tag="PSPA7_0140"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_001345536.1"
                     /db_xref="GI:152988645"
                     /db_xref="GeneID:5353739"
                     /translation="MLEVLLRFRHPLTIVTKGSLILRDLDLLRQLAEQNLVAVMISLT
                     TLDDELKRILEPRAAAPSARLRAIRTLSGNGIPVGVLCSPMIPMVNDMELERLLQAAR
                     DAGARSAAYMLLRLPREVGPLFEEWLAAHYPQRAEHVMSLVRQCRGGEVYDSRFGHRF
                     RGQGPFADLLAQRFAVALKRLGLDRRTGFGLDCSRFAVPGAQMALF"
     misc_feature    <151320..151865
                     /locus_tag="PSPA7_0140"
                     /note="DNA repair photolyase [DNA replication,
                     recombination, and repair]; Region: SplB; COG1533"
                     /db_xref="CDD:224450"
     gene            complement(152053..152967)
                     /locus_tag="PSPA7_0141"
                     /db_xref="GeneID:5355122"
     CDS             complement(152053..152967)
                     /locus_tag="PSPA7_0141"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345537.1"
                     /db_xref="GI:152985973"
                     /db_xref="GeneID:5355122"
                     /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRA
                     EYYPSCYEPVGHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGG
                     ALAGGAAGYYMEKQKQISDDRARIGSYGTDVDRSTVEINRSVAYAKSAQSCYQSQFKA
                     LLDGRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENISNYTQAYEKDLQQV
                     GVPRAEVTKVAEAENRASTTKGGNKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKV
                     ASQGQGMIREVCNSPDMGDWAPPSCAKA"
     gene            complement(153029..154741)
                     /locus_tag="PSPA7_0142"
                     /db_xref="GeneID:5359377"
     CDS             complement(153029..154741)
                     /locus_tag="PSPA7_0142"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345538.1"
                     /db_xref="GI:152988438"
                     /db_xref="GeneID:5359377"
                     /translation="MFEKAILPLALGACLGFAAPAWAEGDPPDNPRPLADDVALPLPC
                     GGEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLA
                     PAWQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDV
                     PSGMAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGGTGFVRLPT
                     EVEWEFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLADWAVYNQVAGGTGQAARLLP
                     VGMKRPNPLGLYDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTG
                     MRREYPLFAADGSEQRNATTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDD
                     AQDPTKQLDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAE
                     TINNYNIRLTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTR
                     YTDAVIQAQFQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLA
                     SSGR"
     misc_feature    complement(153083..154405)
                     /locus_tag="PSPA7_0142"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1262"
                     /db_xref="CDD:224182"
     misc_feature    complement(153662..154363)
                     /locus_tag="PSPA7_0142"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     gene            complement(154734..155933)
                     /locus_tag="PSPA7_0143"
                     /db_xref="GeneID:5358358"
     CDS             complement(154734..155933)
                     /locus_tag="PSPA7_0143"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345539.1"
                     /db_xref="GI:152986744"
                     /db_xref="GeneID:5358358"
                     /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYG
                     LVGTLTERLERAPSVREIIPVGGARYRAEDIAALAARADVAFAVPRTRQIAASADLSG
                     GGETVLSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRM
                     DGQAQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVPAYGWPGKAGGA
                     PRERIYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVA
                     ALAIGGAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSALFGLLLA
                     GLLYAAAAGALNHLFDNQSGEFVCRLLPSHFLAALLATLLCSVLAAASGGWRAARIEA
                     AEGLRDV"
     gene            complement(155933..156652)
                     /locus_tag="PSPA7_0144"
                     /db_xref="GeneID:5359231"
     CDS             complement(155933..156652)
                     /locus_tag="PSPA7_0144"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001345540.1"
                     /db_xref="GI:152986872"
                     /db_xref="GeneID:5359231"
                     /translation="MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGK
                     STLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLATLRRQHCGYVLQSGG
                     LLEFLDVRRNIGLPCALLGAPSAERVQTLAERLEIGDQLDKKPAALSVGQRQRVAIAR
                     ALVHAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEV
                     LAIRWQREADDSVGACLEDAG"
     misc_feature    complement(156011..156649)
                     /locus_tag="PSPA7_0144"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    complement(156011..156646)
                     /locus_tag="PSPA7_0144"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(156518..156541)
                     /locus_tag="PSPA7_0144"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(156035..156037,156134..156139,
                     156356..156358,156515..156523,156527..156532))
                     /locus_tag="PSPA7_0144"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(156356..156367)
                     /locus_tag="PSPA7_0144"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(156182..156211)
                     /locus_tag="PSPA7_0144"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(156134..156151)
                     /locus_tag="PSPA7_0144"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(156116..156127)
                     /locus_tag="PSPA7_0144"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(156029..156049)
                     /locus_tag="PSPA7_0144"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(156649..159747)
                     /locus_tag="PSPA7_0145"
                     /db_xref="GeneID:5359783"
     CDS             complement(156649..159747)
                     /locus_tag="PSPA7_0145"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00069; match to protein family HMM PF07714"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase PpkA"
                     /protein_id="YP_001345541.1"
                     /db_xref="GI:152984686"
                     /db_xref="GeneID:5359783"
                     /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALA
                     ADPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLD
                     PELGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQF
                     TQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAH
                     LTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLA
                     TPQGSPRATDPPPAGPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPP
                     SPPPPPLPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPNAADPAPLGQT
                     PTDKPPQQTPMADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPA
                     FSVLYVYARKQVGGSPWLRVGASSNGAGDGWLPASAVSDWKQSLVLKFTERSGRAPVM
                     FLNSAEQVERLLGDTRAARDTLTQAVDHEGDPQVVAVEPNDRAIPQDQFYLLPIFDSK
                     ESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSV
                     SMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQP
                     GNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGAL
                     RKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPK
                     IADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIG
                     YAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLI
                     VDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSL
                     NMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLST
                     LP"
     misc_feature    complement(158983..159726)
                     /locus_tag="PSPA7_0145"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(158983..159714)
                     /locus_tag="PSPA7_0145"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     misc_feature    complement(order(159235..159246,159298..159300,
                     159307..159309,159340..159342,159346..159351,
                     159355..159357,159361..159363,159466..159468,
                     159472..159474,159484..159495,159541..159543,
                     159637..159639,159643..159645,159682..159684,
                     159694..159708))
                     /locus_tag="PSPA7_0145"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(159307..159309,159340..159342,
                     159346..159351,159355..159357,159361..159363,
                     159472..159474,159484..159495,159541..159543,
                     159637..159639,159643..159645,159682..159684,
                     159694..159708))
                     /locus_tag="PSPA7_0145"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(159235..159246,159298..159300,
                     159349..159351,159355..159357,159361..159363,
                     159466..159468,159472..159474,159694..159696))
                     /locus_tag="PSPA7_0145"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(159235..159246,159292..159312))
                     /locus_tag="PSPA7_0145"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(157357..157902)
                     /locus_tag="PSPA7_0145"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(157540..157542,157633..157635,
                     157885..157887))
                     /locus_tag="PSPA7_0145"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(159755..160483)
                     /locus_tag="PSPA7_0146"
                     /db_xref="GeneID:5353759"
     CDS             complement(159755..160483)
                     /locus_tag="PSPA7_0146"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00481"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoprotein phosphatase"
                     /protein_id="YP_001345542.1"
                     /db_xref="GI:152986292"
                     /db_xref="GeneID:5353759"
                     /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMG
                     GHAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGST
                     LVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNDLISEDEARHHPR
                     ANVVTRAVGVHERLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLGHSDPYAVV
                     RSLVHLGLTRGAPDNITALVVRAF"
     misc_feature    complement(159764..160456)
                     /locus_tag="PSPA7_0146"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; The protein architecture and deduced catalytic
                     mechanism of PP2C phosphatases are similar to the PP1,
                     PP2A, PP2B family of protein Ser/Thr phosphatases, with
                     which PP2C shares no sequence...; Region: PP2Cc; cd00143"
                     /db_xref="CDD:238083"
     misc_feature    complement(order(159788..159790,159902..159904,
                     160355..160363,160406..160411,160421..160423))
                     /locus_tag="PSPA7_0146"
                     /note="active site"
                     /db_xref="CDD:238083"
     gene            complement(160493..161173)
                     /locus_tag="PSPA7_0147"
                     /db_xref="GeneID:5359537"
     CDS             complement(160493..161173)
                     /locus_tag="PSPA7_0147"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345543.1"
                     /db_xref="GI:152987384"
                     /db_xref="GeneID:5359537"
                     /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDEL
                     GAAWLDAYLTSPLWRFAIAPGLLGDDAVAGVVMPSIDRVGRYFPLTVACLLPANADLG
                     ALVGGDDGWFEQVEGLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRS
                     EAATPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVI
                     PLFPGIPG"
     misc_feature    complement(160496..161173)
                     /locus_tag="PSPA7_0147"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: SciT; COG3913"
                     /db_xref="CDD:226427"
     gene            complement(161170..164700)
                     /locus_tag="PSPA7_0148"
                     /db_xref="GeneID:5354223"
     CDS             complement(161170..164700)
                     /locus_tag="PSPA7_0148"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345544.1"
                     /db_xref="GI:152984454"
                     /db_xref="GeneID:5354223"
                     /translation="MKGFLNFFTRWVVPVLGLLALSLVIWFLGPLLRLGNYEPLASAT
                     SRWVLIALLFLVWIGFRVLRIVQARRNAAKVMQSLAEVSAPDAASVATAEELATLKQR
                     MDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGA
                     IRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPID
                     GAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFME
                     FFDSLNREERAQVWGMTFALDDGKSAEGPLAGFASEFALLEQRLTARLVERLQQERDP
                     ARRDLVYGFPQQFAALRECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLI
                     GSMAQSMNLDRQHLARQTGTGRSYFIERLFREVAFGERGLVGTNPKVERRRKWLTIGA
                     LSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLN
                     AVQNLANDAPGWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGSS
                     DFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLER
                     RPPSARLDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVF
                     ARKSGKPLTDPLSGFFTYRGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLAL
                     DVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADVLRILSGPTSPFRKLLEAVARETD
                     LQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGVREQPQQADSDPISAHFAELN
                     SLVSKGEGGNEPAPIDSLLEDMNTLYVQVSAMAGASGDSLLGDAKNQVAAAASRVALS
                     AERQPPVVQGLVKKVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSS
                     RDATLEDFGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQ
                     RAAAIRDAFFRSGGMQPTVRFELKPVTMDAAISQFILDLDGQQLTYDHGPSRPVAMQW
                     PSANGLGVVRLTVTPAPSSGRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTLRLRIDG
                     SSIACELRASSAFNPFKSRVVSGFSLPERL"
     misc_feature    complement(161179..164664)
                     /locus_tag="PSPA7_0148"
                     /note="type VI secretion protein IcmF; Region: VI_IcmF;
                     TIGR03348"
                     /db_xref="CDD:234175"
     misc_feature    complement(163333..164127)
                     /locus_tag="PSPA7_0148"
                     /note="ImcF-related N-terminal domain; Region:
                     ImcF-related_N; pfam14331"
                     /db_xref="CDD:258504"
     misc_feature    complement(162304..163194)
                     /locus_tag="PSPA7_0148"
                     /note="Intracellular multiplication and human
                     macrophage-killing; Region: IcmF-related; pfam06761"
                     /db_xref="CDD:253899"
     misc_feature    complement(161596..161970)
                     /locus_tag="PSPA7_0148"
                     /note="Protein of unknown function (DUF1215); Region:
                     DUF1215; pfam06744"
                     /db_xref="CDD:253889"
     gene            complement(164697..166046)
                     /locus_tag="PSPA7_0149"
                     /db_xref="GeneID:5355309"
     CDS             complement(164697..166046)
                     /locus_tag="PSPA7_0149"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345545.1"
                     /db_xref="GI:152985769"
                     /db_xref="GeneID:5355309"
                     /translation="MSPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPASGPRAG
                     DPYTPPPMASLAPLASRGDGLNPLEQAAGPLLAMLTRLRSTIAHPAPASLRAQLLGYL
                     RQFEEKARQAGVAADEVMLARYVLCTALDEAVLSTPWGSASDWGKQSLLITLHNEAWG
                     GEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLETLRERTAAVI
                     RSTRGEYERELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAE
                     PVFRRIHAIGEIPVQAIDRPAIQPRVIERPRLARFLAEDIKAQRVAVEDAVDRSVVTI
                     RGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLS
                     QARAQEVADLLGATTGEAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
     misc_feature    complement(164700..166040)
                     /locus_tag="PSPA7_0149"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07033"
                     /db_xref="CDD:180801"
     misc_feature    complement(165180..165965)
                     /locus_tag="PSPA7_0149"
                     /note="Type VI protein secretion system component VasF
                     [Intracellular    trafficking, secretion, and vesicular
                     transport]; Region: COG3455"
                     /db_xref="CDD:225986"
     misc_feature    complement(164718..165032)
                     /locus_tag="PSPA7_0149"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    complement(order(164736..164738,164748..164750,
                     164874..164876,164883..164888,164910..164912,
                     164919..164924,165018..165023))
                     /locus_tag="PSPA7_0149"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(166053..167387)
                     /locus_tag="PSPA7_0150"
                     /db_xref="GeneID:5358205"
     CDS             complement(166053..167387)
                     /locus_tag="PSPA7_0150"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345546.1"
                     /db_xref="GI:152988561"
                     /db_xref="GeneID:5358205"
                     /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWG
                     FSELKLDDALLTQGKLAVLSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGL
                     PLKRVGTRDTAEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGL
                     GEYAALGIARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALA
                     GRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTF
                     TASQRRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAML
                     SDRNLIDNASFILVVRADVPGETLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPV
                     APRQIPYHAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
     misc_feature    complement(166056..167387)
                     /locus_tag="PSPA7_0150"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3522"
                     /db_xref="CDD:226053"
     gene            complement(167404..167868)
                     /locus_tag="PSPA7_0151"
                     /db_xref="GeneID:5356902"
     CDS             complement(167404..167868)
                     /locus_tag="PSPA7_0151"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     TIGR03352"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345547.1"
                     /db_xref="GI:152985140"
                     /db_xref="GeneID:5356902"
                     /translation="MQKLMIALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAG
                     QAAPLRLRLYELKKDTAFGRADYFALTDNAPSTLGGDLVEQDEFLLRPGEERRIERTL
                     DEQTRQLGFVAAYRDLDRATWRQVLDIPGQRTSHLDVTLGAQAIGIVARPAP"
     misc_feature    complement(167407..167862)
                     /locus_tag="PSPA7_0151"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3521"
                     /db_xref="CDD:226052"
     gene            complement(167913..169439)
                     /locus_tag="PSPA7_0152"
                     /db_xref="GeneID:5355358"
     CDS             complement(167913..169439)
                     /locus_tag="PSPA7_0152"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345548.1"
                     /db_xref="GI:152985795"
                     /db_xref="GeneID:5355358"
                     /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPE
                     RLVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDIL
                     VQLGHDIALPGSGNPQTDPFTSFDALMSRQNAATAPAFPEPAATPHPAVAAHFQGGSP
                     LDTRPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPAITPAPAPAGGAPLI
                     PADWDPFAELLGNTPAAGPAPATEPLATPLPTPEPAPLAMPFADPGITQQPPQPQPQP
                     QPQPQPQPQPQPQPQPQPQPASVAPPTPPASAAPTAGADLLQAFLRGAGMTQLKVDPA
                     GAEAQMEAIGRSYRGLVEGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEA
                     MLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAAIRHLLARFEPAALEARFG
                     KPAGLSGLLPGARQAQNWESFTELYAKILREAEDDFQELFGREFSRAYEEHSARLRRS
                     "
     misc_feature    complement(167916..169439)
                     /locus_tag="PSPA7_0152"
                     /note="Predicted component of the type VI protein
                     secretion system, contains a FHA domain [Intracellular
                     trafficking, secretion, and vesicular    transport; Signal
                     transduction mechanisms]; Region: COG3456"
                     /db_xref="CDD:225987"
     misc_feature    complement(169119..169376)
                     /locus_tag="PSPA7_0152"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    complement(order(169230..169238,169293..169298,
                     169302..169304,169344..169346))
                     /locus_tag="PSPA7_0152"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     gene            169449..169592
                     /locus_tag="PSPA7_0153"
                     /db_xref="GeneID:5358424"
     CDS             169449..169592
                     /locus_tag="PSPA7_0153"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345549.1"
                     /db_xref="GI:152989219"
                     /db_xref="GeneID:5358424"
                     /translation="MHCQRPALPGAHPRARGVSVRIQAGPMAFRRFVASGRHIGLYRI
                     IKD"
     gene            169807..170838
                     /locus_tag="PSPA7_0154"
                     /db_xref="GeneID:5358869"
     CDS             169807..170838
                     /locus_tag="PSPA7_0154"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345550.1"
                     /db_xref="GI:152984264"
                     /db_xref="GeneID:5358869"
                     /translation="MLDVPVLLAAVAPDSPCGEDLEYDAAFLELERIAQGQPERQMGD
                     AVLPAEPPEWPRVRALACELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLD
                     QYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALN
                     AAGLQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIEGGVAERVGSAQ
                     GLDLAPLRQLLRQALQVFDLYGPQGAGASVVPGAEAAPAEEPGAAPVAAAVPAARASG
                     EIGNREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGITQF
                     ETLRGPENE"
     misc_feature    169807..170835
                     /locus_tag="PSPA7_0154"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3515"
                     /db_xref="CDD:226046"
     misc_feature    169810..170823
                     /locus_tag="PSPA7_0154"
                     /note="type VI secretion-associated protein, ImpA family;
                     Region: VI_chp_8; TIGR03363"
                     /db_xref="CDD:234185"
     gene            170927..171445
                     /locus_tag="PSPA7_0155"
                     /db_xref="GeneID:5359699"
     CDS             170927..171445
                     /locus_tag="PSPA7_0155"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF05591; match to protein family HMM TIGR03358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345551.1"
                     /db_xref="GI:152983480"
                     /db_xref="GeneID:5359699"
                     /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMA
                     DLAGKPAEPQAAVADRKFLEIDADNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFE
                     SMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEDMIMKAIKDPALLQALA
                     SAPKPKDDEPQA"
     misc_feature    170939..171439
                     /locus_tag="PSPA7_0155"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3516"
                     /db_xref="CDD:226047"
     gene            171458..172954
                     /locus_tag="PSPA7_0156"
                     /db_xref="GeneID:5356051"
     CDS             171458..172954
                     /locus_tag="PSPA7_0156"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF05943; match to protein family HMM TIGR03355"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345552.1"
                     /db_xref="GI:152984184"
                     /db_xref="GeneID:5356051"
                     /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETA
                     VRTLAEHALEQTSLISNDAIKSIESIIAAIDAKLTAQVNLIMHHADFQQLESAWRGLH
                     YLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPY
                     GCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTK
                     IFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSK
                     YAWANSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTE
                     IAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDASANANLAARLP
                     YLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPL
                     AAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
     misc_feature    171458..172948
                     /locus_tag="PSPA7_0156"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3517"
                     /db_xref="CDD:226048"
     gene            173030..173518
                     /locus_tag="PSPA7_0157"
                     /db_xref="GeneID:5355875"
     CDS             173030..173518
                     /locus_tag="PSPA7_0157"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF05638"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345553.1"
                     /db_xref="GI:152985902"
                     /db_xref="GeneID:5355875"
                     /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGG
                     GGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITL
                     KEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPIKYGWNIRQNV
                     QA"
     misc_feature    173045..173437
                     /locus_tag="PSPA7_0157"
                     /note="Protein of unknown function (DUF796); Region:
                     DUF796; pfam05638"
                     /db_xref="CDD:253294"
     gene            173677..174462
                     /locus_tag="PSPA7_0158"
                     /db_xref="GeneID:5359337"
     CDS             173677..174462
                     /locus_tag="PSPA7_0158"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF07024"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence protein, SciE type"
                     /protein_id="YP_001345554.1"
                     /db_xref="GI:152988565"
                     /db_xref="GeneID:5359337"
                     /translation="MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMG
                     QWTRALNQLKVVGELDASALPMVQTYSTAIECEALRREVFAGRLTPVILGQPAEWIAP
                     LLQALSLDAEGHGEAAQGLREQAFDAAPAVPGRIGETPFAWLADADTRLGPVLEVIVN
                     GRYAWLPMSNLRSLQVEAPSDLRDLVWLPAELTLANGGATVALLPARYAETVEHGDDA
                     ARLGRKTEWLESGLPLGQRLFVTDAGETALFDLRRLDFEATDA"
     misc_feature    173677..174456
                     /locus_tag="PSPA7_0158"
                     /note="Protein of avirulence locus involved in
                     temperature-dependent protein secretion [General function
                     prediction only]; Region: ImpE; COG4455"
                     /db_xref="CDD:226862"
     misc_feature    174091..174438
                     /locus_tag="PSPA7_0158"
                     /note="ImpE protein; Region: ImpE; pfam07024"
                     /db_xref="CDD:148568"
     gene            174464..174973
                     /locus_tag="PSPA7_0159"
                     /db_xref="GeneID:5356906"
     CDS             174464..174973
                     /locus_tag="PSPA7_0159"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345555.1"
                     /db_xref="GI:152984195"
                     /db_xref="GeneID:5356906"
                     /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASV
                     LRDLAWLFNTTSLFDHDLAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIA
                     TFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVR
                     VAQGERRRA"
     misc_feature    174473..174958
                     /locus_tag="PSPA7_0159"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3518"
                     /db_xref="CDD:226049"
     gene            174970..176829
                     /locus_tag="PSPA7_0160"
                     /db_xref="GeneID:5356637"
     CDS             174970..176829
                     /locus_tag="PSPA7_0160"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345556.1"
                     /db_xref="GI:152988188"
                     /db_xref="GeneID:5356637"
                     /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADP
                     YVERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEG
                     ALSSGFSVERGASLRGQLGPEDQTACEYRTAHPVTLWPLEVVQADYFGNPAAVLGRLA
                     ASEPRAKAGLRIRLRSGAGIPFHSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVR
                     APDNAWVERLPASSLRPRGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGL
                     NRALRRCAGEELELIVLFGKHDARLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRV
                     NEHHVIVDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRRE
                     PRVLSSKQRRKGPRSTYVGSETFVALVDASQAPYRHDLRQLGIAALCTNRDLPLFMPI
                     GAHRSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGA
                     AALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDEN
                     AFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
     misc_feature    174970..176826
                     /locus_tag="PSPA7_0160"
                     /note="Type VI protein secretion system component VasA
                     [Intracellular trafficking, secretion, and    vesicular
                     transport]; Region: COG3519"
                     /db_xref="CDD:226050"
     gene            176793..177839
                     /locus_tag="PSPA7_0161"
                     /db_xref="GeneID:5357327"
     CDS             176793..177839
                     /locus_tag="PSPA7_0161"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345557.1"
                     /db_xref="GI:152986386"
                     /db_xref="GeneID:5357327"
                     /translation="MAGEAGQPSEPLSLLAGMAAAPWDYDFFQALRRIECESPQLPRL
                     GHSVRLADDPLRLGQKPDCTFAPSTLASVSQAGADAVPRLDQFFFGLTGPNGPLPLHL
                     TEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAA
                     LSGRGMPSLRAREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQW
                     LELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVEL
                     AAWVAEYLGEELDWDVNLVLQRQEIPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQY
                     ATARPHEHKEKEHE"
     misc_feature    176811..177800
                     /locus_tag="PSPA7_0161"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3520"
                     /db_xref="CDD:226051"
     gene            177832..180540
                     /locus_tag="PSPA7_0162"
                     /db_xref="GeneID:5355481"
     CDS             177832..180540
                     /locus_tag="PSPA7_0162"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00004; match to protein family HMM PF02861; match to
                     protein family HMM PF07724; match to protein family HMM
                     PF07728; match to protein family HMM TIGR03345"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion ATPase"
                     /protein_id="YP_001345558.1"
                     /db_xref="GI:152989614"
                     /db_xref="GeneID:5355481"
                     /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQ
                     ILQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVY
                     GSLMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPEN
                     GLSASDGFNAGAAPGEASGAMAPSAMGRQEALKRFTVDLTEQARSGKLDPIVGRDEEI
                     RQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLL
                     QAGASMKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPAL
                     ARGTLRTVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEQHH
                     QVQILDEALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRI
                     EALETELAIIRRESAIGVATGERQRNAETLLAEERERLAGLERRWAEEKRLVDELLET
                     RARLRAAAEAVDAGGTPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEPLILPTV
                     DYQAVASVVADWTGIPVGRMARNEIETVLNLDSHLKKRIIGQDHALEMIAKRIQTSRA
                     GLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLK
                     GAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGR
                     LIDFKNTLILLTTNAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVT
                     IPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMI
                     DAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFATAD"
     misc_feature    177868..180495
                     /locus_tag="PSPA7_0162"
                     /note="type VI secretion ATPase, ClpV1 family; Region:
                     VI_ClpV1; TIGR03345"
                     /db_xref="CDD:234172"
     misc_feature    178465..178932
                     /locus_tag="PSPA7_0162"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    178540..178563
                     /locus_tag="PSPA7_0162"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(178543..178566,178756..178758,178867..178869)
                     /locus_tag="PSPA7_0162"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    178744..178761
                     /locus_tag="PSPA7_0162"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    178918..178920
                     /locus_tag="PSPA7_0162"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    179647..180093
                     /locus_tag="PSPA7_0162"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    179749..179772
                     /locus_tag="PSPA7_0162"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(179752..179775,179965..179967,180091..180093)
                     /locus_tag="PSPA7_0162"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    179953..179970
                     /locus_tag="PSPA7_0162"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    180241..180513
                     /locus_tag="PSPA7_0162"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            180575..182515
                     /locus_tag="PSPA7_0163"
                     /db_xref="GeneID:5355069"
     CDS             180575..182515
                     /locus_tag="PSPA7_0163"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF04524; match to protein family HMM TIGR01646; match to
                     protein family HMM TIGR03361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345559.1"
                     /db_xref="GI:152987570"
                     /db_xref="GeneID:5355069"
                     /translation="MGLMQLTRLVQVDCPLGADVLLLQRMEGREELGRLFAYELHLVS
                     ENPNLPLEQLLGKPMSLSLELPGGGRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWL
                     LTRTSDCRIFQNQSVPEIIRQVFRDLGFSDFEDALTRPYREWEYCVQYRESSFDFVSR
                     LMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQM
                     AREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYAR
                     NRIEALQAQHERVRLRGVVRGLGAGHLFRLSGYPREDQNREYLVVGAEYRVVQELYET
                     GSGGAGSQFESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVK
                     VHFHWDRHDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITG
                     RVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQD
                     NLVENDASLIVGHDRNKSVGNDELARIGHNRTRAVKLNDTLLVGGAKSDSVSGTYLIE
                     AGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAN
                     GKGVQGTIDGQVQAMFPPPPKA"
     misc_feature    180608..182143
                     /locus_tag="PSPA7_0163"
                     /note="type VI secretion system Vgr family protein;
                     Region: VI_Rhs_Vgr; TIGR03361"
                     /db_xref="CDD:234183"
     misc_feature    180659..181561
                     /locus_tag="PSPA7_0163"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    181679..181963
                     /locus_tag="PSPA7_0163"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     gene            complement(182522..182635)
                     /locus_tag="PSPA7_0164"
                     /db_xref="GeneID:5354706"
     CDS             complement(182522..182635)
                     /locus_tag="PSPA7_0164"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345560.1"
                     /db_xref="GI:152987514"
                     /db_xref="GeneID:5354706"
                     /translation="MRSARGLKIDQTSEKRTMNFQAHLASRGEYQRGFPLR"
     gene            complement(182642..182767)
                     /locus_tag="PSPA7_0165"
                     /db_xref="GeneID:5353949"
     CDS             complement(182642..182767)
                     /locus_tag="PSPA7_0165"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345561.1"
                     /db_xref="GI:152986670"
                     /db_xref="GeneID:5353949"
                     /translation="MVPLGHQPNRAALHRIGIGAIAVKEFDETDVELAEALKAAH"
     gene            complement(182778..183311)
                     /locus_tag="PSPA7_0166"
                     /db_xref="GeneID:5355905"
     CDS             complement(182778..183311)
                     /locus_tag="PSPA7_0166"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345562.1"
                     /db_xref="GI:152986602"
                     /db_xref="GeneID:5355905"
                     /translation="MSMNPDNVLTLALANDELDRFLVGEPFYFLEARSDNEEPQNVSQ
                     AFDQLLMPYWRATRDPDLPFRFVAALLKILATYPDRNRAIYVAQNWIWYYRFCLSKKR
                     ANPQGPYGDLFEVDLGAVAVALKRQLEANKDELIRDTRWAGAAWNSSNGLWGPLLRTS
                     TTVRDKLGGPDFVPDNP"
     gene            complement(183308..184612)
                     /locus_tag="PSPA7_0167"
                     /db_xref="GeneID:5356434"
     CDS             complement(183308..184612)
                     /locus_tag="PSPA7_0167"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF05488"
                     /codon_start=1
                     /transl_table=11
                     /product="PAAR motif-containing protein"
                     /protein_id="YP_001345563.1"
                     /db_xref="GI:152985744"
                     /db_xref="GeneID:5356434"
                     /translation="MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATG
                     GLAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGD
                     DVSATCSGLPLNHPLWPFPVIIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQDTFI
                     GGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAIGGLMMGGM
                     ALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGRASAAGEVRTPAYKRGRTEAD
                     ILGLAKGKRPPPSEYLKKSYIDKHLKVFKEEGGAFLFTTDDIANPNYTSFNPNKFVMA
                     KSDLNSVVAEYKRTGDVSVLESALGYDPGSLAGKEIYMLNLENPKVLMPTGNEGGVNS
                     LWRPGGLTHPGGMREAVLDNVAIPHGNDVNVLMSTHDIARIQ"
     misc_feature    complement(184151..184378)
                     /locus_tag="PSPA7_0167"
                     /note="PAAR motif; Region: PAAR_motif; pfam05488"
                     /db_xref="CDD:253216"
     gene            complement(184628..185062)
                     /locus_tag="PSPA7_0168"
                     /db_xref="GeneID:5359698"
     CDS             complement(184628..185062)
                     /locus_tag="PSPA7_0168"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345564.1"
                     /db_xref="GI:152987036"
                     /db_xref="GeneID:5359698"
                     /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDA
                     SQGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQ
                     VFIERRPAVLITTLTTTPGDLPHHEPAWKQAMQTLVPRPAGH"
     misc_feature    complement(184637..185062)
                     /locus_tag="PSPA7_0168"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5435"
                     /db_xref="CDD:227722"
     gene            185315..187540
                     /locus_tag="PSPA7_0169"
                     /db_xref="GeneID:5354929"
     CDS             185315..187540
                     /locus_tag="PSPA7_0169"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF04524; match to protein family HMM PF06715; match to
                     protein family HMM TIGR01646; match to protein family HMM
                     TIGR03361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345565.1"
                     /db_xref="GI:152983873"
                     /db_xref="GeneID:5354929"
                     /translation="MALAQQTRLVRVDSPLGADVLQLQRMEGREELGRPFAYELELIS
                     EDPDLQLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWL
                     LTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSR
                     LMEQEGIYYWFRHEQSRHILVLSDAYGAHRSPPGYASVPYYPPTLEQRERDHFYDWHM
                     AREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYAR
                     TRIEALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYET
                     GGGGVGAQFESELDCIDGGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVK
                     VHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITG
                     RVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQD
                     IEVENDETHWVGHDRSKTIDHDETVHVKHDRTETVDNNETLTIGVDRTEKVGNNEKIS
                     IGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVG
                     NNETISIGADRSESVGANESIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKS
                     FTLNAGDSITLVTGAASIRMKKDGSIVISGKNITIDGSGAINIKADKNVVMKGRKILQ
                     N"
     misc_feature    185345..186886
                     /locus_tag="PSPA7_0169"
                     /note="type VI secretion system Vgr family protein;
                     Region: VI_Rhs_Vgr; TIGR03361"
                     /db_xref="CDD:234183"
     misc_feature    185399..186301
                     /locus_tag="PSPA7_0169"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    186419..186703
                     /locus_tag="PSPA7_0169"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     misc_feature    186923..186994
                     /locus_tag="PSPA7_0169"
                     /note="Gp5 C-terminal repeat (3 copies); Region: Gp5_C;
                     pfam06715"
                     /db_xref="CDD:253874"
     misc_feature    <187085..187489
                     /locus_tag="PSPA7_0169"
                     /note="Haemagluttinin repeat; Region: Fil_haemagg_2;
                     pfam13332"
                     /db_xref="CDD:257662"
     gene            187569..188018
                     /locus_tag="PSPA7_0170"
                     /db_xref="GeneID:5358444"
     CDS             187569..188018
                     /locus_tag="PSPA7_0170"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345566.1"
                     /db_xref="GI:152986466"
                     /db_xref="GeneID:5358444"
                     /translation="MSVEIHLPGPASALPARLDGVVIGILLDVPDAAAPVVAYPGCPN
                     EHGLAAATTTQLGRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEASAQLDGERLEFS
                     AEREIVLRCGKASITLTRAGKVIIRGAYLSSRSTGVNRIKGGSVQIN"
     misc_feature    <187746..187817
                     /locus_tag="PSPA7_0170"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; cl17812"
                     /db_xref="CDD:248366"
     gene            188035..189147
                     /locus_tag="PSPA7_0171"
                     /db_xref="GeneID:5354486"
     CDS             188035..189147
                     /locus_tag="PSPA7_0171"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345567.1"
                     /db_xref="GI:152985103"
                     /db_xref="GeneID:5354486"
                     /translation="MELLNATPLAAAYNQGLDAAGRESLVVIAKGSFDLPLDGREARL
                     LDEQQALLMMDEFFGEPGLSAPRRECDFVPFKPFCDVLVLGSAQAPGGRPVQQLTAGI
                     RVGRVGKALTVHGPRQWEPGLLGAGAGVAQPFQRQDISYASAFGGSHASPDNPGFMDC
                     YMANPAGRGWFPRSADTAEIVGTPMPATEKPGEPVDSPHGRFTPMALGPLGRHWQARV
                     GFAGRYDETWLAEQFPFLPADFDERYFQSAPSDQWTDYLRGGEEVLLLNLTGEERAAF
                     RVPRREVPVTFFLKKGGHETAQARIDTLLVDCDARRVEITWRIRRPLRRNLFEIAQVL
                     VGTMSSAWWRARELGKDYHPSLAALVRSRQAEEDEA"
     misc_feature    188035..189144
                     /locus_tag="PSPA7_0171"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5351"
                     /db_xref="CDD:227654"
     gene            189144..190181
                     /locus_tag="PSPA7_0172"
                     /db_xref="GeneID:5356552"
     CDS             189144..190181
                     /locus_tag="PSPA7_0172"
                     /note="catalyzes a condensation reaction in fatty acid
                     biosynthesis: addition of an acyl acceptor of two carbons
                     from malonyl-ACP"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl carrier protein) synthase"
                     /protein_id="YP_001345568.1"
                     /db_xref="GI:152986846"
                     /db_xref="GeneID:5356552"
                     /translation="MSQPLSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGG
                     EWLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPGLDCAELPLLLCVAEGDRPGRC
                     AGLDESFLRDLENELGRRFHPSSALIARGRVGGAVALLNARKLVQGGCRQVLLAGVDS
                     FLNGPTLAAYEARERLLSSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGLEK
                     ATVESEDLPLRADGLTQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNL
                     RVLKPKFDLWHPADCIGECGAAIGPALLAVALAASRKGYGDGPNVFCHLGNDAGERAA
                     ALLSYRRVRAA"
     misc_feature    189144..190178
                     /locus_tag="PSPA7_0172"
                     /note="3-oxoacyl-(acyl carrier protein) synthase;
                     Validated; Region: PRK06147"
                     /db_xref="CDD:235715"
     misc_feature    <189507..>189926
                     /locus_tag="PSPA7_0172"
                     /note="Condensing enzymes; Family of enzymes that catalyze
                     a (decarboxylating or non-decarboxylating) Claisen-like
                     condensation reaction. Members are share strong structural
                     similarity, and are involved in the synthesis and
                     degradation of fatty acids, and the...; Region:
                     cond_enzymes; cl09938"
                     /db_xref="CDD:263929"
     misc_feature    189537..189539
                     /locus_tag="PSPA7_0172"
                     /note="active site"
                     /db_xref="CDD:238201"
     gene            190181..191344
                     /locus_tag="PSPA7_0173"
                     /db_xref="GeneID:5359757"
     CDS             190181..191344
                     /locus_tag="PSPA7_0173"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345569.1"
                     /db_xref="GI:152989562"
                     /db_xref="GeneID:5359757"
                     /translation="MANEVYANDMEISCKAASGKSIAAFPDVCFTPPQAPPTPMGVPI
                     PYPNTGLAKDTTKGTRTVRITRKEVMLKNKSYFKTSYGDEAGRAPKKGVITSKIKGKV
                     YFTSWSMNVKFESKNVVRHMDLTTHNHGSQPGNTMTWTYADRMAYAKGLSQCDDERTR
                     AKDACGDTSKKVVCPDISALKKASAARAAAKKKAGDKFKDNADYQSRHQEVQREFSAL
                     AEKINNDPCQKALRCFLAPYRPNRCCPGQTGDHLVDAASFGPRKGKKITGWSKYQTNK
                     APCICAEGPNQTTATHGQLHTRRGVVALHEQDDKGEWPRGRATQVGAKAARKTFPDSN
                     CSQECLEAQLNKYHDTAKDDGTEKPIKANASMTSDVGERAAARAEMFEQVTLR"
     misc_feature    190232..190585
                     /locus_tag="PSPA7_0173"
                     /note="Domain of unknown function (DUF4150); Region:
                     DUF4150; pfam13665"
                     /db_xref="CDD:257972"
     misc_feature    190919..191227
                     /locus_tag="PSPA7_0173"
                     /note="GHH signature containing HNH/Endo VII superfamily
                     nuclease toxin 2; Region: Tox-GHH2; pfam15635"
                     /db_xref="CDD:259765"
     gene            191721..192281
                     /locus_tag="PSPA7_0174"
                     /db_xref="GeneID:5355017"
     CDS             191721..192281
                     /locus_tag="PSPA7_0174"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345570.1"
                     /db_xref="GI:152984217"
                     /db_xref="GeneID:5355017"
                     /translation="MGTCRQAYVREDEGVWRCIDQTAQGGDVALTDTSFESIDGFSEQ
                     EIYTVGWEGEIWSYDGSVFTQASSPTNLALYKVRCAGDGYAYACGQLGTLLRGRGDKW
                     EIIEHESTREDLWGMEYFDGHLYVSSTHFVYRLVDGRLERVDFGDDVPASCYHLSAAD
                     GIMWSVGAKDVMEFDGQSWKRILEIQ"
     misc_feature    <191748..192008
                     /locus_tag="PSPA7_0174"
                     /note="Photosynthesis system II assembly factor YCF48;
                     Region: PSII_BNR; pfam14870"
                     /db_xref="CDD:259007"
     gene            192278..193540
                     /locus_tag="PSPA7_0175"
                     /db_xref="GeneID:5356520"
     CDS             192278..193540
                     /locus_tag="PSPA7_0175"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     TIGR02270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345571.1"
                     /db_xref="GI:152984736"
                     /db_xref="GeneID:5356520"
                     /translation="MINEAMPRMSLPIVSMLDQHAEEAAFLALLRDYAVCAPHYDLEE
                     LAELDQRIEAHLDGLSIAGQAGYEALFEQLDAHAQGEAFALAALAMQAGDEAVIGRMR
                     ACLAESREARRGFAAALGWLDWERVQPWVERLLASPEPLFRSLGLAACGMHRQDPGPA
                     LLSALGHADPAVLARAARTAGELRRRDLMADIRAYRAHDDPSLCFWANWATAQMGDEE
                     ALGPLRAFAGQPGPFQLPATMVLLAWQPRDTSMAWIRQLMQAAETRRIGIQATGLFGD
                     PVAVPWLIQQMRDESLARVAGEAFSLITGADLALLDLELEVLPDHDPGPNDDPDDENV
                     ALDDDENLTWPEAERVSAWWRDNGARFVAGRAYLLGEPLGEARCREVLRDGQQRQRMA
                     AACLLARFVPGLPLFPTSAPVRRQLALF"
     misc_feature    192314..193534
                     /locus_tag="PSPA7_0175"
                     /note="conserved hypothetical protein; Region: TIGR02270"
                     /db_xref="CDD:131323"
     gene            193915..194643
                     /locus_tag="PSPA7_0176"
                     /db_xref="GeneID:5354612"
     CDS             193915..194643
                     /locus_tag="PSPA7_0176"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00484"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="YP_001345572.1"
                     /db_xref="GI:152989065"
                     /db_xref="GeneID:5354612"
                     /translation="MPDRMRGVKTDSQEQESADDALKRIVDGFQHFRREVFPEQQELF
                     KKLAKSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAI
                     EYAVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDC
                     GANHDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQ
                     GRFLPLDGEHPVPMATPAPRYLNQ"
     misc_feature    193996..194556
                     /locus_tag="PSPA7_0176"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeB; cd00884"
                     /db_xref="CDD:238449"
     misc_feature    order(194065..194067,194071..194073,194092..194094,
                     194098..194106,194140..194142,194149..194151,
                     194224..194226,194239..194241,194269..194271,
                     194278..194280,194524..194526)
                     /locus_tag="PSPA7_0176"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238449"
     misc_feature    order(194092..194094,194098..194100,194269..194271,
                     194278..194280)
                     /locus_tag="PSPA7_0176"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238449"
     misc_feature    order(194095..194106,194110..194112,194116..194127,
                     194140..194148,194152..194154,194158..194160,
                     194209..194214,194221..194226,194341..194343,
                     194524..194526,194530..194535,194539..194541,
                     194545..194547)
                     /locus_tag="PSPA7_0176"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238449"
     gene            194853..196424
                     /locus_tag="PSPA7_0178"
                     /db_xref="GeneID:5357811"
     CDS             194853..196424
                     /locus_tag="PSPA7_0178"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00860; match to protein family HMM PF00916"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfate transporter"
                     /protein_id="YP_001345573.1"
                     /db_xref="GI:152986430"
                     /db_xref="GeneID:5357811"
                     /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMPPA
                     KGLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQL
                     VAGRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAA
                     FAALGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLA
                     LDVRRVEVPANLGEAIDWLRPADLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLH
                     DGPRSDMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLL
                     AFVLLLGSLLRQIPVASLAGVLVYTGIKLVDFKALGNLGRYGRMPMLVYAATALAIVF
                     TDLLTGVLVGFALTLLKLVLKAARLKIVLRYTGEHEAELRLSGAATFLKVPALSRMLD
                     QVKPGTTLHVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRSN
                     AGLGGARSGGAVSPG"
     misc_feature    194874..196364
                     /locus_tag="PSPA7_0178"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    194883..195098
                     /locus_tag="PSPA7_0178"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    195162..195998
                     /locus_tag="PSPA7_0178"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     misc_feature    196143..196358
                     /locus_tag="PSPA7_0178"
                     /note="STAS domain; Region: STAS_2; pfam13466"
                     /db_xref="CDD:257790"
     gene            complement(196411..197049)
                     /locus_tag="PSPA7_0177"
                     /db_xref="GeneID:5354450"
     CDS             complement(196411..197049)
                     /locus_tag="PSPA7_0177"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345574.1"
                     /db_xref="GI:152984180"
                     /db_xref="GeneID:5354450"
                     /translation="MNTAALRELIQQAHLSEARHGYLADLIASRLPHLHRTIRPQGEN
                     TEDILTRFVHAYVEQVPDLLDAANSVAREAGIEDRIKPVLKVAEQFFLTPPALLAGHD
                     GLDALLDEAYLAHRLVEEVNDRYIAHFGQALIPLDTTVANLVAHQLIGEPFANQLDEA
                     VRHALEHMLDADTFDAESARAYRENLKNPRVVAAWQQWPCLSRQLGVELSLG"
     gene            complement(197271..197432)
                     /locus_tag="PSPA7_0179"
                     /db_xref="GeneID:5354592"
     CDS             complement(197271..197432)
                     /locus_tag="PSPA7_0179"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345575.1"
                     /db_xref="GI:152986909"
                     /db_xref="GeneID:5354592"
                     /translation="MSQHSGSPYRCFYPAGRRQRPRGGPPRQRTLTVSPRHTARQAGF
                     IRFSIRVGV"
     gene            197445..198545
                     /locus_tag="PSPA7_0180"
                     /db_xref="GeneID:5358701"
     CDS             197445..198545
                     /locus_tag="PSPA7_0180"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00034; match to protein family HMM PF00116; match to
                     protein family HMM PF02790; match to protein family HMM
                     TIGR02866"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="YP_001345576.1"
                     /db_xref="GI:152988948"
                     /db_xref="GeneID:5358701"
                     /translation="MGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMTIFWICVV
                     IGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPATRTLIH
                     IYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQEQIRNQQAKDEHYLLEVDE
                     PLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRGQCAE
                     LCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKVYHT
                     ICAACHQAEGQGMPPMFPALKGSKVVTGPKEHHLEVVFNGVAGTAMAAFGKQLNEVDL
                     AAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
     misc_feature    197445..198200
                     /locus_tag="PSPA7_0180"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 2 [Energy production and conversion]; Region:
                     CyoA; COG1622"
                     /db_xref="CDD:224537"
     misc_feature    197490..197729
                     /locus_tag="PSPA7_0180"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:202397"
     misc_feature    197769..198170
                     /locus_tag="PSPA7_0180"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     misc_feature    <198207..198533
                     /locus_tag="PSPA7_0180"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    198237..198464
                     /locus_tag="PSPA7_0180"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            198555..200147
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /db_xref="GeneID:5356983"
     CDS             198555..200147
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /EC_number="1.9.3.1"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00115; match to protein family HMM TIGR02891"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="YP_001345577.1"
                     /db_xref="GI:152983842"
                     /db_xref="GeneID:5356983"
                     /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSF
                     MMFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMI
                     PLMIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHS
                     VTFFIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMP
                     VLAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAII
                     PTFARKPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTG
                     VKVFNWVTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVA
                     HFHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFVGMNLAFFPMHFVGL
                     AGMPRRIPDYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRSGKPAPAKPWDGAE
                     GLEWSIPSPAPYHTFSTPPEVK"
     misc_feature    198615..200141
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    198642..200096
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Cytochrome C oxidase subunit I.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(198642..198644,198879..198881,198891..198893,
                     198897..198899,198918..198920,199038..199040,
                     199050..199052,199104..199106,199116..199118,
                     199176..199178,199197..199199,199206..199208,
                     199230..199232,199257..199265,199278..199283,
                     199287..199289,199317..199319,199428..199430,
                     199437..199439,199446..199451,199461..199463)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(198669..198671,198849..198851,198882..198884,
                     198903..198905,198912..198914,199074..199079,
                     199095..199097,199107..199109)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(198687..198689,198699..198701,198708..198710,
                     198720..198722,198957..198962,199803..199805,
                     200022..200024,200031..200033)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(198729..198731,198738..198743,199827..199829,
                     199836..199841,199938..199940,199992..199994)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(198777..198779,199287..199289,199398..199400,
                     199407..199412,199485..199493,199500..199502,
                     199509..199511,199533..199535,199557..199559,
                     199566..199568,199587..199595,199629..199631,
                     199683..199688,199692..199694,199698..199712,
                     199902..199907,199917..199925,199950..199955)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(198795..198797,199737..199739,199749..199751,
                     199875..199877,199986..199988)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(198951..198953,198960..198962)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199017..199019,199245..199256)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199176..199178,199197..199199,199317..199319,
                     199428..199430,199437..199439,199446..199451,
                     199461..199463)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199287..199289,199302..199307,199695..199697,
                     199707..199712,199917..199919)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199326..199328,199473..199478,199731..199733)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(199326..199328,199338..199340,199371..199373,
                     199473..199478,199551..199553,199560..199562)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199401..199403,199413..199415,200091..200093)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/Vb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(199476..199478,199707..199712,199917..199922)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    199491..199493
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    199590..199592
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199734..199736,199917..199922)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199830..199832,200001..200003)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(199938..199940,199950..199952)
                     /gene="ctaD"
                     /locus_tag="PSPA7_0181"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     gene            200158..200712
                     /locus_tag="PSPA7_0182"
                     /db_xref="GeneID:5356276"
     CDS             200158..200712
                     /locus_tag="PSPA7_0182"
                     /note="involved in the insertion of copper into subunit I
                     of cytochrome C oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase assembly protein"
                     /protein_id="YP_001345578.1"
                     /db_xref="GI:152984888"
                     /db_xref="GeneID:5356276"
                     /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPIYDVMCRALGING
                     KTAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARN
                     PSDKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDV
                     RHVTLAYTLFDITARNPPVPVAGR"
     misc_feature    200158..200706
                     /locus_tag="PSPA7_0182"
                     /note="cytochrome C oxidase assembly protein; Provisional;
                     Region: PRK05089"
                     /db_xref="CDD:235341"
     gene            200723..201610
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /db_xref="GeneID:5356236"
     CDS             200723..201610
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00510"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="YP_001345579.1"
                     /db_xref="GI:152989209"
                     /db_xref="GeneID:5356236"
                     /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHEES
                     HGPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAA
                     FFGALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWK
                     LPLINTILLVTSSFTVTFAHHALKKNRRGPLKAWLALTVLLGIAFLILQAEEYVHAYN
                     ELGLTLGAGIYGSTFFMLTGFHGAHVTLGALILGIMLIRILRGHFDAEHHFGFEAASW
                     YWHFVDVVWIGLFIFVYVI"
     misc_feature    200771..201604
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Cytochrome c oxidase subunit III.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_III; cd01665"
                     /db_xref="CDD:238834"
     misc_feature    order(200909..200911,200918..200923,200930..200932,
                     200939..200944)
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(200912..200917,200924..200929,200936..200938,
                     200951..200953,200984..200989,200996..200998,
                     201470..201472,201491..201493,201527..201532)
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(200960..200962,200969..200974,201005..201007,
                     201014..201016,201026..201031,201047..201049,
                     201401..201406,201413..201415,201425..201427)
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    201143..201145
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(201197..201205,201254..201256,201332..201334,
                     201362..201370,201395..201403)
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    201290..201292
                     /gene="coIII"
                     /locus_tag="PSPA7_0183"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            complement(201626..201835)
                     /locus_tag="PSPA7_0184"
                     /db_xref="GeneID:5358859"
     CDS             complement(201626..201835)
                     /locus_tag="PSPA7_0184"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345580.1"
                     /db_xref="GI:152987316"
                     /db_xref="GeneID:5358859"
                     /translation="MLKVAIVLLLLATLVSLFSGLFFLVRDQGHGSRVVNSLTVRVVL
                     AAATLALIAWGFYSGELNSHAPWHF"
     misc_feature    complement(201638..201832)
                     /locus_tag="PSPA7_0184"
                     /note="Protein of unknown function (DUF2909); Region:
                     DUF2909; pfam11137"
                     /db_xref="CDD:256309"
     gene            201914..202645
                     /locus_tag="PSPA7_0185"
                     /db_xref="GeneID:5354142"
     CDS             201914..202645
                     /locus_tag="PSPA7_0185"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345581.1"
                     /db_xref="GI:152986531"
                     /db_xref="GeneID:5354142"
                     /translation="MRGAFRPGLLPTLVVLGLLPVLLWLGTWQLQRADEKRALLASYE
                     ARRDADPLSPGQLEDLRDPAYVRVRLHGRFDERHTLLLDNRLRNGQAGVEVLQPFYDQ
                     ASGLWLLVNRGWVPWSDRRSPPTLETPDRVLLLDAWTYLPPPGGLHLADAPAVGWPRL
                     VTQLEIPALWRDFGRAGLPWEIRLEPGDGSFDTDWPLVSMPPERHTGYAAQWFALAAA
                     LLALYLYLGVRRAREKNHESRDSDA"
     misc_feature    201989..202552
                     /locus_tag="PSPA7_0185"
                     /note="SURF1 superfamily. Surf1/Shy1 has been implicated
                     in the posttranslational steps of the biogenesis of the
                     mitochondrially-encoded Cox1 subunit of cytochrome c
                     oxidase (complex IV). Cytochrome c oxidase (complex IV),
                     the terminal electron-transferring...; Region: SURF1;
                     cd06662"
                     /db_xref="CDD:119401"
     gene            202620..203198
                     /locus_tag="PSPA7_0186"
                     /db_xref="GeneID:5357961"
     CDS             202620..203198
                     /locus_tag="PSPA7_0186"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345582.1"
                     /db_xref="GI:152986937"
                     /db_xref="GeneID:5357961"
                     /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWV
                     PQGRSYSGALIGNGQTPADLGVQGRSQGEPWQLLVTAPGTCGEDCQQLVYLARQVNIA
                     LGREASRAGHALAASGELPADFANLVKLDYPRLQRYGLDPALYDKAGGGERPLLWVVD
                     PHGNLVLRYDAKANGKKLLKDVQLLLKLSHIG"
     gene            203263..204336
                     /locus_tag="PSPA7_0187"
                     /db_xref="GeneID:5358729"
     CDS             203263..204336
                     /locus_tag="PSPA7_0187"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02628"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345583.1"
                     /db_xref="GI:152983843"
                     /db_xref="GeneID:5358729"
                     /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPG
                     CYGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVR
                     RGRDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALR
                     LSGRFAARRYPAATRGLAGLALLLVIGQITLGGWVSSNYAAVACIDLPTCHGEWWPRM
                     DFANGFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVW
                     PTALMLLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRA
                     PAPSPQRVRRTLPPAQGSRLKAA"
     misc_feature    203299..204201
                     /locus_tag="PSPA7_0187"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; pfam02628"
                     /db_xref="CDD:251431"
     gene            204362..205276
                     /gene="cyoE2"
                     /locus_tag="PSPA7_0188"
                     /db_xref="GeneID:5356277"
     CDS             204362..205276
                     /gene="cyoE2"
                     /locus_tag="PSPA7_0188"
                     /EC_number="2.5.1.-"
                     /note="converts protoheme IX and farnesyl diphosphate to
                     heme O"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="YP_001345584.1"
                     /db_xref="GI:152987657"
                     /db_xref="GeneID:5356277"
                     /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPL
                     DGFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALG
                     FALLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAP
                     PLLGWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERY
                     TKLHILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIR
                     TFKYSIVYLFLLFMALLVDHYLPLKLLL"
     misc_feature    204410..205234
                     /gene="cyoE2"
                     /locus_tag="PSPA7_0188"
                     /note="Protoheme IX farnesyltransferase; Region:
                     PT_UbiA_Cox10; cd13957"
                     /db_xref="CDD:260120"
     misc_feature    order(204584..204586,204596..204598,204962..204964)
                     /gene="cyoE2"
                     /locus_tag="PSPA7_0188"
                     /note="putative active site [active]"
                     /db_xref="CDD:260120"
     gene            205302..205937
                     /locus_tag="PSPA7_0189"
                     /db_xref="GeneID:5357570"
     CDS             205302..205937
                     /locus_tag="PSPA7_0189"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345585.1"
                     /db_xref="GI:152988856"
                     /db_xref="GeneID:5357570"
                     /translation="MTRVNKTALVLAALVALVLGLTVHKVLTAQRQADPTVLLDAGIV
                     ILPQTRKVPALEFTNQDGQAVGTDSLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKL
                     PQEVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANALSIPYI
                     PADTSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
     misc_feature    205455..205877
                     /locus_tag="PSPA7_0189"
                     /note="SCO (an acronym for Synthesis of Cytochrome c
                     Oxidase) family; composed of proteins similar to Sco1, a
                     membrane-anchored protein possessing a soluble domain with
                     a TRX fold. Members of this family are required for the
                     proper assembly of cytochrome c...; Region: SCO; cd02968"
                     /db_xref="CDD:239266"
     misc_feature    order(205551..205553,205563..205565,205818..205820)
                     /locus_tag="PSPA7_0189"
                     /note="Cu(I) binding site [ion binding]; other site"
                     /db_xref="CDD:239266"
     gene            complement(205969..206421)
                     /locus_tag="PSPA7_0190"
                     /db_xref="GeneID:5357156"
     CDS             complement(205969..206421)
                     /locus_tag="PSPA7_0190"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345586.1"
                     /db_xref="GI:152986972"
                     /db_xref="GeneID:5357156"
                     /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLD
                     LVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQ
                     AAERLWLDTPVYLSAQAHLQAYYGRYGFVPVTEVYLEDDIPHIGMRRA"
     misc_feature    complement(206002..>206397)
                     /locus_tag="PSPA7_0190"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(206101..206271)
                     /locus_tag="PSPA7_0190"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(206140..206145,206173..206181))
                     /locus_tag="PSPA7_0190"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            206553..207026
                     /locus_tag="PSPA7_0191"
                     /db_xref="GeneID:5354376"
     CDS             206553..207026
                     /locus_tag="PSPA7_0191"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345587.1"
                     /db_xref="GI:152984085"
                     /db_xref="GeneID:5354376"
                     /translation="MRWEELSEQPCSLARVLAIVGDRWTLLVLRDCFLGIRRFDDFER
                     SLGVTRHVLADRLKRLVEAEILAKSPYQEKPLREEYRLTEKGMELYPTILSLVNWGDR
                     HLAGVEGPPLEHVHKRCGQHMHGVLVCSECGEPLHARDVTVREGLFWRGRLLRRG"
     misc_feature    206553..206909
                     /locus_tag="PSPA7_0191"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     gene            207379..208107
                     /locus_tag="PSPA7_0192"
                     /db_xref="GeneID:5353627"
     CDS             207379..208107
                     /locus_tag="PSPA7_0192"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00106; match to protein family HMM PF08659"
                     /codon_start=1
                     /transl_table=11
                     /product="putative short chain dehydrogenase"
                     /protein_id="YP_001345588.1"
                     /db_xref="GI:152985959"
                     /db_xref="GeneID:5353627"
                     /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPL
                     VQAIRDQGGEALACACDARQEQQVIDLFARIEREVGPLEAVIFNVGANVWFPITETTE
                     RVYRKVWEMAAFGGFLSGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFAL
                     RALAQSMARELGPKGIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETY
                     WQIHCQPRDCWVHELDLRPWTETF"
     misc_feature    207391..207891
                     /locus_tag="PSPA7_0192"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    207394..208104
                     /locus_tag="PSPA7_0192"
                     /note="classical (c) SDR, subgroup  10; Region: SDR_c10;
                     cd05373"
                     /db_xref="CDD:187631"
     misc_feature    order(207409..207411,207415..207426,207481..207489,
                     207556..207564,207640..207648,207709..207711,
                     207790..207798,207835..207837,207847..207849,
                     207928..207939,207943..207948)
                     /locus_tag="PSPA7_0192"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187631"
     misc_feature    order(207835..207837,207847..207849)
                     /locus_tag="PSPA7_0192"
                     /note="active site"
                     /db_xref="CDD:187631"
     gene            208132..208719
                     /locus_tag="PSPA7_0193"
                     /db_xref="GeneID:5358934"
     CDS             208132..208719
                     /locus_tag="PSPA7_0193"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345589.1"
                     /db_xref="GI:152986243"
                     /db_xref="GeneID:5358934"
                     /translation="MNKQIEFFFDVGSPTTYLAWTQLPRIAAERGATIAWRPMLLGGV
                     FKATGNHSPIEVPAKGRYTLHDLARHAQRYGVPLAFNPAFPINTLTLMRGAQGYLGGE
                     GFHPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTE
                     EAVRRGVFGAPSFFVGDQLFFGQDRLDFVAEALAG"
     misc_feature    208144..208713
                     /locus_tag="PSPA7_0193"
                     /note="DsbA family, 2-hydroxychromene-2-carboxylate (HCCA)
                     isomerase subfamily; HCCA isomerase is a glutathione (GSH)
                     dependent enzyme involved in the naphthalene catabolic
                     pathway. It converts HCCA, a hemiketal formed
                     spontaneously after ring cleavage of 1; Region:
                     DsbA_HCCA_Iso; cd03022"
                     /db_xref="CDD:239320"
     misc_feature    208168..208170
                     /locus_tag="PSPA7_0193"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:239320"
     gene            208964..210298
                     /locus_tag="PSPA7_0194"
                     /db_xref="GeneID:5355601"
     CDS             208964..210298
                     /locus_tag="PSPA7_0194"
                     /note="involved in the transport of C4-dicarboxylates
                     across the membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter DctA"
                     /protein_id="YP_001345590.1"
                     /db_xref="GI:152984669"
                     /db_xref="GeneID:5355601"
                     /translation="MFIKRCSRSIFLQVVIGLVIGVLCGVGIPDLAVQMKPLGDGFIK
                     LIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYSLGL
                     GSGANIHLNELPAGDIALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQVLLFSV
                     LFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDSL
                     SHLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELLIVMGTASSDAVLP
                     QVMRKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMTDLLTI
                     LLVSLVTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIG
                     NCVATVTIARWENDIDLPRAQAILDGRLEAPTRTGGEPLERGVVAGEGKLQG"
     misc_feature    208970..210232
                     /locus_tag="PSPA7_0194"
                     /note="C4-dicarboxylate transporter DctA; Reviewed;
                     Region: PRK13027"
                     /db_xref="CDD:183850"
     gene            210347..211033
                     /locus_tag="PSPA7_0195"
                     /db_xref="GeneID:5359509"
     CDS             210347..211033
                     /locus_tag="PSPA7_0195"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00392; match to protein family HMM PF07729"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345591.1"
                     /db_xref="GI:152986952"
                     /db_xref="GeneID:5359509"
                     /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISR
                     PSLREAIMVLETLGVVRSMPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFI
                     VGIVAQSAGAAEISELRLLLLDLREAVEDGAAQAVVEAYTAFHRRLVKLTSNPIFLSV
                     SEQIGSALERSDNLVRRQPEYAEEILQEHEAILRAIRQHDSERASQAMRQHILNEGAR
                     LNIDLRLPQG"
     misc_feature    210353..211018
                     /locus_tag="PSPA7_0195"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    210362..210556
                     /locus_tag="PSPA7_0195"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(210362..210364,210368..210370,210437..210439,
                     210443..210448,210470..210484,210488..210493,
                     210500..210502,210530..210535,210539..210550)
                     /locus_tag="PSPA7_0195"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    210614..210988
                     /locus_tag="PSPA7_0195"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            211134..211868
                     /locus_tag="PSPA7_0196"
                     /db_xref="GeneID:5354356"
     CDS             211134..211868
                     /locus_tag="PSPA7_0196"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345592.1"
                     /db_xref="GI:152987940"
                     /db_xref="GeneID:5354356"
                     /translation="MVGFEARTPQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKET
                     LGQIFRVSNGTIQRALTRLAEDGAVVMAPKEVASVARPDERQARQVLEARLLVESEVL
                     RQLRKGVDATTLDELRALVDEEQACLEARDSAGVIRLAGRFHLRLAECTENPLLLGFV
                     RGLVARASLDIALNKGAVYSVEACVAQRGLLDALEAGDSVAATELMDEYLRGLFARMR
                     FLPPPTTDLRKAFGMSARRQDKRQEA"
     misc_feature    211134..211820
                     /locus_tag="PSPA7_0196"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    211179..211355
                     /locus_tag="PSPA7_0196"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(211179..211181,211185..211187,211254..211256,
                     211260..211262,211284..211298,211302..211307,
                     211314..211316,211344..211349,211353..211355)
                     /locus_tag="PSPA7_0196"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    211398..211769
                     /locus_tag="PSPA7_0196"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            212071..212436
                     /locus_tag="PSPA7_0197"
                     /db_xref="GeneID:5357383"
     CDS             212071..212436
                     /locus_tag="PSPA7_0197"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF06355"
                     /codon_start=1
                     /transl_table=11
                     /product="aegerolysin"
                     /protein_id="YP_001345593.1"
                     /db_xref="GI:152985646"
                     /db_xref="GeneID:5357383"
                     /translation="MKVVVSNSIGTAGIRNATLQWGMFCRCSNRDDEISAEKDSSMNV
                     QAGSPQWIASCGRENAASGTRGCFDCHDGNTKMGTFSWDDPRKSGATQTRHFTPASQN
                     YAGISSGGNATGAASARSP"
     misc_feature    212071..212418
                     /locus_tag="PSPA7_0197"
                     /note="Aegerolysin; Region: Aegerolysin; pfam06355"
                     /db_xref="CDD:253689"
     gene            complement(212503..213393)
                     /locus_tag="PSPA7_0198"
                     /db_xref="GeneID:5358520"
     CDS             complement(212503..213393)
                     /locus_tag="PSPA7_0198"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345594.1"
                     /db_xref="GI:152986169"
                     /db_xref="GeneID:5358520"
                     /translation="MDSLKGMAIFATVVDKGSMAAAAESLGLTPSAVSQQIRRLESRA
                     QVTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGL
                     SGSLITQALKPLLEDHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGD
                     WNHILCAAPGYLRQRAPLKRPEQLLELDWIALNTASQFNLLTLTGADGEVCKLRLEPR
                     VAANGMLAVRQFTLDGLGVSCQPLPEVREALDAGRLQRLLPEWKLPDLGIHAVTPRRD
                     AQPAKVKVAIEALRRAFATG"
     misc_feature    complement(212512..213393)
                     /locus_tag="PSPA7_0198"
                     /note="transcriptional regulator; Provisional; Region:
                     PRK10632"
                     /db_xref="CDD:182601"
     misc_feature    complement(213205..213384)
                     /locus_tag="PSPA7_0198"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(212527..213120)
                     /locus_tag="PSPA7_0198"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(212590..212592,212671..212673,
                     212722..212724,212911..212913,212917..212919,
                     212959..212961,213076..213078,213088..213090))
                     /locus_tag="PSPA7_0198"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(212695..212697,212704..212709,
                     212728..212742,212830..212832,213013..213033,
                     213037..213039,213049..213051,213058..213063,
                     213067..213072,213082..213087))
                     /locus_tag="PSPA7_0198"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            213408..213542
                     /locus_tag="PSPA7_0199"
                     /db_xref="GeneID:5359603"
     CDS             213408..213542
                     /locus_tag="PSPA7_0199"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345595.1"
                     /db_xref="GI:152986881"
                     /db_xref="GeneID:5359603"
                     /translation="MGTSAREKAPEKARESVPSGEGVDFRKMRTQIGAKNKSIKELIS
                     "
     gene            complement(213690..213971)
                     /locus_tag="PSPA7_0200"
                     /db_xref="GeneID:5358673"
     CDS             complement(213690..213971)
                     /locus_tag="PSPA7_0200"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345596.1"
                     /db_xref="GI:152985203"
                     /db_xref="GeneID:5358673"
                     /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQ
                     EVANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKEIQILRIDRVEITP"
     misc_feature    complement(213714..213971)
                     /locus_tag="PSPA7_0200"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(213968..214195)
                     /locus_tag="PSPA7_0201"
                     /db_xref="GeneID:5359458"
     CDS             complement(213968..214195)
                     /locus_tag="PSPA7_0201"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345597.1"
                     /db_xref="GI:152984580"
                     /db_xref="GeneID:5359458"
                     /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQ
                     WQVAAIDEGLADANAGRLLEHTEIEKRWGLQ"
     misc_feature    complement(213986..214195)
                     /locus_tag="PSPA7_0201"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG3905"
                     /db_xref="CDD:226420"
     gene            complement(214371..214991)
                     /locus_tag="PSPA7_0202"
                     /db_xref="GeneID:5359148"
     CDS             complement(214371..214991)
                     /locus_tag="PSPA7_0202"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345598.1"
                     /db_xref="GI:152986123"
                     /db_xref="GeneID:5359148"
                     /translation="MPTRVLRGLVAALPLFLAACSDPAPSSEEIARLLTERGFDKPAC
                     ASSTLFKAFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLQRDGDTYALTPAGREDYKP
                     ESKAFCYSSGFDVSVRSVDPAKPDDHGPAVEKGWLVTVEVRPRGVKDWAKNPEVLKQA
                     SLTTLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
     gene            215092..215592
                     /locus_tag="PSPA7_0203"
                     /db_xref="GeneID:5359108"
     CDS             215092..215592
                     /locus_tag="PSPA7_0203"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345599.1"
                     /db_xref="GI:152986451"
                     /db_xref="GeneID:5359108"
                     /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPG
                     QGMEMRFMVKLRVQNPNDEPIEYNGIALDLDVNGQPLASGVSDQAGEVPRFGERVVSV
                     PLTVSAFSAFRQAWGLSNNAPTQGMPYVVKGKLAGGLFGTVRFSEKGTLDFPGPAVGV
                     PKTKGL"
     misc_feature    215194..215502
                     /locus_tag="PSPA7_0203"
                     /note="Water Stress and Hypersensitive response; Region:
                     WHy; smart00769"
                     /db_xref="CDD:214812"
     gene            215665..216006
                     /locus_tag="PSPA7_0204"
                     /db_xref="GeneID:5354471"
     CDS             215665..216006
                     /locus_tag="PSPA7_0204"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03831; match to protein family HMM PF08274; match to
                     protein family HMM TIGR00686"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345600.1"
                     /db_xref="GI:152988852"
                     /db_xref="GeneID:5354471"
                     /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGK
                     VIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGA
                     MKLKSEFVRKV"
     misc_feature    215668..216003
                     /locus_tag="PSPA7_0204"
                     /note="Uncharacterized Zn-ribbon-containing protein
                     involved in phosphonate metabolism [Inorganic ion
                     transport and metabolism]; Region: PhnA; COG2824"
                     /db_xref="CDD:225380"
     misc_feature    215671..215760
                     /locus_tag="PSPA7_0204"
                     /note="PhnA Zinc-Ribbon; Region: PhnA_Zn_Ribbon;
                     pfam08274"
                     /db_xref="CDD:254700"
     misc_feature    215797..215961
                     /locus_tag="PSPA7_0204"
                     /note="PhnA protein; Region: PhnA; pfam03831"
                     /db_xref="CDD:252191"
     gene            complement(216126..217553)
                     /gene="gabP"
                     /locus_tag="PSPA7_0205"
                     /db_xref="GeneID:5357152"
     CDS             complement(216126..217553)
                     /gene="gabP"
                     /locus_tag="PSPA7_0205"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00324; match to protein family HMM PF03845; match to
                     protein family HMM TIGR01773"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-aminobutyrate permease"
                     /protein_id="YP_001345601.1"
                     /db_xref="GI:152985787"
                     /db_xref="GeneID:5357152"
                     /translation="MSKVVLASQLPDKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGS
                     GHAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTI
                     GWLYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFE
                     FWFALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLT
                     TMFSFMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLL
                     IQVGSYQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLARRGDAPSVL
                     KLTNTAHVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQL
                     RMRKQLQASGQPIEFRMWLYPWLTWAVILFIVAALSIMLVMPEHRHEVFATALLTIFT
                     VCLGLLNARRKPRLGEDYAGKTARV"
     misc_feature    complement(216171..217553)
                     /gene="gabP"
                     /locus_tag="PSPA7_0205"
                     /note="gamma-aminobutyrate permease; Region: GABAperm;
                     TIGR01773"
                     /db_xref="CDD:233567"
     misc_feature    complement(<216753..217373)
                     /gene="gabP"
                     /locus_tag="PSPA7_0205"
                     /note="Spore germination protein; Region: Spore_permease;
                     cl17796"
                     /db_xref="CDD:266844"
     misc_feature    complement(216255..>216959)
                     /gene="gabP"
                     /locus_tag="PSPA7_0205"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(217722..219215)
                     /gene="mmsA3"
                     /locus_tag="PSPA7_0206"
                     /db_xref="GeneID:5358416"
     CDS             complement(217722..219215)
                     /gene="mmsA3"
                     /locus_tag="PSPA7_0206"
                     /EC_number="1.2.1.27"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00171; match to protein family HMM TIGR01722"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="YP_001345602.1"
                     /db_xref="GI:152984720"
                     /db_xref="GeneID:5358416"
                     /translation="MGMLQHLINGELVADSGRSADVFNPSTGEAIHKVPLADGKTLQK
                     AIDAAKAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELK
                     RGIENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYP
                     LAIACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKDAVDGLIQAPEVK
                     AISFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSC
                     GERCMAISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTG
                     YIDSGVAQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVR
                     VNSLEEAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFG
                     GWKRSLFGDLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
     misc_feature    complement(217773..219206)
                     /gene="mmsA3"
                     /locus_tag="PSPA7_0206"
                     /note="Methylmalonate semialdehyde dehydrogenase and ALDH
                     family members 6A1 and 6B2; Region: ALDH_F6_MMSDH;
                     cd07085"
                     /db_xref="CDD:143404"
     misc_feature    complement(order(217773..217778,217782..217799,
                     217818..217820,217860..217862,217866..217868,
                     217878..217880,217905..217916,217920..217922,
                     217926..217931,217938..217940,217947..217952,
                     217956..217961,217965..217967,218490..218492,
                     218496..218498,218505..218507,218514..218516,
                     218526..218528,218805..218807,218814..218816,
                     218823..218825,218838..218861,218886..218891,
                     218898..218900,218997..218999,219009..219011,
                     219018..219020,219030..219032,219036..219038))
                     /gene="mmsA3"
                     /locus_tag="PSPA7_0206"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143404"
     misc_feature    complement(order(217986..217988,218064..218066,
                     218070..218072,218376..218378,218472..218480,
                     218532..218534,218541..218552,218601..218603,
                     218691..218693,218700..218702,218745..218747,
                     218769..218780))
                     /gene="mmsA3"
                     /locus_tag="PSPA7_0206"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143404"
     misc_feature    complement(order(218376..218378,218385..218387,
                     218478..218480,218769..218771))
                     /gene="mmsA3"
                     /locus_tag="PSPA7_0206"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143404"
     gene            complement(219296..219583)
                     /locus_tag="PSPA7_0207"
                     /db_xref="GeneID:5355076"
     CDS             complement(219296..219583)
                     /locus_tag="PSPA7_0207"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345603.1"
                     /db_xref="GI:152989719"
                     /db_xref="GeneID:5355076"
                     /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVP
                     MTDGTLLLETAEGDRHAPLVAGQAYFRKAGVEHNVVNASAHEVVFIETEIK"
     misc_feature    complement(219314..>219556)
                     /locus_tag="PSPA7_0207"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            complement(219583..220929)
                     /locus_tag="PSPA7_0208"
                     /db_xref="GeneID:5358258"
     CDS             complement(219583..220929)
                     /locus_tag="PSPA7_0208"
                     /note="catalyzes the formation of pyruvate and
                     beta-alanine from L-alanine and 3-oxopropanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="beta alanine--pyruvate transaminase"
                     /protein_id="YP_001345604.1"
                     /db_xref="GI:152989101"
                     /db_xref="GeneID:5358258"
                     /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSW
                     LTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEK
                     IAQLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAG
                     TSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDAS
                     NIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEY
                     FGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVA
                     CAAGLAALDILARDNLVQQSAELAPHFEKVLHGLQGAKNVIDIRNCGLAGAIQIAPRD
                     GDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALDGIA"
     misc_feature    complement(219586..220896)
                     /locus_tag="PSPA7_0208"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    complement(219598..220893)
                     /locus_tag="PSPA7_0208"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(220066..220068,220144..220149,
                     220153..220155,220252..220254,220462..220464,
                     220468..220473,220567..220575))
                     /locus_tag="PSPA7_0208"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(220066..220068,220144..220146,
                     220153..220155,220252..220254,220468..220473,
                     220567..220572))
                     /locus_tag="PSPA7_0208"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(220066..220068)
                     /locus_tag="PSPA7_0208"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            221065..221982
                     /locus_tag="PSPA7_0209"
                     /db_xref="GeneID:5356160"
     CDS             221065..221982
                     /locus_tag="PSPA7_0209"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345605.1"
                     /db_xref="GI:152985079"
                     /db_xref="GeneID:5356160"
                     /translation="MGKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRS
                     AISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQH
                     LRGELNIGIINNLVTLPQMRITHALSTLKGQGPQVRINIGMTTPNEIELGVLDGHLHV
                     GVVPLISPLSGLEYLPLYDEHAQLYCSRGHPLFERADGDIAVDQVLAADAVAPSYRLP
                     AEAQARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFH
                     YAIALTIVTRKGRRPNLVLERFLEAVAVS"
     misc_feature    221107..221973
                     /locus_tag="PSPA7_0209"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    221113..221292
                     /locus_tag="PSPA7_0209"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    221380..221970
                     /locus_tag="PSPA7_0209"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(221434..221439,221443..221448,221455..221457,
                     221467..221469,221473..221493,221755..221772,
                     221788..221793,221797..221802)
                     /locus_tag="PSPA7_0209"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(222088..223386)
                     /gene="guaD2"
                     /locus_tag="PSPA7_0210"
                     /db_xref="GeneID:5354038"
     CDS             complement(222088..223386)
                     /gene="guaD2"
                     /locus_tag="PSPA7_0210"
                     /EC_number="3.5.4.3"
                     /note="Catalyzes the deamination of guanine"
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="YP_001345606.1"
                     /db_xref="GI:152983612"
                     /db_xref="GeneID:5354038"
                     /translation="MSSSAHRGRILHFLGDPAKLGDKAWEYFDDGLLWIEHGQVRALD
                     HAAYLLPRLPAGLALEEHPGRLLLPGFVDCHVHYPQLGVVASYGTQLLDWLEAHTYPA
                     EQRFADAGYATVQAELFLDELLRHGTTTALVFGTVHAVSAEAFFQAAQKRRLRMIAGK
                     VLMDRNAPPALCDTAASGYAESRALIERWHGNGRLQYAVTPRFAPTSSPGQLAAAARL
                     LDEYPGVYLHSHLSENLKEVAWVGELFPQAQDYLDVYHRAGLVGERSVFAHGIHLSER
                     ECRCLAHKNAALAHCPSSNLFMGSGLFDLGRAQQYGIRVGIGSDLGGGTSLSLLANLA
                     DAYKIQQLRGASLDPFQALYLATLGGARTLGLDGLIGNFLPGREADFVALDLAATPMI
                     AQRMEHARGLADTLFVLNTLGDDRAVAATWVLGERRHAKG"
     misc_feature    complement(222091..223386)
                     /gene="guaD2"
                     /locus_tag="PSPA7_0210"
                     /note="guanine deaminase; Provisional; Region: PRK09228"
                     /db_xref="CDD:236419"
     misc_feature    complement(222112..223368)
                     /gene="guaD2"
                     /locus_tag="PSPA7_0210"
                     /note="Guanine deaminase (GDEase). Guanine deaminase is an
                     aminohydrolase responsible for the conversion of guanine
                     to xanthine and ammonia, the first step to utilize guanine
                     as a nitrogen source. This reaction also removes the
                     guanine base from the pool and...; Region: GDEase;
                     cd01303"
                     /db_xref="CDD:238628"
     misc_feature    complement(order(222427..222429,222580..222582,
                     222688..222690,222697..222699,223156..223158,
                     223162..223164))
                     /gene="guaD2"
                     /locus_tag="PSPA7_0210"
                     /note="active site"
                     /db_xref="CDD:238628"
     gene            223369..223701
                     /locus_tag="PSPA7_0211"
                     /db_xref="GeneID:5358060"
     CDS             223369..223701
                     /locus_tag="PSPA7_0211"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345607.1"
                     /db_xref="GI:152989180"
                     /db_xref="GeneID:5358060"
                     /translation="MGRAAHRACAMTGTQGKRGDEVASRYRIVHLLCRRKGLSPLLVR
                     KIGGNIPPLARDAPPEVSAKNASGVFIGSPALSLCAVRMLWISLCADFLRRAGRAVAG
                     SVLPASGR"
     gene            complement(224148..224516)
                     /locus_tag="PSPA7_0212"
                     /db_xref="GeneID:5358830"
     CDS             complement(224148..224516)
                     /locus_tag="PSPA7_0212"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345608.1"
                     /db_xref="GI:152988523"
                     /db_xref="GeneID:5358830"
                     /translation="MAAWQPPAPHRGTPRRPRRICEQRGDERAWAFLAKQSSPPCAQS
                     YPQHADSRPASRGAIPADRPGEFHDYRGGQKTANPAGHERDPARHFFQHFANRLINKP
                     STAAQGSTAEYRPPTRPALG"
     gene            224616..226187
                     /locus_tag="PSPA7_0213"
                     /db_xref="GeneID:5355799"
     CDS             224616..226187
                     /locus_tag="PSPA7_0213"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001345609.1"
                     /db_xref="GI:152985406"
                     /db_xref="GeneID:5355799"
                     /translation="MTTVSSPAPPRLELRGISKRYPGCLANDRIDLRIDAGEIHALLG
                     ENGAGKSTLMKIIYGVTRPDAGEILWQGEPVRVRDPAGARALGIGMVFQHFSLFETLS
                     VAQNIALALGTEAGGPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLM
                     QDIRLLILDEPTSVLTPREAEDLFVILRRLAEEGCSVLFISHKLAEVRALCRRATVLR
                     GGRVAGQCLPAQCSDLELARLMVGDAEGLAAEYPKVAGGAPFLQVRDLYWRNPDPFGV
                     SFAGLDLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRVQAGRIRLGGTAGGHLAA
                     DARRRAGQAFVPAERLGHGAVPEMSLADNTLLSAFQRGLVKRGLVRRRKVLALAEEII
                     RRFAVKTPGAGAPARSLSGGNLQKFILGREILQSPRLLVAAHPTWGVDVGAAALIHRA
                     LIALRDAGTAILVVSEDLDELFLLSDRIAALCSGRLSPAVATASASPQQVGGWMAGQF
                     EAPAAVAGAVAQGSL"
     misc_feature    224637..226133
                     /locus_tag="PSPA7_0213"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    224649..225290
                     /locus_tag="PSPA7_0213"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    224745..224768
                     /locus_tag="PSPA7_0213"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(224754..224759,224763..224771,224892..224894,
                     225120..225125,225219..225221)
                     /locus_tag="PSPA7_0213"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    224883..224894
                     /locus_tag="PSPA7_0213"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    225048..225077
                     /locus_tag="PSPA7_0213"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    225108..225125
                     /locus_tag="PSPA7_0213"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    225132..225143
                     /locus_tag="PSPA7_0213"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    225207..225227
                     /locus_tag="PSPA7_0213"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    225384..226073
                     /locus_tag="PSPA7_0213"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            226187..227284
                     /locus_tag="PSPA7_0214"
                     /db_xref="GeneID:5355532"
     CDS             226187..227284
                     /locus_tag="PSPA7_0214"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02653"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001345610.1"
                     /db_xref="GI:152986122"
                     /db_xref="GeneID:5355532"
                     /translation="MLLSLEPRGRQSRWILLASPLLAGLLTLVCGALLFAGLGHDPWQ
                     ALHTVLVQPVSDLYGIGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLIGALAGS
                     AVAIQLLDWQSRWALAGVLLAGSAAGAFWAGLAAWLRTRFNANEILTTIMLNYIALNL
                     LLYGVHGPLKDPEGFNFPQSALFGEASRLPALFEDSRVHFGALFGLLALAAVWVLAQR
                     SFLGFQVRVLGLDRRAAGFAGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQV
                     SPGYGYAAITVAFLGRLNPFGILAASLLMALLYLGGEAAQMSLNLPLALTGLFQGMML
                     FFLLACDVLILYRPRLHGHWRKRPALRDALA"
     misc_feature    226427..227200
                     /locus_tag="PSPA7_0214"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    226883..226939
                     /locus_tag="PSPA7_0214"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            227308..228234
                     /locus_tag="PSPA7_0215"
                     /db_xref="GeneID:5359107"
     CDS             227308..228234
                     /locus_tag="PSPA7_0215"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02653"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001345611.1"
                     /db_xref="GI:152983566"
                     /db_xref="GeneID:5359107"
                     /translation="MDIDLLNNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMM
                     LFGAVIGFMVAFSSGSLWLGVLLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGV
                     GLSSFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLL
                     RSRAGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAEN
                     MTAGRGWIALALVVFASWRVFRVLLGAWLFGLASILHLVAQGVGLAIPANLLAMLPYV
                     ATILVLVLLSRDALRTRLYAPVSLGQPWKAGL"
     misc_feature    227359..228153
                     /locus_tag="PSPA7_0215"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    227833..227889
                     /locus_tag="PSPA7_0215"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            228400..228963
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /db_xref="GeneID:5358994"
     CDS             228400..228963
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /EC_number="1.11.1.15"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00578; match to protein family HMM PF08534; match to
                     protein family HMM TIGR03137"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit C"
                     /protein_id="YP_001345612.1"
                     /db_xref="GI:152986830"
                     /db_xref="GeneID:5358994"
                     /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFT
                     FNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTH
                     QLTNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAA
                     HPGEVCPAKWKEGEKTLAPSLDLVGKI"
     misc_feature    228400..228960
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /note="peroxiredoxin; Region: AhpC; TIGR03137"
                     /db_xref="CDD:211789"
     misc_feature    228409..228918
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /note="Peroxiredoxin (PRX) family, Typical 2-Cys PRX
                     subfamily; PRXs are thiol-specific antioxidant (TSA)
                     proteins, which confer a protective role in cells through
                     its peroxidase activity by reducing hydrogen peroxide,
                     peroxynitrite, and organic hydroperoxides; Region:
                     PRX_Typ2cys; cd03015"
                     /db_xref="CDD:239313"
     misc_feature    order(228409..228411,228532..228537,228544..228546,
                     228724..228726,228754..228756,228793..228801,
                     228805..228813,228823..228828,228847..228849,
                     228895..228906)
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239313"
     misc_feature    order(228526..228528,228628..228633,228697..228699,
                     228703..228705,228739..228741)
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /note="decamer (pentamer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239313"
     misc_feature    order(228529..228531,228538..228540,228757..228759)
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239313"
     misc_feature    order(228538..228540,228895..228897)
                     /gene="ahpC"
                     /locus_tag="PSPA7_0216"
                     /note="peroxidatic and resolving cysteines [active]"
                     /db_xref="CDD:239313"
     gene            229109..230674
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /db_xref="GeneID:5359741"
     CDS             229109..230674
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /EC_number="1.8.1.-"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00070; match to protein family HMM PF07992; match to
                     protein family HMM TIGR03140"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit F"
                     /protein_id="YP_001345613.1"
                     /db_xref="GI:152987410"
                     /db_xref="GeneID:5359741"
                     /translation="MLDANLKAQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIV
                     GLTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSK
                     LDAEVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQD
                     EVEARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTAREAFDVLVVG
                     GGPAGAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLARALEEHV
                     RHYEVDIMNLQRASKLVPAKNAGELHEVQFESGGSLKARSLILATGARWREMGVPGEQ
                     EYKAKGVCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRAD
                     AVLQRKLYSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGL
                     LPNTEWLKGSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASL
                     SAFDHLIRTSAPE"
     misc_feature    229109..230668
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="alkyl hydroperoxide reductase subunit F;
                     Provisional; Region: PRK15317"
                     /db_xref="CDD:237942"
     misc_feature    229109..229390
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="Alkyl hydroperoxide reductase F subunit (AhpF)
                     N-terminal domain (NTD) family, N-terminal TRX-fold
                     subdomain; AhpF is a homodimeric flavoenzyme which
                     catalyzes the NADH-dependent reduction of the
                     peroxiredoxin AhpC, which in turn catalyzes the
                     reduction...; Region: AhpF_NTD_N; cd02974"
                     /db_xref="CDD:239272"
     misc_feature    229361..229363
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239272"
     misc_feature    229421..229687
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="TRX-GRX-like family, Alkyl hydroperoxide reductase
                     F subunit (AhpF) N-terminal domain (NTD) subfamily,
                     C-terminal TRX-fold subdomain; AhpF is a homodimeric
                     flavoenzyme which catalyzes the NADH-dependent reduction
                     of the peroxiredoxin AhpC, which then...; Region:
                     AhpF_NTD_C; cd03026"
                     /db_xref="CDD:239324"
     misc_feature    order(229490..229492,229499..229501)
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239324"
     misc_feature    <229901..230257
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    230174..230389
                     /gene="ahpF"
                     /locus_tag="PSPA7_0217"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(230748..231821)
                     /locus_tag="PSPA7_0218"
                     /db_xref="GeneID:5359382"
     CDS             complement(230748..231821)
                     /locus_tag="PSPA7_0218"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03976"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345614.1"
                     /db_xref="GI:152988607"
                     /db_xref="GeneID:5359382"
                     /translation="MSEEPTVSPPSAEQPAAQPAKPARPAARRAPRKPATRRPRVASP
                     AQKAREEIQAISQKPVALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDL
                     QIELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQE
                     QGQWYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERML
                     TNSGILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMF
                     FHTDTADAPWTVIKSDDKKRARLNCIRHFLHALDYPGKDRRIAHEPDPLLVGPASRVI
                     EEDEKVYAEAAAAPGHANLDIPA"
     misc_feature    complement(230874..231557)
                     /locus_tag="PSPA7_0218"
                     /note="polyphosphate kinase 2, PA0141 family; Region:
                     PPK2_P_aer; TIGR03707"
                     /db_xref="CDD:213852"
     gene            232099..233448
                     /locus_tag="PSPA7_0219"
                     /db_xref="GeneID:5356948"
     CDS             232099..233448
                     /locus_tag="PSPA7_0219"
                     /note="catalyzes the transformation of hydroxyatrazine to
                     N-isopropylammelide and ethylamine in the atrazine
                     degradation pathway."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxydechloroatrazine ethylaminohydrolase"
                     /protein_id="YP_001345615.1"
                     /db_xref="GI:152985904"
                     /db_xref="GeneID:5356948"
                     /translation="MSRTWIRNPLAIFTANGLDAAGGLVVEDGRIVELLGAGQHPAQP
                     CASQFDASQHVVLPGLINTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKL
                     ELATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLG
                     EKDGGLPPQQTVQEAETILADSERLIARYHQRGEGARVQIALAPCSPFSVTPEIMRAS
                     AELAARHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAE
                     EIRRLGEAGTGICHCPSSNMRLASGICPTMELEAAGAPIGLGVDGSASNDASNMILEA
                     RQALYLQRLRYGAERITPALALGWATRGSARLLGRGDIGELAPGKQADLALFKLDELR
                     FSGSHDPLSALLLCAADRADRVMVGGTWRVVDGAVEGLDLAALIARHRAAASALIAG"
     misc_feature    232102..233445
                     /locus_tag="PSPA7_0219"
                     /note="hydroxydechloroatrazine ethylaminohydrolase;
                     Reviewed; Region: PRK08203"
                     /db_xref="CDD:236184"
     misc_feature    232108..233379
                     /locus_tag="PSPA7_0219"
                     /note="TRZ/ATZ family contains enzymes from the atrazine
                     degradation pathway and related hydrolases. Atrazine, a
                     chlorinated herbizide, can be catabolized by a variety of
                     different bacteria. The first three steps of the atrazine
                     dehalogenation pathway are...; Region: ATZ_TRZ_like;
                     cd01298"
                     /db_xref="CDD:238623"
     misc_feature    order(232288..232290,232294..232296,232792..232794,
                     232801..232803,232903..232905,233056..233058)
                     /locus_tag="PSPA7_0219"
                     /note="active site"
                     /db_xref="CDD:238623"
     misc_feature    order(232372..232374,232381..232383,232468..232473,
                     232558..232563)
                     /locus_tag="PSPA7_0219"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238623"
     gene            233557..234609
                     /locus_tag="PSPA7_0220"
                     /db_xref="GeneID:5358500"
     CDS             233557..234609
                     /locus_tag="PSPA7_0220"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01156"
                     /codon_start=1
                     /transl_table=11
                     /product="nonspecific ribonucleoside hydrolase"
                     /protein_id="YP_001345616.1"
                     /db_xref="GI:152984477"
                     /db_xref="GeneID:5358500"
                     /translation="MSRAARPRNRFCRLLLGLALLMPASLPFAAAETAAPQSPRTLII
                     DTDPGADDVIALLFAMASPKELKIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVY
                     AGAPRPLLRTPIYAADVHGSEGISGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTL
                     AMLGPETNLALALTQAPDIVKGIREIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVL
                     KSGAPITMLPLDVTHKILTSPERIARLRNLGNRAGKTVADILDAYVQYDIKYYGLEGG
                     PVHDATVVAYLLEPSLFKGKRINVQVDSREGITFGQTVADWYGGLKQPANVNWINEGD
                     AQGFFDLLAERIARLP"
     misc_feature    233680..234594
                     /locus_tag="PSPA7_0220"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    order(233695..233697,233707..233712,233785..233787,
                     233911..233913,234043..234045,234148..234150,
                     234166..234168,234172..234174,234394..234396)
                     /locus_tag="PSPA7_0220"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    order(233881..233883,234076..234078,234202..234204,
                     234463..234465,234469..234474,234481..234483)
                     /locus_tag="PSPA7_0220"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            complement(234624..235247)
                     /locus_tag="PSPA7_0221"
                     /db_xref="GeneID:5353642"
     CDS             complement(234624..235247)
                     /locus_tag="PSPA7_0221"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345617.1"
                     /db_xref="GI:152983894"
                     /db_xref="GeneID:5353642"
                     /translation="MSRSKGSSSRRSFLRLAALLLPAGALLGSLPGVRAAARPRKLYL
                     AGPDVFRADAVAHGEALKALCARYGFEGLYPLDNALPKRIADPREQAAWIYRANLGLI
                     ERADAVLANLNFFRGAEPDSGTAFEVGYATALGKPVYGYVDDAGSYAERIRRHAPALI
                     GQDPSRDRDGMALEEFGLPLNLMLAVPATLVVGDAEQALRQLAGHHG"
     misc_feature    complement(234633..235142)
                     /locus_tag="PSPA7_0221"
                     /note="Nucleoside 2-deoxyribosyltransferase [Nucleotide
                     transport and metabolism]; Region: COG3613"
                     /db_xref="CDD:226140"
     gene            complement(235372..235890)
                     /locus_tag="PSPA7_0222"
                     /db_xref="GeneID:5359341"
     CDS             complement(235372..235890)
                     /locus_tag="PSPA7_0222"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345618.1"
                     /db_xref="GI:152984082"
                     /db_xref="GeneID:5359341"
                     /translation="MTAIYLAGPDVFRPDAEAHGETLKALCAEFGFVGLYPLDHALPA
                     DIREPAAQAAWIYRANVGLIERADCVLANLDPFRGSEPDSGTAFEVGYALALGKPVYA
                     YLDDAGAYAERLARLAPEWLGERPGVDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREA
                     LLRLAEDLGRNT"
     misc_feature    complement(235381..235890)
                     /locus_tag="PSPA7_0222"
                     /note="Nucleoside 2-deoxyribosyltransferase [Nucleotide
                     transport and metabolism]; Region: COG3613"
                     /db_xref="CDD:226140"
     gene            complement(235906..236148)
                     /locus_tag="PSPA7_0223"
                     /db_xref="GeneID:5355198"
     CDS             complement(235906..236148)
                     /locus_tag="PSPA7_0223"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_001345619.1"
                     /db_xref="GI:152988506"
                     /db_xref="GeneID:5355198"
                     /translation="MRATVFHGWVCSGECRVGHRTWLRVQPARRCNYLTTRTTPLKPA
                     LLRAAPCRRGCRTVQRAIAWCMPAPPRWPTMGAGFP"
     gene            236128..237225
                     /locus_tag="PSPA7_0224"
                     /db_xref="GeneID:5355782"
     CDS             236128..237225
                     /locus_tag="PSPA7_0224"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02608"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345620.1"
                     /db_xref="GI:152989295"
                     /db_xref="GeneID:5355782"
                     /translation="MKHRRTQSRTSVLCRLAAVLGLGACALAAEAAEPLKVGFVYVGP
                     VGDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTS
                     FGYMNPTAKVARQFPRVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKI
                     GYIASFPIPEVIRDINAIRLALDKYDPQAELKVMWVNTWFDPGKEADAANALIDQGVD
                     VVFQHTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMD
                     GTWKSEDFWGGLAESMVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSG
                     KERFAAGVSATNADLASMNYYVEGIKADLPK"
     misc_feature    236233..237006
                     /locus_tag="PSPA7_0224"
                     /note="Periplasmic binding domain of the basic membrane
                     lipoprotein Med in Bacillus and its close homologs from
                     other bacteria and Archaea; Region: PBP1_BmpA_Med_like;
                     cd06353"
                     /db_xref="CDD:107348"
     misc_feature    order(236251..236256,236278..236280,236500..236502,
                     236638..236640,236722..236724,236857..236859,
                     236908..236910)
                     /locus_tag="PSPA7_0224"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107348"
     gene            237298..238260
                     /locus_tag="PSPA7_0225"
                     /db_xref="GeneID:5357531"
     CDS             237298..238260
                     /locus_tag="PSPA7_0225"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03171"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="YP_001345621.1"
                     /db_xref="GI:152987821"
                     /db_xref="GeneID:5357531"
                     /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPL
                     PAARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFD
                     MALHLPAEHPDVGAGTSFYGPNRHPDLPGWEALLEGHYADMLALARTVLRALAIALGI
                     EEDFFDRRFEQPVSVFRLIHYPPAADRQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQ
                     NRQGEWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVLSPRGVDRYSMPFFAEPHS
                     DTEIRCLPGCFDADNPPRYPPTTCGEWLTSRFAQTYAYRRGETA"
     misc_feature    237307..238245
                     /locus_tag="PSPA7_0225"
                     /note="oxidase reductase; Provisional; Region: PTZ00273"
                     /db_xref="CDD:140299"
     misc_feature    237307..237681
                     /locus_tag="PSPA7_0225"
                     /note="non-haem dioxygenase in morphine synthesis
                     N-terminal; Region: DIOX_N; pfam14226"
                     /db_xref="CDD:258418"
     misc_feature    237817..238119
                     /locus_tag="PSPA7_0225"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy; pfam03171"
                     /db_xref="CDD:251775"
     gene            238360..239310
                     /gene="add"
                     /locus_tag="PSPA7_0226"
                     /db_xref="GeneID:5356744"
     CDS             238360..239310
                     /gene="add"
                     /locus_tag="PSPA7_0226"
                     /EC_number="3.5.4.4"
                     /note="catalyzes the formation of inosine from adenosine"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="YP_001345622.1"
                     /db_xref="GI:152986046"
                     /db_xref="GeneID:5356744"
                     /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVET
                     LRKAYAFNNLQEFLDLYYAGADVLRSEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTH
                     TDRGIPFEVVLAGIRAALRDGEKQLGIRHGLILSFLRHLSEEEAQKTLDQALPFRDAF
                     VAVGLDSSEVGHPPRKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDH
                     GVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDD
                     PAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
     misc_feature    238381..239295
                     /gene="add"
                     /locus_tag="PSPA7_0226"
                     /note="Adenosine deaminase (ADA) is a monomeric zinc
                     dependent enzyme which catalyzes the irreversible
                     hydrolytic deamination of both adenosine, as well as
                     desoxyadenosine, to ammonia and inosine or desoxyinosine,
                     respectively. ADA plays an important role in...; Region:
                     ADA; cd01320"
                     /db_xref="CDD:238645"
     misc_feature    order(238399..238401,238405..238407,238939..238941,
                     238948..238950,239011..239013,239182..239187)
                     /gene="add"
                     /locus_tag="PSPA7_0226"
                     /note="active site"
                     /db_xref="CDD:238645"
     misc_feature    order(238405..238407,238411..238413,238858..238860,
                     238948..238950,239182..239187)
                     /gene="add"
                     /locus_tag="PSPA7_0226"
                     /note="purine riboside binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238645"
     gene            239448..240035
                     /locus_tag="PSPA7_0227"
                     /db_xref="GeneID:5358772"
     CDS             239448..240035
                     /locus_tag="PSPA7_0227"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF04542; match to protein family HMM PF04545; match to
                     protein family HMM PF08281; match to protein family HMM
                     TIGR02937"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-70 factor"
                     /protein_id="YP_001345623.1"
                     /db_xref="GI:152986078"
                     /db_xref="GeneID:5358772"
                     /translation="MSDRDLPSGPRPDALPADGEAARRADLLKAFLAQRQRMESLVRR
                     RVGCRATAADLVQELFLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDD
                     WLPEQRQGEPVGPEQALEAGDQWRRVEAALRDLPERTRRIFLLNRIHGRTYAEIARAM
                     QLSQSAVEKHMMRALDACKASLAGPAGEQTRSAQP"
     misc_feature    239484..240011
                     /locus_tag="PSPA7_0227"
                     /note="DNA-directed RNA polymerase specialized sigma
                     subunit, sigma24 homolog [Transcription]; Region: RpoE;
                     COG1595"
                     /db_xref="CDD:224511"
     misc_feature    239538..239735
                     /locus_tag="PSPA7_0227"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    239820..239984
                     /locus_tag="PSPA7_0227"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(239853..239855,239883..239885,239901..239906,
                     239934..239936,239940..239945,239949..239957,
                     239961..239966,239970..239972)
                     /locus_tag="PSPA7_0227"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            240032..241027
                     /locus_tag="PSPA7_0228"
                     /db_xref="GeneID:5359295"
     CDS             240032..241027
                     /locus_tag="PSPA7_0228"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF04773"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane sensor"
                     /protein_id="YP_001345624.1"
                     /db_xref="GI:152988670"
                     /db_xref="GeneID:5359295"
                     /translation="MTRTDSDAAPCDPALEQTAQAWLVRLRGTSDVAVRRAFEDWLAQ
                     RPEHAQAYARAETLWRLTEMPATRLALEEADALEIYLRPRRAPRNPRRWAYPLASVAC
                     LLAMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQ
                     RRVELLRGAVALRVKRDALPFVVEAGEGRARVLGTEFEVRRGARATRVTVLQGRVAVS
                     AGTGAGAAEEVLGAGQQVGFADGELGRPVAVDAAAALAWRQGWLSFYRQPLAEVLDEL
                     ARYYPGRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
     misc_feature    240041..241024
                     /locus_tag="PSPA7_0228"
                     /note="Fe2+-dicitrate sensor, membrane component
                     [Inorganic ion transport and metabolism / Signal
                     transduction mechanisms]; Region: FecR; COG3712"
                     /db_xref="CDD:226235"
     misc_feature    240401..240679
                     /locus_tag="PSPA7_0228"
                     /note="FecR protein; Region: FecR; pfam04773"
                     /db_xref="CDD:252792"
     gene            241176..243563
                     /locus_tag="PSPA7_0229"
                     /db_xref="GeneID:5355147"
     CDS             241176..243563
                     /locus_tag="PSPA7_0229"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00593; match to protein family HMM PF07660; match to
                     protein family HMM PF07715; match to protein family HMM
                     TIGR01783"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TonB-dependent receptor"
                     /protein_id="YP_001345625.1"
                     /db_xref="GI:152985138"
                     /db_xref="GeneID:5355147"
                     /translation="MTPFPRFALHTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLA
                     RALDAFSRASGQTLLYTAELPPQATAPALHGSLGAEEALQRLLQGSGLRARRVDERTL
                     TLEPIPASGALDLDATTVSAAAPAQGYRPAASASISRGDAPVLEIPQTISVVPAQALQ
                     DQRPRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTA
                     TADHVEVLKGPASLLYGIQDPGGVVNVVSRKPQLQQANALTLRGSAYAHGRNGGGGQL
                     DSTGPLGDSGLAYRMILDHEDEDYWRDFGKSRETLVAPSLAWYGEDTTVNLSYEHREF
                     TTPFDRGTAIDPRTNRPLDIPRSRRLDEPFNITEGRSDLTRLDLERQLDDSWKAHFGY
                     GYSRETYDDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGALQLAGMRHDLQ
                     FGMDHEKRKIFRADLLRDSRTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYF
                     QDSIHLDDRWILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSL
                     YGSYTRSFKPNSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRK
                     KNVLVNELDGAGNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLDAEVTEDPTL
                     EGKRLQNVARNTASLSAVYELGEVLGGDRLRLGGGARYVGERPGDPGNSFDLPSYTVA
                     DAFASYDTRFGGHGVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQVSTTVEF"
     misc_feature    241344..241493
                     /locus_tag="PSPA7_0229"
                     /note="Secretin and TonB N terminus short domain; Region:
                     STN; smart00965"
                     /db_xref="CDD:198033"
     misc_feature    241611..243560
                     /locus_tag="PSPA7_0229"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     misc_feature    241623..243560
                     /locus_tag="PSPA7_0229"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(241623..241652,241680..241709,241740..241748,
                     241752..241760,241782..241802,241824..241856,
                     241890..241916)
                     /locus_tag="PSPA7_0229"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(242364..242366,242445..242447)
                     /locus_tag="PSPA7_0229"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            243746..244663
                     /gene="pcaQ"
                     /locus_tag="PSPA7_0230"
                     /db_xref="GeneID:5355356"
     CDS             243746..244663
                     /gene="pcaQ"
                     /locus_tag="PSPA7_0230"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466; match to
                     protein family HMM TIGR02424"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator PcaQ"
                     /protein_id="YP_001345626.1"
                     /db_xref="GI:152988733"
                     /db_xref="GeneID:5355356"
                     /translation="MNLDNRIKFRHLACFLEVARQRSFAKAADAVAVSQPAISKTLKE
                     LEEILGARLFERSKAGVELTEAGVTFLRYAGPCVQALRDGVNTLRGHEAQVETVRVGV
                     LSTVESLVVPEVLRRLHRRHRALVVSVATGPSAYLLAQLKVGELDLVVGRMTDSPEIQ
                     GLTFEHLYSESMMLVVRPGHPLLAAPLRDPQRLADFPLVLPLAGTTIRRHADSLFVQC
                     GIPLAGQRLETLSPTLSRSYVLRSEAIWVAPRDAVRLDVGNGELVELDLGIREPGGSV
                     GLCHNAALPLPLGAQWFSVVLREVAAELH"
     misc_feature    243761..244654
                     /gene="pcaQ"
                     /locus_tag="PSPA7_0230"
                     /note="pca operon transcription factor PcaQ; Region:
                     TF_pcaQ; TIGR02424"
                     /db_xref="CDD:233862"
     misc_feature    243770..243946
                     /gene="pcaQ"
                     /locus_tag="PSPA7_0230"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    244034..244624
                     /gene="pcaQ"
                     /locus_tag="PSPA7_0230"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(244079..244084,244088..244093,244100..244102,
                     244112..244114,244118..244138,244421..244438,
                     244454..244459,244463..244468)
                     /gene="pcaQ"
                     /locus_tag="PSPA7_0230"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            244798..245517
                     /gene="pcaH"
                     /locus_tag="PSPA7_0231"
                     /db_xref="GeneID:5353799"
     CDS             244798..245517
                     /gene="pcaH"
                     /locus_tag="PSPA7_0231"
                     /EC_number="1.13.11.3"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00775; match to protein family HMM TIGR02422"
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit beta"
                     /protein_id="YP_001345627.1"
                     /db_xref="GI:152987252"
                     /db_xref="GeneID:5353799"
                     /translation="MHDAENRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSL
                     SETSGPDFSHLKLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQ
                     ANAGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGNYYFRTIKPGPYPWRNGPNDWRPA
                     HIHVSVSGPAIATRLITQMYFEGDPLIPRCPIIRTLADPEAAQSLIGRLDMSMANPMD
                     CLAYRFDIVLRGQRRTFFENA"
     misc_feature    244831..245493
                     /gene="pcaH"
                     /locus_tag="PSPA7_0231"
                     /note="Intradiol dioxygenases catalyze the critical
                     ring-cleavage step in the conversion of catecholate
                     derivatives to citric acid cycle intermediates. This
                     family contains catechol 1,2-dioxygenases and
                     protocatechuate 3,4-dioxygenases which are mononuclear...;
                     Region: intradiol_dioxygenase; cl17208"
                     /db_xref="CDD:266557"
     misc_feature    244846..245511
                     /gene="pcaH"
                     /locus_tag="PSPA7_0231"
                     /note="protocatechuate 3,4-dioxygenase, beta subunit;
                     Region: protocat_beta; TIGR02422"
                     /db_xref="CDD:131475"
     misc_feature    order(245098..245100,245122..245124,245239..245241,
                     245269..245271,245278..245280,245284..245286,
                     245368..245370)
                     /gene="pcaH"
                     /locus_tag="PSPA7_0231"
                     /note="active site"
                     /db_xref="CDD:238241"
     gene            245528..246133
                     /gene="pcaG"
                     /locus_tag="PSPA7_0232"
                     /db_xref="GeneID:5357913"
     CDS             245528..246133
                     /gene="pcaG"
                     /locus_tag="PSPA7_0232"
                     /EC_number="1.13.11.3"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00775; match to protein family HMM TIGR02423"
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit alpha"
                     /protein_id="YP_001345628.1"
                     /db_xref="GI:152987562"
                     /db_xref="GeneID:5357913"
                     /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMARED
                     APGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPEQPFNSFGRTATTFDA
                     GEWTLHTVKPGVVRNAQGVPMAPHINVALFARGINIHLQTRLYFDDEAEANAACPVLN
                     LIEQAPRRDTLVARRCEVNGQLAYRFDIRIQGDNETVFFDF"
     misc_feature    245531..246130
                     /gene="pcaG"
                     /locus_tag="PSPA7_0232"
                     /note="Protocatechuate 3,4-dioxygenase beta subunit
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: PcaH; COG3485"
                     /db_xref="CDD:226016"
     misc_feature    245543..246127
                     /gene="pcaG"
                     /locus_tag="PSPA7_0232"
                     /note="Protocatechuate 3,4-dioxygenase (3,4-PCD) , alpha
                     subunit. 3,4-PCD catalyzes the oxidative ring cleavage of
                     3,4-dihydroxybenzoate to produce
                     beta-carboxy-cis,cis-muconate. 3,4-PCDs are large
                     aggregates of 12 protomers, each composed of an alpha-
                     and...; Region: 3,4-PCD_alpha; cd03463"
                     /db_xref="CDD:239546"
     misc_feature    order(245543..245569,245576..245578,245582..245593,
                     245699..245707,245723..245725,245735..245737,
                     245741..245743,245765..245767,245771..245779,
                     245810..245812,245894..245896,245903..245905,
                     245927..245932,245939..245941,245954..245956,
                     246026..246028,246095..246100,246110..246112,
                     246119..246127)
                     /gene="pcaG"
                     /locus_tag="PSPA7_0232"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239546"
     misc_feature    order(245573..245575,245927..245929)
                     /gene="pcaG"
                     /locus_tag="PSPA7_0232"
                     /note="active site"
                     /db_xref="CDD:239546"
     gene            246346..247191
                     /gene="pcaR"
                     /locus_tag="PSPA7_0233"
                     /db_xref="GeneID:5354698"
     CDS             246346..247191
                     /gene="pcaR"
                     /locus_tag="PSPA7_0233"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01614; match to protein family HMM PF09339; match to
                     protein family HMM TIGR02431"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator PcaR"
                     /protein_id="YP_001345629.1"
                     /db_xref="GI:152989400"
                     /db_xref="GeneID:5354698"
                     /translation="MSMSEHPEHPATLAPPSVLSPARRIAAFTGDPNFMTSLARGLAV
                     IHAFQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGH
                     AYLSSTPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGS
                     RLPAYCTSMGRILLAALDDDALHGYLGEVEMQAKTSRTLYTPDTLLPCLMDIRRQGWC
                     IVDQELEVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELENRFLPLLLEASRELS
                     ARLFS"
     misc_feature    246436..247182
                     /gene="pcaR"
                     /locus_tag="PSPA7_0233"
                     /note="beta-ketoadipate pathway transcriptional
                     regulators, PcaR/PcaU/PobR family; Region: pcaR_pcaU;
                     TIGR02431"
                     /db_xref="CDD:131484"
     misc_feature    246448..246714
                     /gene="pcaR"
                     /locus_tag="PSPA7_0233"
                     /note="helix_turn_helix isocitrate lyase regulation;
                     Region: HTH_ICLR; smart00346"
                     /db_xref="CDD:214629"
     misc_feature    246793..247179
                     /gene="pcaR"
                     /locus_tag="PSPA7_0233"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            247392..248495
                     /locus_tag="PSPA7_0234"
                     /db_xref="GeneID:5356317"
     CDS             247392..248495
                     /locus_tag="PSPA7_0234"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00529; match to protein family HMM TIGR01730"
                     /codon_start=1
                     /transl_table=11
                     /product="RND efflux membrane fusion protein"
                     /protein_id="YP_001345630.1"
                     /db_xref="GI:152985181"
                     /db_xref="GeneID:5356317"
                     /translation="MALPAILCASLLAGCGAEPPTEERTRVLAQTVKLAEFASATSIT
                     GDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQRSNVENAQAAVAAQ
                     QAQSKLADLNYRRQKALLPKGYTSQSEYDQALASVRSAQSSLKAAQAQLANARDLLSY
                     TELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYESLFSHDVEGQRIS
                     VSLLGRPEVTASGKVREITPTVDERSGTLKVKVGLDAVPAEMTLGSVVNASVAAPAQH
                     SVVLPWSALSKLGSQPAVWLLDQERKARLQPVRVARYASEKVVIASGLEAGQTVVTVG
                     GQLLHPGQVVEVAQPPQPTQTTASRDALGGGQP"
     misc_feature    247470..248429
                     /locus_tag="PSPA7_0234"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    247533..>247658
                     /locus_tag="PSPA7_0234"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    247875..248180
                     /locus_tag="PSPA7_0234"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            248492..249562
                     /locus_tag="PSPA7_0235"
                     /db_xref="GeneID:5356502"
     CDS             248492..249562
                     /locus_tag="PSPA7_0235"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00529; match to protein family HMM TIGR01730"
                     /codon_start=1
                     /transl_table=11
                     /product="RND efflux membrane fusion protein"
                     /protein_id="YP_001345631.1"
                     /db_xref="GI:152984660"
                     /db_xref="GeneID:5356502"
                     /translation="MKPVVLASLFGCALLLSACGDEQPSAPPRPVLSVTVKTLKNDDL
                     GRFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGD
                     LASAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAALQQARD
                     QLSYTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPAD
                     ARFLVSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSS
                     AGSVRSVLPASVLLERDGKTQVWVIDAKQSSVALREVQVLSRDERQVVIGRGLVDGDR
                     VVRAGVNSLEPGQKIKLDEDAR"
     misc_feature    248630..249541
                     /locus_tag="PSPA7_0235"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    248681..248803
                     /locus_tag="PSPA7_0235"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    249002..249292
                     /locus_tag="PSPA7_0235"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            249559..252606
                     /locus_tag="PSPA7_0236"
                     /db_xref="GeneID:5355839"
     CDS             249559..252606
                     /locus_tag="PSPA7_0236"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00873"
                     /codon_start=1
                     /transl_table=11
                     /product="RND efflux transporter"
                     /protein_id="YP_001345632.1"
                     /db_xref="GI:152988613"
                     /db_xref="GeneID:5355839"
                     /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSF
                     AIKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDT
                     TKAGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLR
                     DYVEKVRLDIRSVKDLGKVQMIGAQDEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAV
                     TPSGVVEAGPERISVRTSGNFRSEKDLQAINLRVNERFYRLSDLASISRDFVDPPTSL
                     FRYKGEPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKA
                     VGGFTQALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSL
                     GALIIALGLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFV
                     PIGLNASSAGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKSRI
                     AERFDSLLHLAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQN
                     SSIHETRAVMDRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTK
                     DLEARERVATRLRERLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMG
                     LAGVLDGNPNIGDIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVT
                     QVRDDIYLVNVIGRAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWR
                     RDRKPTITVKASLRGEIQPTDLVARLAPEVRRFADGLPANYRIEVGGTVEESGKAEGP
                     IAKVVPLMLFLMATFLMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILG
                     ILALIGIIIRNSVILVTQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPI
                     AREVFWGPMAYAMIGGIVAATLLTLIFLPALYVAWYRIPEPGR"
     misc_feature    249574..252588
                     /locus_tag="PSPA7_0236"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     gene            252676..253743
                     /locus_tag="PSPA7_0237"
                     /db_xref="GeneID:5356954"
     CDS             252676..253743
                     /locus_tag="PSPA7_0237"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345633.1"
                     /db_xref="GI:152984664"
                     /db_xref="GeneID:5356954"
                     /translation="MGHPPRRRAGYARRCYGDEGQYRQPGAAENPTNLRICFATEVTV
                     DTLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHLQTRLLHRTTRRLALT
                     EAGERYLERCRAILADIEVAEAEASGAHIRPCGRLRVQSLMGLGQHHLVPMIARYGAL
                     FPDVVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLGSIHSVLCASPGYLQQ
                     RGVPRSVDELEQHVCLRLQDPAYPEGWLFVDEQGERTVSPQNTFMVNVAEVMAQAARA
                     GLGIALLPSYVAAPALRNGELRRVMPGHTMHERTIYALYPSRRYLDAKIRTWVDLLQQ
                     ELPQAFARDETTMQSSSYWAQ"
     misc_feature    252811..253701
                     /locus_tag="PSPA7_0237"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    252814..252993
                     /locus_tag="PSPA7_0237"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    253078..253671
                     /locus_tag="PSPA7_0237"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(253108..253110,253120..253122,253234..253236,
                     253282..253284,253288..253290,253474..253476,
                     253525..253527,253606..253608)
                     /locus_tag="PSPA7_0237"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(253111..253116,253126..253131,253135..253140,
                     253147..253149,253159..253161,253165..253185,
                     253369..253371,253456..253470,253489..253494,
                     253501..253503)
                     /locus_tag="PSPA7_0237"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            253859..254044
                     /locus_tag="PSPA7_0238"
                     /db_xref="GeneID:5355843"
     CDS             253859..254044
                     /locus_tag="PSPA7_0238"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345634.1"
                     /db_xref="GI:152989473"
                     /db_xref="GeneID:5355843"
                     /translation="MNRQILAAAVLSLFSLAFSQVGFAEESSLMTNRMVDANQQAIEH
                     QQELSASAAPAETRRDS"
     gene            254134..254277
                     /locus_tag="PSPA7_0239"
                     /db_xref="GeneID:5356794"
     CDS             254134..254277
                     /locus_tag="PSPA7_0239"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345635.1"
                     /db_xref="GI:152986818"
                     /db_xref="GeneID:5356794"
                     /translation="MRRFFCLSERPDNSCKICKGLSFDSGVFPIMAEKYNRASSMDNY
                     RRL"
     gene            254327..254446
                     /locus_tag="PSPA7_0240"
                     /db_xref="GeneID:5359729"
     CDS             254327..254446
                     /locus_tag="PSPA7_0240"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345636.1"
                     /db_xref="GI:152984623"
                     /db_xref="GeneID:5359729"
                     /translation="MKNMMPDESKRLSIEESDCVPTGFQCPVHTLERLPDAEP"
     gene            complement(254480..254608)
                     /locus_tag="PSPA7_0241"
                     /db_xref="GeneID:5356285"
     CDS             complement(254480..254608)
                     /locus_tag="PSPA7_0241"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345637.1"
                     /db_xref="GI:152986495"
                     /db_xref="GeneID:5356285"
                     /translation="MLKSGRAGKVLWCFRRRFWRRRAGDRSHGAPRRAQPEKKGRW"
     gene            254630..255964
                     /locus_tag="PSPA7_0242"
                     /db_xref="GeneID:5354515"
     CDS             254630..255964
                     /locus_tag="PSPA7_0242"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03573"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_001345638.1"
                     /db_xref="GI:152985670"
                     /db_xref="GeneID:5354515"
                     /translation="MRNLFALTPLALALFSAPGAWADEGEAEEGFIEGSSLQLLTRNY
                     YFNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTS
                     ILPITAPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLGNPVVAGGESRMLP
                     QTFRGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGG
                     TWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDEDWSLNPGAHYYKTVDSGDSLLG
                     RIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNE
                     KSWKLQYDYDFVALGMPGLTASASYSRGKLDLTRVDPDSPGYGGWYSADGNNAKHWER
                     DLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPVDVF"
     misc_feature    254714..255958
                     /locus_tag="PSPA7_0242"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            complement(255993..256790)
                     /locus_tag="PSPA7_0243"
                     /db_xref="GeneID:5358544"
     CDS             complement(255993..256790)
                     /locus_tag="PSPA7_0243"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00165; match to protein family HMM PF02311"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345639.1"
                     /db_xref="GI:152986741"
                     /db_xref="GeneID:5358544"
                     /translation="MTMNGQPAELHRPIPRLARLPRPVYARAESLRAGSWTSRHHHAW
                     VQLSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAW
                     APTRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPM
                     PREPRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRL
                     LASLNALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
     misc_feature    complement(256284..256682)
                     /locus_tag="PSPA7_0243"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    complement(255996..256358)
                     /locus_tag="PSPA7_0243"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(256149..256274)
                     /locus_tag="PSPA7_0243"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            256868..258484
                     /locus_tag="PSPA7_0244"
                     /db_xref="GeneID:5359228"
     CDS             256868..258484
                     /locus_tag="PSPA7_0244"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01019"
                     /codon_start=1
                     /transl_table=11
                     /product="putative gamma-glutamyltranspeptidase"
                     /protein_id="YP_001345640.1"
                     /db_xref="GI:152985532"
                     /db_xref="GeneID:5359228"
                     /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGG
                     NAIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAA
                     GHDRMPLYGWTPVTVPGCPAAWAELSRRFGKLPFGQLLQPAIELARDGFPVSPVIARL
                     WQGGLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESF
                     YRGELARTIAGHAEHSGGYLRLDDLAGYRAQWVEPIALNYRGYDVWEIPPSGQGLIAL
                     MTLNILKGFEFGERDCAQTWHRQLEAMKLAYVDGLHYISQPRSMRVSVEELLHEDYAA
                     SRRALIGAHALDPTPGQPKPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIA
                     LQNRGAEFSLDPDHVNCLEPGKQTFHTIIPGFLSKDGIPLGPFGVMGAYMQPQGHVQM
                     VMNLVDFGLNPQAALDAPRWQWLGGLRVGIEHAAPRALATELAQRGHQVEIAYDSTSY
                     GRGQIVLRDPASGVLCGGTEPRTDSQIAVW"
     misc_feature    256892..258481
                     /locus_tag="PSPA7_0244"
                     /note="Gamma-glutamyltransferase [Amino acid transport and
                     metabolism]; Region: Ggt; COG0405"
                     /db_xref="CDD:223482"
     gene            259148..259984
                     /locus_tag="PSPA7_0245"
                     /db_xref="GeneID:5358893"
     CDS             259148..259984
                     /locus_tag="PSPA7_0245"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345641.1"
                     /db_xref="GI:152985031"
                     /db_xref="GeneID:5358893"
                     /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNES
                     LTYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEI
                     TPRLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNF
                     YYRKPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYH
                     ANLHFNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKY
                     HF"
     misc_feature    259148..259981
                     /locus_tag="PSPA7_0245"
                     /note="Nucleoside-binding outer membrane protein [Cell
                     envelope biogenesis, outer membrane]; Region: Tsx;
                     COG3248"
                     /db_xref="CDD:225787"
     gene            260228..261634
                     /locus_tag="PSPA7_0246"
                     /db_xref="GeneID:5355870"
     CDS             260228..261634
                     /locus_tag="PSPA7_0246"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00860; match to protein family HMM TIGR00801; match to
                     protein family HMM TIGR03173"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="YP_001345642.1"
                     /db_xref="GI:152988715"
                     /db_xref="GeneID:5355870"
                     /translation="MHSEEQRPHDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPL
                     VIGSLLGLGEHLPYLISMALTVSGVGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAA
                     GMLVKQRGGGPEDILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVS
                     LIKVGITDLGGGAGAADFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVGGLALGT
                     LAAWATGVFVPRPLPELPLLSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTAN
                     CMLSRQPLDGPKYLERLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRH
                     VGIYIGGVLLALGLFPWIGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTAMDRRS
                     VLIIAASFGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGVTAILLNLLLPEERVAQA
                     PLGSPEGGALARWRKPLG"
     misc_feature    260309..261556
                     /locus_tag="PSPA7_0246"
                     /note="xanthine permease; Region: pbuX; TIGR03173"
                     /db_xref="CDD:234136"
     misc_feature    260312..261421
                     /locus_tag="PSPA7_0246"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     gene            261727..262392
                     /locus_tag="PSPA7_0247"
                     /db_xref="GeneID:5353781"
     CDS             261727..262392
                     /locus_tag="PSPA7_0247"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00440; match to protein family HMM PF08362"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345643.1"
                     /db_xref="GI:152987105"
                     /db_xref="GeneID:5353781"
                     /translation="MTLTVPAHAPDARDKPAGRIRQKNEEAILAAAEEEFARHGFKGT
                     SMNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDGTFNTLGPGDDPAEALAGY
                     IRAKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMD
                     PVDPVHLIFLLWGSTQHYADFATQIGLVTGRKRLSKQDFAAATENLVRIILKGCGLTP
                     PAA"
     misc_feature    <261838..261948
                     /locus_tag="PSPA7_0247"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    261949..262377
                     /locus_tag="PSPA7_0247"
                     /note="YcdC-like protein, C-terminal region; Region:
                     TetR_C_3; pfam08362"
                     /db_xref="CDD:203918"
     gene            262397..262987
                     /locus_tag="PSPA7_0248"
                     /db_xref="GeneID:5357230"
     CDS             262397..262987
                     /locus_tag="PSPA7_0248"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01205; match to protein family HMM PF09186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345644.1"
                     /db_xref="GI:152985137"
                     /db_xref="GeneID:5357230"
                     /translation="MPSTLQGLAEFREEIRKSRFHTIAAPVADEGAAQAFIAAHRDAS
                     AGHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVAVLVSRWFGGIKLGTG
                     GLARAYGGGAAKCLQQAPRRELVERCRVRFACAFAEHALLKARSLALGARVEEEEYRA
                     DGVGLVLELPAARFDELQALLVDLSRGQVRPQRLEA"
     misc_feature    262397..262981
                     /locus_tag="PSPA7_0248"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1739"
                     /db_xref="CDD:224653"
     misc_feature    262439..262747
                     /locus_tag="PSPA7_0248"
                     /note="Uncharacterized protein family UPF0029; Region:
                     UPF0029; pfam01205"
                     /db_xref="CDD:250442"
     misc_feature    262790..262957
                     /locus_tag="PSPA7_0248"
                     /note="Domain of unknown function (DUF1949); Region:
                     DUF1949; pfam09186"
                     /db_xref="CDD:255222"
     gene            complement(262992..263819)
                     /locus_tag="PSPA7_0249"
                     /db_xref="GeneID:5355355"
     CDS             complement(262992..263819)
                     /locus_tag="PSPA7_0249"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345645.1"
                     /db_xref="GI:152985233"
                     /db_xref="GeneID:5355355"
                     /translation="MSRERELDAWIDGLLADPRFHGHPLHEALGRLRQQSLEQLVRLE
                     RIARISDGFQSMAREQNLTLSERYHKQLRRLEKVARISDRYQQMMRDLNLALKEASIR
                     DPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQVNDTWGHDSGDRVLVE
                     IARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVRDSVRTLAVRVGTEAL
                     SVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAVPATPASPRPAPAR"
     misc_feature    complement(263046..263516)
                     /locus_tag="PSPA7_0249"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(263277..263279,263406..263408))
                     /locus_tag="PSPA7_0249"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(263274..263285,263289..263291,
                     263355..263357,263367..263369,263379..263384,
                     263391..263393))
                     /locus_tag="PSPA7_0249"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(263217..263219,263301..263303))
                     /locus_tag="PSPA7_0249"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(263826..264206)
                     /locus_tag="PSPA7_0250"
                     /db_xref="GeneID:5355336"
     CDS             complement(263826..264206)
                     /locus_tag="PSPA7_0250"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345646.1"
                     /db_xref="GI:152988865"
                     /db_xref="GeneID:5355336"
                     /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVID
                     WVERFLAEERRPLELDLRLLYLNTSSIKAMMDIFDLLEEAHQGGRAIDLRWHYDRRNE
                     RVAELAEEFREDCSFPFAIQAHDE"
     misc_feature    complement(263874..264170)
                     /locus_tag="PSPA7_0250"
                     /note="Domain of unknown function (DUF1987); Region:
                     DUF1987; pfam09345"
                     /db_xref="CDD:255302"
     gene            complement(264233..264775)
                     /locus_tag="PSPA7_0251"
                     /db_xref="GeneID:5357165"
     CDS             complement(264233..264775)
                     /locus_tag="PSPA7_0251"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345647.1"
                     /db_xref="GI:152985425"
                     /db_xref="GeneID:5357165"
                     /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHA
                     EQAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLV
                     ERDDGQRLVQSIQAIANLDKAALKAAYKEQLRRPRDSGSASGAGLGLLDIARKSSEPL
                     AASLKEQPDGRAFFSLRAVI"
     gene            complement(264784..266775)
                     /locus_tag="PSPA7_0252"
                     /db_xref="GeneID:5356487"
     CDS             complement(264784..266775)
                     /locus_tag="PSPA7_0252"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345648.1"
                     /db_xref="GI:152985393"
                     /db_xref="GeneID:5356487"
                     /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLA
                     YAKNFTLLHRQQILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRG
                     DFRDHAYFIIASGSGHYYFNDGRQAHSDAPRYTLEADDPEDAWYFNTLRNSAAYNINV
                     NVDSKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGA
                     IQAHPDRRLIAYSSAAGGASERHRVFDLLDRPEQRDALREAMRLARAKAGSVHCLWAG
                     LDGRQQLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYA
                     VERLLLRPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELE
                     DKVQERTQALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKP
                     RDVVGGDFYVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAI
                     LDETDQAMRSMLSQEQIPQALATNMDAGLVWVDRRRGQLAFAGAKISLYASDGEEVQE
                     LKGARRAIGDKRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLR
                     DHARQPLPEQAEAFVATLAEYQGEHPQRDDITILSFRFD"
     misc_feature    complement(265618..>265731)
                     /locus_tag="PSPA7_0252"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(265624..265629,265636..265641,
                     265645..265650,265657..265662,265666..265671,
                     265717..265719,265723..265728))
                     /locus_tag="PSPA7_0252"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(264787..>265620)
                     /locus_tag="PSPA7_0252"
                     /note="Serine phosphatase RsbU, regulator of sigma subunit
                     [Signal transduction mechanisms / Transcription]; Region:
                     RsbU; COG2208"
                     /db_xref="CDD:225118"
     misc_feature    complement(264787..265380)
                     /locus_tag="PSPA7_0252"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     gene            complement(267049..268098)
                     /locus_tag="PSPA7_0253"
                     /db_xref="GeneID:5355086"
     CDS             complement(267049..268098)
                     /locus_tag="PSPA7_0253"
                     /note="regulates chemotaxis by demethylation of
                     methyl-accepting chemotaxis proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis-specific methylesterase"
                     /protein_id="YP_001345649.1"
                     /db_xref="GI:152984656"
                     /db_xref="GeneID:5355086"
                     /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLI
                     RQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVD
                     FIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIAL
                     GASTGGTEALKEVLLGLPANSPGVVITQHMPPGFTRSFAERLDRLTRLAVSEARDGDR
                     ILPGHALIAPGDYHMQVQRSGADYMVRLNRQPQVNGHRPAVDVMFESLARCAGRNLLA
                     GLLTGMGRDGARGLLAIRQAGGYTLAQDEATCVIYGMPREAVELGAAEDVLPLERIAQ
                     ALLQQACRRGGGNRL"
     misc_feature    complement(267067..268098)
                     /locus_tag="PSPA7_0253"
                     /note="chemotaxis-specific methylesterase; Provisional;
                     Region: PRK00742"
                     /db_xref="CDD:234828"
     misc_feature    complement(267712..268083)
                     /locus_tag="PSPA7_0253"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(267778..267783,267790..267792,
                     267853..267855,267910..267912,267934..267936,
                     268069..268074))
                     /locus_tag="PSPA7_0253"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(267934..267936)
                     /locus_tag="PSPA7_0253"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(267910..267918,267922..267927))
                     /locus_tag="PSPA7_0253"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(267775..267783)
                     /locus_tag="PSPA7_0253"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(267085..267630)
                     /locus_tag="PSPA7_0253"
                     /note="CheB methylesterase; Region: CheB_methylest;
                     pfam01339"
                     /db_xref="CDD:250544"
     gene            complement(268118..268720)
                     /locus_tag="PSPA7_0254"
                     /db_xref="GeneID:5355835"
     CDS             complement(268118..268720)
                     /locus_tag="PSPA7_0254"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03975"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345650.1"
                     /db_xref="GI:152986313"
                     /db_xref="GeneID:5355835"
                     /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASDEDLLIVTVL
                     GSCVSVCLRDPVNGIGGMNHFMLPERGAGSDPASPSARYGGHAMELLINRMLALGARR
                     ERLQAKVFGGGSVLRQISAAIGQRNVEFTLGYLATERIPLLASDVLEAFPRKIYFFPR
                     NGRVLVKSLVELKNDTVLQRERDYRRRIDRNPDGGPIDLF"
     misc_feature    complement(268121..268720)
                     /locus_tag="PSPA7_0254"
                     /note="CheD chemotactic sensory transduction; Region:
                     CheD; cl00810"
                     /db_xref="CDD:260637"
     gene            complement(268726..269568)
                     /locus_tag="PSPA7_0255"
                     /db_xref="GeneID:5359558"
     CDS             complement(268726..269568)
                     /locus_tag="PSPA7_0255"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01739; match to protein family HMM PF03705"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemotaxis protein methyltransferase"
                     /protein_id="YP_001345651.1"
                     /db_xref="GI:152987290"
                     /db_xref="GeneID:5359558"
                     /translation="MSISTPSPVFGNHEFHYTREDFQQVRERLYRLTGISLAESKVQM
                     VYSRLSRRLRLLRLASFAEYFAHLDREPGERQLFVNALTTNLTAFFRERHHFPLLADL
                     ARRQLQRHRPLRVWSAAASTGEEPYSIAITLVEALGRFDPPVKIIASDIDTGVLDCAR
                     QGVYPLDRLEQLPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWPIAG
                     ELDAIFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRSVGQTV
                     YRPA"
     misc_feature    complement(269347..269517)
                     /locus_tag="PSPA7_0255"
                     /note="CheR methyltransferase, all-alpha domain; Region:
                     CheR_N; pfam03705"
                     /db_xref="CDD:202731"
     misc_feature    complement(268735..269514)
                     /locus_tag="PSPA7_0255"
                     /note="Methylase of chemotaxis methyl-accepting proteins
                     [Cell motility and secretion / Signal transduction
                     mechanisms]; Region: CheR; COG1352"
                     /db_xref="CDD:224271"
     misc_feature    complement(268804..269229)
                     /locus_tag="PSPA7_0255"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(268891..268893,268942..268950,
                     269116..269121,269197..269217))
                     /locus_tag="PSPA7_0255"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(269638..271677)
                     /locus_tag="PSPA7_0256"
                     /db_xref="GeneID:5354116"
     CDS             complement(269638..271677)
                     /locus_tag="PSPA7_0256"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00015"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis transducer"
                     /protein_id="YP_001345652.1"
                     /db_xref="GI:152983759"
                     /db_xref="GeneID:5354116"
                     /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERL
                     YDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDRTIPDERLEGRAARIGK
                     GINELVAAHIAVKMKVVSVVTAYGRGDFEPLMDRLPGKKAQITEAIDGVRERLRGAAE
                     ATAAQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLP
                     NFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFALDVVPVFNDANER
                     LGSAVQWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEESGKEGFFLRLAKDLNSLVDT
                     ADRGLRDVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNETAQSLSRMLGQIRDAAD
                     TINTAAGEIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANA
                     SEVATQGGTVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGE
                     QGRGFAVVAGEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAI
                     RRVTDIMSEIAAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGL
                     LNQSVAVFRLDNAPSVVQLASARPPAPRPAAPAPLARGGMARASKARKEDGWEEF"
     misc_feature    complement(270937..271161)
                     /locus_tag="PSPA7_0256"
                     /note="PAS domain; Region: PAS_8; pfam13188"
                     /db_xref="CDD:257556"
     misc_feature    complement(270805..271143)
                     /locus_tag="PSPA7_0256"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    complement(269779..270522)
                     /locus_tag="PSPA7_0256"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(269866..270441)
                     /locus_tag="PSPA7_0256"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(269866..269871,269878..269880,
                     269887..269892,269896..269901,269908..269913,
                     269917..269922,269929..269931,269938..269943,
                     269950..269952,269959..269964,269971..269976,
                     269980..269985,269992..269994,270001..270006,
                     270013..270015,270022..270027,270064..270069,
                     270076..270081,270085..270090,270097..270102,
                     270109..270111,270118..270123,270130..270132,
                     270139..270141,270151..270153,270172..270174,
                     270181..270183,270193..270195,270202..270207,
                     270214..270216,270223..270225,270232..270237,
                     270244..270249,270256..270258,270265..270270,
                     270274..270276,270286..270291,270295..270300,
                     270307..270309,270316..270321,270328..270333,
                     270340..270342,270349..270354,270361..270363,
                     270370..270375,270379..270384,270391..270393,
                     270400..270405,270412..270417))
                     /locus_tag="PSPA7_0256"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(270106..270207)
                     /locus_tag="PSPA7_0256"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(271713..272198)
                     /locus_tag="PSPA7_0257"
                     /db_xref="GeneID:5354806"
     CDS             complement(271713..272198)
                     /locus_tag="PSPA7_0257"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01584"
                     /codon_start=1
                     /transl_table=11
                     /product="putative purine-binding chemotaxis protein"
                     /protein_id="YP_001345653.1"
                     /db_xref="GI:152989162"
                     /db_xref="GeneID:5354806"
                     /translation="MNGTEASQAHGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTA
                     IANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSV
                     SDVIALGGDAIRPPPEFGASFDTKYLLGLATAGERMLILVDIERLMTSREMALVDEAA
                     A"
     misc_feature    complement(271743..272159)
                     /locus_tag="PSPA7_0257"
                     /note="CheW, a small regulator protein, unique to the
                     chemotaxis signalling in prokaryotes and archea. CheW
                     interacts with the histidine kinase CheA, most likely with
                     the related regulatory domain of CheA. CheW is proposed to
                     form signalling arrays together...; Region: CheW; cd00732"
                     /db_xref="CDD:238374"
     misc_feature    complement(order(271743..271766,271923..271925,
                     271929..271931,272013..272030))
                     /locus_tag="PSPA7_0257"
                     /note="putative CheA interaction surface; other site"
                     /db_xref="CDD:238374"
     gene            complement(272185..274062)
                     /locus_tag="PSPA7_0258"
                     /db_xref="GeneID:5358812"
     CDS             complement(272185..274062)
                     /locus_tag="PSPA7_0258"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01584; match to protein family HMM PF01627; match to
                     protein family HMM PF02518; match to protein family HMM
                     PF02895"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component sensor"
                     /protein_id="YP_001345654.1"
                     /db_xref="GI:152987678"
                     /db_xref="GeneID:5358812"
                     /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIF
                     RAAHSIKGSSGMFGFDDISAVTHELETLLDRIRCGQMRLRPDMISAFLEARDVLQRLL
                     DAHRSGHADPDVPLDETVERLRGWLRAPEEQPEDGFGFFDGAPGSPAEDAALDDAFGF
                     FDDAPGAPGEASGTEAFGLFDDSPGTPLPQERAFGLFDGAPGSPAAPGAPAQTIAATA
                     RGAAASARGDGESGSIRVSVEKIDSLINLVGELVITQAMLGQLGEQLEPSRHERLQHA
                     LAQLEHNTRDLQESVMSIRMLPINFIFSRFPRLVRDTAARLGKQVELHLHGEHTELDK
                     SVIEKLSDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKLAASHQGGSVVVEVSDDG
                     RGLSRPRILAKARERNLPVHDGMSDAEVWQLVFMPGFSTAETVTELSGRGVGMDVVKR
                     NIGAMGGRIDIDSAPGMGTRIGIRLPLTLAILDGLIVAVAAVNYVIPLTYIVESLQAR
                     SEDVRGLGGEDNAMIRVRGEYLPLFSLHELLRIGGEAPAPERGIVVILESEGRSFALQ
                     VDELVGQQQVVIKSLEQNFRRVEGIAGATIMGDGSVALILDVDALPRLAAREDTADER
                     H"
     misc_feature    complement(272197..274062)
                     /locus_tag="PSPA7_0258"
                     /note="Chemotaxis protein histidine kinase and related
                     kinases [Cell motility and secretion / Signal transduction
                     mechanisms]; Region: CheA; COG0643"
                     /db_xref="CDD:223716"
     misc_feature    complement(273754..274050)
                     /locus_tag="PSPA7_0258"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    complement(order(273853..273855,273862..273864,
                     273907..273912,273919..273921))
                     /locus_tag="PSPA7_0258"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    complement(273919..273921)
                     /locus_tag="PSPA7_0258"
                     /note="active site"
                     /db_xref="CDD:238041"
     misc_feature    complement(273181..273372)
                     /locus_tag="PSPA7_0258"
                     /note="Signal transducing histidine kinase, homodimeric
                     domain; Region: H-kinase_dim; pfam02895"
                     /db_xref="CDD:251602"
     misc_feature    complement(272638..273045)
                     /locus_tag="PSPA7_0258"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(272650..272652,272656..272661,
                     272674..272676,272680..272682,272728..272739,
                     272878..272883,272887..272889,272893..272895,
                     272899..272901,273004..273006,273013..273015,
                     273025..273027))
                     /locus_tag="PSPA7_0258"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(273013..273015)
                     /locus_tag="PSPA7_0258"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(272731..272733,272737..272739,
                     272881..272883,272887..272889))
                     /locus_tag="PSPA7_0258"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(272230..272628)
                     /locus_tag="PSPA7_0258"
                     /note="CheA regulatory domain; CheA is a histidine protein
                     kinase present in bacteria and archea. Activated by the
                     chemotaxis receptor a histidine phosphoryl group from CheA
                     is passed directly to an aspartate in the response
                     regulator CheY. This signalling...; Region: CheA_reg;
                     cd00731"
                     /db_xref="CDD:238373"
     gene            complement(274090..274455)
                     /locus_tag="PSPA7_0259"
                     /db_xref="GeneID:5357591"
     CDS             complement(274090..274455)
                     /locus_tag="PSPA7_0259"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00072"
                     /codon_start=1
                     /transl_table=11
                     /product="putative two-component response regulator"
                     /protein_id="YP_001345655.1"
                     /db_xref="GI:152987544"
                     /db_xref="GeneID:5357591"
                     /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQS
                     RNYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGW
                     LVKPFDPPKLLEVTRKVLP"
     misc_feature    complement(<274096..274443)
                     /locus_tag="PSPA7_0259"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(274096..274440)
                     /locus_tag="PSPA7_0259"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(274138..274143,274150..274152,
                     274207..274209,274273..274275,274297..274299,
                     274426..274431))
                     /locus_tag="PSPA7_0259"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(274297..274299)
                     /locus_tag="PSPA7_0259"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(274273..274281,274285..274290))
                     /locus_tag="PSPA7_0259"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(274135..274143)
                     /locus_tag="PSPA7_0259"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(274651..275826)
                     /locus_tag="PSPA7_0260"
                     /db_xref="GeneID:5353979"
     CDS             complement(274651..275826)
                     /locus_tag="PSPA7_0260"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00015"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chemotaxis transducer"
                     /protein_id="YP_001345656.1"
                     /db_xref="GI:152989445"
                     /db_xref="GeneID:5353979"
                     /translation="MRESLGVSVPSRSLALTLGLLSLPWALCAGLYAMGLDTWLALSL
                     GWLASLAAVLPLRRADRQSATTNSGSEADAALPAWDEAQRALGEETAQLDGHARQVDE
                     LLHSAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGHGQVDEGINFQDFIRTTQQTLS
                     LFVEATLETSRTSQQLVERMDHVRQKIAEILQSTQDMDAIAKQTNLLALNAAIEAARA
                     GESGRGFAVVADEVRALSTRSTEFSAAIRKHVDVVYHEIQDAKGAISQLADKDMSFAL
                     DSKQKIQGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVNAAVTALQFQDMSSQLLGQM
                     RKHHARLGAFALGLGALRTRPRQEWPARVAQEVAELRRPLPSPVSQNSVEVGEVELF"
     misc_feature    complement(274870..275511)
                     /locus_tag="PSPA7_0260"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(<275029..275337)
                     /locus_tag="PSPA7_0260"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(275119..275220)
                     /locus_tag="PSPA7_0260"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(276019..276951)
                     /locus_tag="PSPA7_0261"
                     /db_xref="GeneID:5356362"
     CDS             complement(276019..276951)
                     /locus_tag="PSPA7_0261"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345657.1"
                     /db_xref="GI:152986927"
                     /db_xref="GeneID:5356362"
                     /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNL
                     GVRLFQRSTRRLALTEAGERFLQEVGGSLAGIQTALANVSNVGNQPSGTLKVSMGLAF
                     GRDYILPLLGEFLERYPGIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPGVVARHLTP
                     GHLILLASPAYLRDKPPIRHPGDLCDFDGIRIRSPQTGRVRPWPLRRRDGEQAPIELR
                     ERMTMSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAA
                     NRLLPAKTRVFVDFVVDYFRRQELARRFCAFPSG"
     misc_feature    complement(276061..276945)
                     /locus_tag="PSPA7_0261"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(276763..276942)
                     /locus_tag="PSPA7_0261"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(276079..276678)
                     /locus_tag="PSPA7_0261"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(276142..276144,276223..276225,
                     276274..276276,276469..276471,276475..276477,
                     276517..276519,276634..276636,276646..276648))
                     /locus_tag="PSPA7_0261"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(276247..276249,276256..276261,
                     276280..276294,276388..276390,276571..276591,
                     276595..276597,276607..276609,276616..276621,
                     276625..276630,276640..276645))
                     /locus_tag="PSPA7_0261"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            277071..277823
                     /gene="fabG"
                     /locus_tag="PSPA7_0262"
                     /db_xref="GeneID:5358719"
     CDS             277071..277823
                     /gene="fabG"
                     /locus_tag="PSPA7_0262"
                     /note="catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="YP_001345658.1"
                     /db_xref="GI:152984369"
                     /db_xref="GeneID:5358719"
                     /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSS
                     ADKSRALAAELEAAGSSVLALHADSADAAALVAAVDAAAARFGRIDILVNNAAILAFG
                     SVEELPLADFERTLAINVRSVFVATQAAIRHMGDGGRVISIGSTNAERMPFAGGATYA
                     MSKSALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAETLKGLMALPRYAR
                     SEEIASFVAYLAGPEAAYITGASLSIDGGFSA"
     misc_feature    277089..277820
                     /gene="fabG"
                     /locus_tag="PSPA7_0262"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    277107..277805
                     /gene="fabG"
                     /locus_tag="PSPA7_0262"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(277119..277121,277125..277136,277191..277199,
                     277269..277277,277353..277361,277422..277424,
                     277497..277505,277545..277547,277557..277559,
                     277635..277646,277650..277655)
                     /gene="fabG"
                     /locus_tag="PSPA7_0262"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(277425..277427,277503..277505,277545..277547,
                     277557..277559)
                     /gene="fabG"
                     /locus_tag="PSPA7_0262"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(277924..279534)
                     /gene="atsA"
                     /locus_tag="PSPA7_0263"
                     /db_xref="GeneID:5356669"
     CDS             complement(277924..279534)
                     /gene="atsA"
                     /locus_tag="PSPA7_0263"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00884"
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="YP_001345659.1"
                     /db_xref="GI:152988264"
                     /db_xref="GeneID:5356669"
                     /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTD
                     FHTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELEGKPGYEGHLNERVAALPELLR
                     EAGYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGT
                     PALYVEDEHYLDTLPEGFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPR
                     EIVEKYRGRYDAGPEALRQDRLARLKELGLVEADVEAHPVLALSREWERLDEEERAKS
                     ARAMEVYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPD
                     LLGFLDQHYDNSLDNIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYP
                     RLSRQGAISHAFATVMDVTPTLLDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEA
                     AHDENTVTGWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPG
                     KLAELIEHWKRYVSETGVVEGASPFLVR"
     misc_feature    complement(277927..279534)
                     /gene="atsA"
                     /locus_tag="PSPA7_0263"
                     /note="Arylsulfatase A and related enzymes [Inorganic ion
                     transport and metabolism]; Region: AslA; COG3119"
                     /db_xref="CDD:225661"
     misc_feature    complement(278275..279522)
                     /gene="atsA"
                     /locus_tag="PSPA7_0263"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            complement(279621..280460)
                     /locus_tag="PSPA7_0264"
                     /db_xref="GeneID:5354866"
     CDS             complement(279621..280460)
                     /locus_tag="PSPA7_0264"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001345660.1"
                     /db_xref="GI:152985936"
                     /db_xref="GeneID:5354866"
                     /translation="MNALTAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGE
                     FIAIVGASGCGKSTLLRLLIGLDRDYDGEISVDGRPIAGIGGERGIVFQEHRLFPWLT
                     VQQNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLV
                     ASPRLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVM
                     EPRPGRIRRVVEVDLAHPRERGGFDFLRQREALLHELTADGEYLAPPPRRVENLPFEF
                     LAC"
     misc_feature    complement(279681..280430)
                     /locus_tag="PSPA7_0264"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    complement(279762..280421)
                     /locus_tag="PSPA7_0264"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(280290..280313)
                     /locus_tag="PSPA7_0264"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(279852..279854,279951..279956,
                     280182..280184,280287..280295,280299..280304))
                     /locus_tag="PSPA7_0264"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(280182..280193)
                     /locus_tag="PSPA7_0264"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(279999..280028)
                     /locus_tag="PSPA7_0264"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(279951..279968)
                     /locus_tag="PSPA7_0264"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(279933..279944)
                     /locus_tag="PSPA7_0264"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(279846..279866)
                     /locus_tag="PSPA7_0264"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(280457..282073)
                     /locus_tag="PSPA7_0265"
                     /db_xref="GeneID:5358121"
     CDS             complement(280457..282073)
                     /locus_tag="PSPA7_0265"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001345661.1"
                     /db_xref="GI:152988829"
                     /db_xref="GeneID:5358121"
                     /translation="MKNIDKTLSPAWSRPLPRLAPPSSAAFARRLGDSLLPWSLPLGL
                     ALLWWVASHYHWMSAQVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASG
                     AALGTWLGFSARAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVP
                     VTIHTLVGVRDAQPKLREAAAVLRLPPRLLIWRLILPAALPAFLTGLRLALAQGWTSL
                     LAVELLASSEGIGYLMVQGRQLFMLDIVFVCILVIGLVGVGMDRAIHWLDRRLLHWPQ
                     AATGEFRRRPPGRGWQRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSG
                     ALDGSLPGALFDSLKRTLGGLLLGGGLGFLGGLLLGLWHPAERLFGPTFAALRQVAIF
                     AWVPLLTAWFGLGEPAKLAFVALAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRR
                     LLRLALPGAAPSVFAGLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIG
                     AGMLLVGLTGALLNALGQRIEARATRWRHA"
     misc_feature    complement(281240..281992)
                     /locus_tag="PSPA7_0265"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(281300..281824)
                     /locus_tag="PSPA7_0265"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(281300..281302,281309..281314,
                     281321..281326,281330..281335,281342..281347,
                     281375..281380,281405..281410,281417..281428,
                     281447..281449,281456..281461,281501..281503,
                     281552..281554,281561..281566,281576..281578,
                     281582..281587,281594..281596,281600..281602,
                     281657..281659,281663..281668,281675..281704,
                     281708..281719,281744..281746,281759..281764,
                     281771..281776))
                     /locus_tag="PSPA7_0265"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(281411..281428,281657..281701))
                     /locus_tag="PSPA7_0265"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(281345..281347,281375..281377,
                     281384..281386,281408..281410,281657..281659))
                     /locus_tag="PSPA7_0265"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(281480..281482,281492..281497,
                     281513..281551))
                     /locus_tag="PSPA7_0265"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(280460..281230)
                     /locus_tag="PSPA7_0265"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(280523..>280909)
                     /locus_tag="PSPA7_0265"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(280523..280525,280532..280537,
                     280541..280546,280553..280558,280586..280591,
                     280625..280630,280637..280648,280667..280669,
                     280676..280681,280721..280723,280772..280774,
                     280781..280786,280796..280798,280802..280807,
                     280814..280816,280820..280822,280826..280831,
                     280907..280909))
                     /locus_tag="PSPA7_0265"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(280556..280558,280586..280588,
                     280595..280597,280628..280630,280844..280846,
                     280907..280909))
                     /locus_tag="PSPA7_0265"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(280700..280702,280712..280717,
                     280733..280771))
                     /locus_tag="PSPA7_0265"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(282123..282278)
                     /locus_tag="PSPA7_0266"
                     /db_xref="GeneID:5353895"
     CDS             complement(282123..282278)
                     /locus_tag="PSPA7_0266"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345662.1"
                     /db_xref="GI:152985817"
                     /db_xref="GeneID:5353895"
                     /translation="MHSGAWKINNKNSFFYNHKQYDRPHGPLRVICSQSMENILQMHL
                     PLPGAVL"
     misc_feature    complement(<282126..282236)
                     /locus_tag="PSPA7_0266"
                     /note="Uncharacterized protein family (UPF0254); Region:
                     UPF0254; cl01641"
                     /db_xref="CDD:242621"
     gene            282340..283401
                     /locus_tag="PSPA7_0267"
                     /db_xref="GeneID:5357630"
     CDS             282340..283401
                     /locus_tag="PSPA7_0267"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ester transport system substrate-binding
                     protein"
                     /protein_id="YP_001345663.1"
                     /db_xref="GI:152984871"
                     /db_xref="GeneID:5357630"
                     /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVS
                     AGNSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLG
                     DLAAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLS
                     FDNALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLST
                     RDLNGAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQA
                     SYPVVILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRRQFSAEQWAAPE
                     LLEAADRLAKGKAVAQAGQ"
     misc_feature    282340..283371
                     /locus_tag="PSPA7_0267"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    282541..283113
                     /locus_tag="PSPA7_0267"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(283427..284785)
                     /locus_tag="PSPA7_0268"
                     /db_xref="GeneID:5356600"
     CDS             complement(283427..284785)
                     /locus_tag="PSPA7_0268"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03573"
                     /codon_start=1
                     /transl_table=11
                     /product="putative porin"
                     /protein_id="YP_001345664.1"
                     /db_xref="GI:152987661"
                     /db_xref="GeneID:5356600"
                     /translation="MHDLRHAVFAGLLAGTLCEGAAATAGAGGFIEDSELQFLARTYY
                     FNRDYRDGPNNAGRNRFKPRSERNGYREETTQGLRLLFGSGYTPGNLGFGLDAHAMLG
                     LQLDSGGGRTGTGNLPVGADGHPEHRYGKLGGALKLRHGETRLKYGQTSTSAPVFAAS
                     SNRTLTGMAYGLLLEDRTFDGLLLEGGRFSAASGPGESRMHGEISTVYGRLGAYPVRL
                     DTVNFLGGQWQAGERLQLSLYAARFDDVWRQAYLGARYRQPLGEQRALLLDFNAYRTR
                     DSGQSRFGRIDTLASSLALGYEQGPQRLTLAYQHVRGEQPFDYMAFGDGRSSASMVLA
                     NSLGYSDFNGPGERSWQLRYDLELGALGLPGLSLHALHARGRAGASADSAAESIYAGL
                     YGRDGRHRETDLGLAYRVKAGPLAGLALRASQAWHRDNPTYLGGDVDETRLILDYPWT
                     IW"
     misc_feature    complement(283433..284698)
                     /locus_tag="PSPA7_0268"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            285035..285760
                     /locus_tag="PSPA7_0269"
                     /db_xref="GeneID:5357574"
     CDS             285035..285760
                     /locus_tag="PSPA7_0269"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01569"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acid phosphatase"
                     /protein_id="YP_001345665.1"
                     /db_xref="GI:152984076"
                     /db_xref="GeneID:5357574"
                     /translation="MTHNKTLRPSLLLCLALLAPLACLGETAVPYALAQPPRLADYLP
                     PPPSADSAAAVADLGAVLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGESFSKER
                     LPLARSFFNRAQENLVEVLMPAKKHFARPRPYEVTPLVNPVLPPPEGESYPSGHTMDG
                     YLKASLLSMLVPERHDAFFARAEEHAQSRVLAGVHFPSDLEGGRTAAAALVASLLAEP
                     AVAADFAAVREEVRGALGLPKLQ"
     misc_feature    285107..285730
                     /locus_tag="PSPA7_0269"
                     /note="PAP2, bacterial acid phosphatase or class A
                     non-specific acid phosphatases. These enzymes catalyze
                     phosphomonoester hydrolysis, with optimal activity in low
                     pH conditions. They are secreted into the periplasmic
                     space, and their physiological role remains...; Region:
                     PAP2_acid_phosphatase; cd03397"
                     /db_xref="CDD:239491"
     misc_feature    <285347..285646
                     /locus_tag="PSPA7_0269"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    order(285407..285409,285428..285430,285494..285502,
                     285599..285601,285617..285619,285629..285631)
                     /locus_tag="PSPA7_0269"
                     /note="active site"
                     /db_xref="CDD:239491"
     gene            complement(285785..286702)
                     /locus_tag="PSPA7_0270"
                     /db_xref="GeneID:5355192"
     CDS             complement(285785..286702)
                     /locus_tag="PSPA7_0270"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345666.1"
                     /db_xref="GI:152983885"
                     /db_xref="GeneID:5355192"
                     /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELG
                     CQLVNRGSKDLRPTPEGQVVLQHALNLVQGAANLSQEIAQLNKLDAGELRFGSGPAPA
                     QELVPDAVADFIRRHPRVQISLEVDNWEKLSRALLREELEFFVADIRDFEADPNFQTR
                     PLTPRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAAN
                     IRCENMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGII
                     SRSGYRLSAAAKAMIETLVELDQAQHAAA"
     misc_feature    complement(285791..286702)
                     /locus_tag="PSPA7_0270"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(286517..286696)
                     /locus_tag="PSPA7_0270"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(285821..286429)
                     /locus_tag="PSPA7_0270"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(286004..286009,286013..286018,
                     286034..286036,286037..286045,286325..286345,
                     286349..286351,286361..286363,286370..286375,
                     286379..286384))
                     /locus_tag="PSPA7_0270"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            287060..289432
                     /locus_tag="PSPA7_0271"
                     /db_xref="GeneID:5358800"
     CDS             287060..289432
                     /locus_tag="PSPA7_0271"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00593; match to protein family HMM PF07715"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_001345667.1"
                     /db_xref="GI:152983755"
                     /db_xref="GeneID:5358800"
                     /translation="MTRRFRFPLDRTPPSGTDYTLALLLALGGALPASAAEAPDDAAP
                     ATSVAAATPGRADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQ
                     VLPSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIE
                     QLELLRGPQGTLFGKNTTAGVLNISTRAPTFTAERTVEVSGGQDGYFQGRGTVSGPLG
                     ETLAGRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEE
                     DSSNGSMVVYGAAERFWQRAALVGASPLRDPQRKKVNVNGRQHVSVHQGGSSLEANWN
                     LASGYRLTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFD
                     YVVGAYAFRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQG
                     TWHLTERLDFTAGLRGTYEEKDAKVERFAPLGGAAVGGIGAAVRNGQLGAYDSGDLSQ
                     YNFAPSALLSLSYQFSDELLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERAND
                     AELGLKSTLFDRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLE
                     FEATALPLRGLTLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLTGQRVVGASK
                     WIANLNGEYRWRLDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSD
                     LGDGQLDTSVWLKNAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
     misc_feature    287213..289429
                     /locus_tag="PSPA7_0271"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    287297..289429
                     /locus_tag="PSPA7_0271"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            289473..290375
                     /locus_tag="PSPA7_0272"
                     /db_xref="GeneID:5354802"
     CDS             289473..290375
                     /locus_tag="PSPA7_0272"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345668.1"
                     /db_xref="GI:152986871"
                     /db_xref="GeneID:5354802"
                     /translation="MSNAAQALATPVRLDIQPVAGRIGAEIRGVTLSGELDAATVEAI
                     QAALVRHKVIFFRGQSQLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRR
                     ANSWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAV
                     HSNEYDYAGVKPSASVEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRL
                     KGLSQHDSAHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAIDDYGNQPRMV
                     RRVTLGGDVPVGIDGQRSRTIRKA"
     misc_feature    289503..290345
                     /locus_tag="PSPA7_0272"
                     /note="Probable taurine catabolism dioxygenase [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: TauD; COG2175"
                     /db_xref="CDD:225086"
     misc_feature    289509..290330
                     /locus_tag="PSPA7_0272"
                     /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
                     trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
                     carrying out three reactions in the biosynthesis of
                     clavulanic acid, an inhibitor of class A serine
                     beta-lactamases. In general, Fe(II)-2OG oxygenases...;
                     Region: CAS_like; cl00184"
                     /db_xref="CDD:260242"
     misc_feature    order(289791..289793,289797..289799,289872..289874,
                     290259..290261,290289..290291)
                     /locus_tag="PSPA7_0272"
                     /note="active site"
                     /db_xref="CDD:238154"
     misc_feature    order(289791..289793,289797..289799,290259..290261)
                     /locus_tag="PSPA7_0272"
                     /note="iron coordination sites [ion binding]; other site"
                     /db_xref="CDD:238154"
     misc_feature    order(289800..289802,289806..289808,289821..289823,
                     289974..289976,290301..290303)
                     /locus_tag="PSPA7_0272"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238154"
     gene            290442..291341
                     /locus_tag="PSPA7_0273"
                     /db_xref="GeneID:5359782"
     CDS             290442..291341
                     /locus_tag="PSPA7_0273"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345669.1"
                     /db_xref="GI:152987223"
                     /db_xref="GeneID:5359782"
                     /translation="MSQTATARPLDSDAAEAFRITPLQAPLGAEVRGLDARRPLAPEQ
                     VLALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPDIV
                     KVANTGDGELGNFALPAHIDHQWTPVPSSGSFLYALEVPSSGGETRFTNLARAYESLD
                     EATRREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRR
                     VLFLSAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHA
                     RNAFPASERRRLKRISLAGSRPF"
     misc_feature    290481..291338
                     /locus_tag="PSPA7_0273"
                     /note="Probable taurine catabolism dioxygenase [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: TauD; COG2175"
                     /db_xref="CDD:225086"
     misc_feature    290496..291314
                     /locus_tag="PSPA7_0273"
                     /note="Taurine catabolism dioxygenase TauD, TfdA family;
                     Region: TauD; pfam02668"
                     /db_xref="CDD:251459"
     misc_feature    order(290799..290801,290805..290807,290880..290882,
                     291264..291266,291297..291299)
                     /locus_tag="PSPA7_0273"
                     /note="active site"
                     /db_xref="CDD:238154"
     misc_feature    order(290799..290801,290805..290807,291264..291266)
                     /locus_tag="PSPA7_0273"
                     /note="iron coordination sites [ion binding]; other site"
                     /db_xref="CDD:238154"
     misc_feature    order(290808..290810,290814..290816,290829..290831,
                     290988..290990,291309..291311)
                     /locus_tag="PSPA7_0273"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238154"
     gene            complement(291566..291709)
                     /locus_tag="PSPA7_0274"
                     /db_xref="GeneID:5357884"
     CDS             complement(291566..291709)
                     /locus_tag="PSPA7_0274"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345670.1"
                     /db_xref="GI:152984842"
                     /db_xref="GeneID:5357884"
                     /translation="MTGYQVKPLRLRRENILPAPRNAGVINVFNTLYQQSLMPGQSSK
                     AKL"
     gene            291989..293107
                     /locus_tag="PSPA7_0275"
                     /db_xref="GeneID:5356114"
     CDS             291989..293107
                     /locus_tag="PSPA7_0275"
                     /EC_number="1.6.1.2"
                     /note="Pyridinenucleotide transhydrogenase subunit alpha;
                     Nicotinamide nucleotidetranshydrogenase subunit alpha;
                     Annotation was generated automatically without manual
                     curation; identified by match to protein family HMM
                     PF01262; match to protein family HMM PF05222"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="YP_001345671.1"
                     /db_xref="GI:152983921"
                     /db_xref="GeneID:5356114"
                     /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNAS
                     QPDSAYEVAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIA
                     RMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAG
                     TVKAARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETD
                     EERECAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATV
                     AEMKPGSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNI
                     LDFLKLTLSAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
     misc_feature    291989..293083
                     /locus_tag="PSPA7_0275"
                     /note="Rubrum transdehydrogenase NAD-binding and catalytic
                     domains; Region: Rubrum_tdh; cd05304"
                     /db_xref="CDD:240629"
     misc_feature    291992..293086
                     /locus_tag="PSPA7_0275"
                     /note="NAD/NADP transhydrogenase alpha subunit [Energy
                     production and conversion]; Region: PntA; COG3288"
                     /db_xref="CDD:225826"
     misc_feature    order(292031..292033,292205..292207,292262..292264,
                     292859..292861,292937..292939,292943..292945)
                     /locus_tag="PSPA7_0275"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(292118..292120,292358..292363,292388..292393,
                     292400..292405,292412..292417,292421..292426,
                     292430..292447,292451..292453,292457..292465,
                     292472..292474,292541..292546,292829..292834,
                     292958..292963,292973..292975,292982..292987)
                     /locus_tag="PSPA7_0275"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(292343..292348,292358..292360,292367..292369,
                     292376..292378,292499..292510,292568..292576,
                     292679..292681,292712..292714,292763..292771,
                     292790..292792,292796..292798)
                     /locus_tag="PSPA7_0275"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(292349..292354,292358..292360,292388..292390,
                     292517..292522,292541..292543,292589..292594,
                     292598..292609)
                     /locus_tag="PSPA7_0275"
                     /note="trimer interface B [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(292448..292462,292469..292471,292478..292480,
                     292547..292549,292553..292555)
                     /locus_tag="PSPA7_0275"
                     /note="trimer interface A [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     gene            293183..293491
                     /locus_tag="PSPA7_0276"
                     /db_xref="GeneID:5353619"
     CDS             293183..293491
                     /locus_tag="PSPA7_0276"
                     /EC_number="1.6.1.2"
                     /note="Pyridinenucleotide transhydrogenase subunit alpha;
                     Nicotinamide nucleotidetranshydrogenase subunit alpha;
                     Annotation was generated automatically without manual
                     curation"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="YP_001345672.1"
                     /db_xref="GI:152988509"
                     /db_xref="GeneID:5353619"
                     /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAIS
                     AIVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH
                     "
     misc_feature    293204..293464
                     /locus_tag="PSPA7_0276"
                     /note="Domain of unknown function (DUF3814); Region:
                     DUF3814; pfam12769"
                     /db_xref="CDD:257285"
     gene            293491..294927
                     /gene="pntB"
                     /locus_tag="PSPA7_0277"
                     /db_xref="GeneID:5355785"
     CDS             293491..294927
                     /gene="pntB"
                     /locus_tag="PSPA7_0277"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02233"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide transhydrogenase subunit
                     beta"
                     /protein_id="YP_001345673.1"
                     /db_xref="GI:152985746"
                     /db_xref="GeneID:5355785"
                     /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIA
                     VATTVGLVFKLGAEIATTGVGYILVGLLVGGSAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVVEPQSLGIVAQLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAV
                     ARAQHALMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINS
                     EFGQTDVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     misc_feature    293491..294921
                     /gene="pntB"
                     /locus_tag="PSPA7_0277"
                     /note="NAD/NADP transhydrogenase beta subunit [Energy
                     production and conversion]; Region: PntB; COG1282"
                     /db_xref="CDD:224201"
     gene            complement(295035..295199)
                     /locus_tag="PSPA7_0278"
                     /db_xref="GeneID:5359649"
     CDS             complement(295035..295199)
                     /locus_tag="PSPA7_0278"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345674.1"
                     /db_xref="GI:152987590"
                     /db_xref="GeneID:5359649"
                     /translation="MHDWQGGLALEVIIFVMEITSGAMGFPGFATGRVIGGLQRSDEE
                     SMPRRHEKYS"
     gene            295271..296065
                     /locus_tag="PSPA7_0279"
                     /db_xref="GeneID:5354726"
     CDS             295271..296065
                     /locus_tag="PSPA7_0279"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345675.1"
                     /db_xref="GI:152985598"
                     /db_xref="GeneID:5354726"
                     /translation="MATPQPVDARTQPWRETPGGDLVEFGRPVRQALHLVRHNPAQGR
                     VLSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPP
                     PPEPLAPVVEEPPPPVVDEKAVKPPPPKPVPKPKPKPKPQPRPEPAPKAVEPAPPAPP
                     QPAAPPAPPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSEIQ
                     VQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVGVPIDFKLN"
     misc_feature    <295814..296062
                     /locus_tag="PSPA7_0279"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    295823..296059
                     /locus_tag="PSPA7_0279"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     gene            296094..296813
                     /gene="exbB1"
                     /locus_tag="PSPA7_0280"
                     /db_xref="GeneID:5358074"
     CDS             296094..296813
                     /gene="exbB1"
                     /locus_tag="PSPA7_0280"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01618"
                     /codon_start=1
                     /transl_table=11
                     /product="transport protein ExbB"
                     /protein_id="YP_001345676.1"
                     /db_xref="GI:152985469"
                     /db_xref="GeneID:5358074"
                     /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQD
                     RQFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRL
                     ERALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLET
                     VAGPIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRV
                     IVHPSAARQAGNPSRNVKEAS"
     misc_feature    296124..296747
                     /gene="exbB1"
                     /locus_tag="PSPA7_0280"
                     /note="Biopolymer transport proteins [Intracellular
                     trafficking and secretion]; Region: TolQ; COG0811"
                     /db_xref="CDD:223881"
     gene            296815..297216
                     /gene="exbD1"
                     /locus_tag="PSPA7_0281"
                     /db_xref="GeneID:5356695"
     CDS             296815..297216
                     /gene="exbD1"
                     /locus_tag="PSPA7_0281"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02472"
                     /codon_start=1
                     /transl_table=11
                     /product="transport protein ExbD"
                     /protein_id="YP_001345677.1"
                     /db_xref="GI:152984058"
                     /db_xref="GeneID:5356695"
                     /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPI
                     NLPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQ
                     ADEGVNYGQVAKAMASIERAGITRLAVITAR"
     misc_feature    296815..297207
                     /gene="exbD1"
                     /locus_tag="PSPA7_0281"
                     /note="Biopolymer transport protein [Intracellular
                     trafficking and secretion]; Region: ExbD; COG0848"
                     /db_xref="CDD:223917"
     gene            complement(297397..297609)
                     /locus_tag="PSPA7_0282"
                     /db_xref="GeneID:5358919"
     CDS             complement(297397..297609)
                     /locus_tag="PSPA7_0282"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345678.1"
                     /db_xref="GI:152983608"
                     /db_xref="GeneID:5358919"
                     /translation="MAKKFPLHPSHPERICWGCDRYCSAQSMGCGNGASRTQHPSELF
                     GEDWAGEWEVEGTEDAKEQEAPARQA"
     misc_feature    complement(297454..297609)
                     /locus_tag="PSPA7_0282"
                     /note="Protein of unknown function (DUF3079); Region:
                     DUF3079; pfam11278"
                     /db_xref="CDD:151719"
     gene            297608..297766
                     /locus_tag="PSPA7_0283"
                     /db_xref="GeneID:5358056"
     CDS             297608..297766
                     /locus_tag="PSPA7_0283"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345679.1"
                     /db_xref="GI:152986633"
                     /db_xref="GeneID:5358056"
                     /translation="MVLSRYLMPALRYTADMRGSPGRSAENCRRLALDQRNRLIEIYR
                     IIKLLFIP"
     gene            297822..298403
                     /locus_tag="PSPA7_0284"
                     /db_xref="GeneID:5356465"
     CDS             297822..298403
                     /locus_tag="PSPA7_0284"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345680.1"
                     /db_xref="GI:152986142"
                     /db_xref="GeneID:5356465"
                     /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRTLPNASRVEQKDWIAP
                     LRADWIAGLDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDRVRGALLVAPADV
                     ERESCAEALRNFAPISREPLPFPAVLVGSDNDQACSPQRAMHLARAWGAETVILPEAG
                     HINVKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
     misc_feature    297837..298382
                     /locus_tag="PSPA7_0284"
                     /note="Predicted esterase of the alpha/beta hydrolase fold
                     [General function prediction only]; Region: COG3545"
                     /db_xref="CDD:226075"
     misc_feature    <297957..298304
                     /locus_tag="PSPA7_0284"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            complement(298411..299868)
                     /locus_tag="PSPA7_0285"
                     /db_xref="GeneID:5353506"
     CDS             complement(298411..299868)
                     /locus_tag="PSPA7_0285"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="YP_001345681.1"
                     /db_xref="GI:152987970"
                     /db_xref="GeneID:5353506"
                     /translation="MNRYPPINELVLLQAHQLAERIRLRQVSCREVMQAYLAHIERFN
                     PRVNALVSLLPAERLLAEAAARDDELAHGQYRGWMHGLPHAIKDLSLTRGIRTTLGSP
                     LYRDYVPERDGIMVERIRAAGAILIGKTNTPEFGLGSQTYNPLFGATACAYDERLSAG
                     GSSGGAAAALALHLVPVADGSDMMGSLRNPAAFNNVIGFRPSQGRVPFDDSADLFFDQ
                     LGYEGPMGRSVRDTALLLSVQAGADRRAPLSIAEPGASFAAPLERDFAGTRLGWLGDL
                     DGYLPMQDGILQLCQRALGDFRSLGCEVEEAALGFAPERLWESWRTLRHWLVAGSLGA
                     LHADPAKRTQLKPEALWEVENGLRLGADAVYRASVIRSDWYRAIGRLFERYDYLLLPS
                     AQVFPFAKEIPWPRSIEGVAMDTYHRWMEVVVPGSLSGCPVANVQAGFNAEGLPMGLQ
                     IIGPHQADFAVLQLAHAYEQASRWFERQPSPLLVG"
     misc_feature    complement(298420..299856)
                     /locus_tag="PSPA7_0285"
                     /note="amidase; Provisional; Region: PRK07486"
                     /db_xref="CDD:236028"
     gene            complement(299935..300969)
                     /locus_tag="PSPA7_0286"
                     /db_xref="GeneID:5357413"
     CDS             complement(299935..300969)
                     /locus_tag="PSPA7_0286"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01547"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_001345682.1"
                     /db_xref="GI:152985790"
                     /db_xref="GeneID:5357413"
                     /translation="MYQRIARIGLGLSIVLGGSAQAAGQLNVVSWSGYFSPQLLEKFE
                     KESGIRVTVDSYDSNETLLAKLKQGGAGYDVAIPSQQFVPILVEERLLERFDPAAEPY
                     YANLVDNLKKPAWDPEGAYSVPFIWGTTSVVLDGARYAGPADSYAVLYQPPEELRGRI
                     NMFDSVSEVVDMASLYLGIPLCSEDPKQMQRVLDLLKAQKPFVKTYSSKAGSIRENLA
                     AGEVDMSMFWGGSSLRARELKPSLKYLYPKEGVLAWVDNLVIPRGSRNPDNARRFIAF
                     LAQPENAALTQNFLKHQSPVKGVEPYLEPGLKDAPELHVPEGTRVVFSQTCGEAAIRL
                     ADRLWTNLMR"
     misc_feature    complement(299944..300960)
                     /locus_tag="PSPA7_0286"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            complement(300991..301800)
                     /locus_tag="PSPA7_0287"
                     /db_xref="GeneID:5358419"
     CDS             complement(300991..301800)
                     /locus_tag="PSPA7_0287"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001345683.1"
                     /db_xref="GI:152988371"
                     /db_xref="GeneID:5358419"
                     /translation="MNARLWRGGRRSVQDFPGFGAFSLLFYLYLYAPILVLVVYSFNA
                     NQSATVWTGFSLDWYRAAFANQALRQAAGNSLLIAVCASAAATAIATLAALGTSRGAR
                     FKGLRLSMGTIMLPLVLPEIVVGVATLALFSTLGLSLGYGNLIIAHTVFCIPFAYLPV
                     RARLDDMDLSLEQAAADLYAGPWRTLRKVTLPLLAPGIFSGLMLAFIVSLDNFVISMM
                     VAQAGTTTLPIFIFGLLRMGVTPDVNAVSTLILGVSVIFVSLSYLLGKPRA"
     misc_feature    complement(300994..301782)
                     /locus_tag="PSPA7_0287"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(301027..301497)
                     /locus_tag="PSPA7_0287"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301027..301032,301039..301044,
                     301051..301056,301060..301065,301072..301077,
                     301105..301110,301147..301152,301159..301170,
                     301189..301191,301198..301203,301243..301245,
                     301294..301296,301303..301308,301318..301320,
                     301324..301329,301336..301338,301342..301344,
                     301348..301353,301414..301416,301420..301425,
                     301432..301461,301465..301476))
                     /locus_tag="PSPA7_0287"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301153..301170,301414..301458))
                     /locus_tag="PSPA7_0287"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301075..301077,301105..301107,
                     301114..301116,301150..301152,301366..301368,
                     301414..301416))
                     /locus_tag="PSPA7_0287"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301222..301224,301234..301239,
                     301255..301293))
                     /locus_tag="PSPA7_0287"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(301797..302717)
                     /locus_tag="PSPA7_0288"
                     /db_xref="GeneID:5359075"
     CDS             complement(301797..302717)
                     /locus_tag="PSPA7_0288"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001345684.1"
                     /db_xref="GI:152986206"
                     /db_xref="GeneID:5359075"
                     /translation="MHPTSSPGAALQRRQALRSFLGVTPALVAIGLFLVLPILIVGAY
                     SLMEANPYGGVNRTFSGESYVALLFERQMDDSLAFADSYLVIALRSLGIAALTTLVTL
                     LIGFPVAVWLVMQPPRRRGLLIFLITVPFWANLLVRTYAWILLLRGSGVINNGLLGLG
                     LIDQPLPLLYSDGAVLLGLVYTYAPFVVLPIYATLEKMDMRLLEAAQDLYAGRLRTLR
                     KVVLPLARPGILAGAMLTFVPCLGAMIAPELLGGGTRMMLGNLIFRQFADARNWPLGA
                     ALSLLLMAAVMLVLSLYAWRAGRLARGAGR"
     misc_feature    complement(301917..302459)
                     /locus_tag="PSPA7_0288"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301929..301934,301971..301976,
                     301983..301994,302013..302015,302022..302027,
                     302067..302069,302118..302120,302127..302132,
                     302142..302144,302148..302153,302160..302162,
                     302166..302168,302172..302177,302289..302291,
                     302295..302300,302307..302336,302340..302351,
                     302379..302381,302394..302399,302406..302411))
                     /locus_tag="PSPA7_0288"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301977..301994,302289..302333))
                     /locus_tag="PSPA7_0288"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(301929..301931,301938..301940,
                     301974..301976,302190..302192,302289..302291))
                     /locus_tag="PSPA7_0288"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(302046..302048,302058..302063,
                     302079..302117))
                     /locus_tag="PSPA7_0288"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(302742..303854)
                     /locus_tag="PSPA7_0289"
                     /db_xref="GeneID:5355564"
     CDS             complement(302742..303854)
                     /locus_tag="PSPA7_0289"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00005; match to protein family HMM PF03459; match to
                     protein family HMM PF08402; match to protein family HMM
                     TIGR01187"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001345685.1"
                     /db_xref="GI:152985429"
                     /db_xref="GeneID:5355564"
                     /translation="MNALHSLRTHAVSIRAVRKVYGDPGSGPVALKRIDLDIRDNEFF
                     TLLGPSGCGKTTLLRMIAGFEFPTEGEILLYGENIAARPPFERPVNTVFQHYALFPHM
                     SIAENLAFGLESRPPGRSLDKAGVAERVREMLALVQMERFAERRPAQLSGGQQQRVAL
                     ARALAPQPRVLLLDEPLSALDLKLRQAMREELKAIQAKTGITFIFVTHDQEEALTMSD
                     RIAVLSEGQVQQVGPPEEIYERPGNRFVADFIGETNFIEAELLRRDGSLALYRGPGGE
                     SFEAAARDDLAPGARVSLSIRPERLGLRDAGTGDGLPCTVQSQVYLGTDLQYRVRLAD
                     GSLLTVRAPNATGRRFAAGEAARLAVARDSASVLLD"
     misc_feature    complement(302745..303830)
                     /locus_tag="PSPA7_0289"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(303102..303821)
                     /locus_tag="PSPA7_0289"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(303690..303713)
                     /locus_tag="PSPA7_0289"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(303231..303233,303330..303335,
                     303573..303575,303687..303695,303699..303704))
                     /locus_tag="PSPA7_0289"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(303573..303584)
                     /locus_tag="PSPA7_0289"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(303378..303407)
                     /locus_tag="PSPA7_0289"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(303330..303347)
                     /locus_tag="PSPA7_0289"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(303312..303323)
                     /locus_tag="PSPA7_0289"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(303225..303245)
                     /locus_tag="PSPA7_0289"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(302751..302975)
                     /locus_tag="PSPA7_0289"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(303859..304062)
                     /locus_tag="PSPA7_0290"
                     /db_xref="GeneID:5356491"
     CDS             complement(303859..304062)
                     /locus_tag="PSPA7_0290"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345686.1"
                     /db_xref="GI:152988433"
                     /db_xref="GeneID:5356491"
                     /translation="MLVFLTPYIRKLSFRQPPLFRIIRPSSRWRQPAPLFRHLAEAYF
                     PALPEQQQPSSRRAAARTKGNRR"
     gene            304084..304977
                     /locus_tag="PSPA7_0291"
                     /db_xref="GeneID:5358353"
     CDS             304084..304977
                     /locus_tag="PSPA7_0291"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_001345687.1"
                     /db_xref="GI:152983950"
                     /db_xref="GeneID:5358353"
                     /translation="MSIPRLPPLNAVRAFEAAARLGSYVAASKALHVTQPAVGRHVRL
                     LEDWLGARLFERTSRGVRLTPAGRQYYAAVSAALQQIAEAGGQLGGARWLRIMAVPAF
                     ARRWLTPRLETLCAQRPGLKIALEPNPTFDHVEERSADLGIVYGLPGQYANPRALLIR
                     PKVFPVCSPAYLAAAGPLETVERLVEHKLIHVDDGEWWNLWFSAVGVDVRVSPAVLYL
                     SNDHALARAEEGLGIALANEVLVRQELRSGALVRPLAAEAALESYQVLTPPGVPSADV
                     EWFIDWLGEALREAFPDAVTC"
     misc_feature    304084..304932
                     /locus_tag="PSPA7_0291"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    304108..304287
                     /locus_tag="PSPA7_0291"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    304363..304932
                     /locus_tag="PSPA7_0291"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(304405..304410,304414..304419,304426..304428,
                     304438..304440,304444..304464,304723..304740,
                     304756..304761,304765..304770)
                     /locus_tag="PSPA7_0291"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            305097..306761
                     /gene="mdcA"
                     /locus_tag="PSPA7_0292"
                     /db_xref="GeneID:5355981"
     CDS             305097..306761
                     /gene="mdcA"
                     /locus_tag="PSPA7_0292"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     TIGR01110"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit alpha"
                     /protein_id="YP_001345688.1"
                     /db_xref="GI:152988025"
                     /db_xref="GeneID:5355981"
                     /translation="MTTTLSPPPQWSRRRQEKQRRLERARSLADGVVLPRDRIVAALE
                     ALIAPGDRVVLEGNNQKQADFLSRSLARVDPGRLHDLHMIMPSVGRPEHLDLFELGIA
                     RKLDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLLVDLIPNVALVAGFMADRE
                     GNVYTGPSTEDSPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQ
                     PFYIEPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYG
                     ESLGLKGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRD
                     GSLRSNRMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGR
                     RHSTPAWLDMRPEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLA
                     PVMIYGDDVTHVLTEEGIAYLYKARSLEERRAMIAAVAGISPIGLRHDPRETQRMRRE
                     GLIALPEDLGIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
     misc_feature    305127..306758
                     /gene="mdcA"
                     /locus_tag="PSPA7_0292"
                     /note="malonate decarboxylase, alpha subunit; Region:
                     mdcA; TIGR01110"
                     /db_xref="CDD:233274"
     misc_feature    <305529..305744
                     /gene="mdcA"
                     /locus_tag="PSPA7_0292"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     misc_feature    <306159..306551
                     /gene="mdcA"
                     /locus_tag="PSPA7_0292"
                     /note="Acetyl-CoA hydrolase/transferase C-terminal domain;
                     Region: AcetylCoA_hyd_C; pfam13336"
                     /db_xref="CDD:257666"
     gene            306761..307642
                     /gene="mdcB"
                     /locus_tag="PSPA7_0293"
                     /db_xref="GeneID:5355656"
     CDS             306761..307642
                     /gene="mdcB"
                     /locus_tag="PSPA7_0293"
                     /EC_number="2.7.8.25"
                     /note="catalyzes the reversible formation of
                     2'-(5''-triphosphoribosyl)-3'dephospho-CoA from
                     3-dephospho-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase"
                     /protein_id="YP_001345689.1"
                     /db_xref="GI:152987915"
                     /db_xref="GeneID:5355656"
                     /translation="MNAIANLAATPRADLGECLADLAVDALIDEAELSPKPALVDRRG
                     NGAHADLHLGLMQASALSLWPCFKEMADAAQRHARIDARLRGVLGQLGREGEVAMLRT
                     TEGVNSHRGAIWALGLLVAAAALAPRRTQAGEVAARAGRIALLDDPAAASGDSHGERV
                     RRRYGVGGAREEARLGFPRAVRHGLPQLWRSRESGAGEQNARLDALLAIMSVLDDTCV
                     LHRAGRVGLAAMQEGARAVLAAGGSASLAGRRRLRELDRRLLALNASPGGAADLLAAC
                     LFLDRLPAALGGWAGSL"
     misc_feature    306767..307627
                     /gene="mdcB"
                     /locus_tag="PSPA7_0293"
                     /note="triphosphoribosyl-dephospho-CoA synthase;
                     Validated; Region: PRK01237"
                     /db_xref="CDD:234927"
     gene            307644..307943
                     /gene="mdcC"
                     /locus_tag="PSPA7_0294"
                     /db_xref="GeneID:5357092"
     CDS             307644..307943
                     /gene="mdcC"
                     /locus_tag="PSPA7_0294"
                     /note="acyl carrier protein of malonate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit delta"
                     /protein_id="YP_001345690.1"
                     /db_xref="GI:152987504"
                     /db_xref="GeneID:5357092"
                     /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIEV
                     VTSVNGSGPRWQQLFARVFAAATAPAAAIRIHDFGATPGVVRLRLEQALEEAGHD"
     misc_feature    307644..307940
                     /gene="mdcC"
                     /locus_tag="PSPA7_0294"
                     /note="malonate decarboxylase subunit delta; Provisional;
                     Region: PRK01220"
                     /db_xref="CDD:179253"
     gene            307936..308799
                     /gene="mdcD"
                     /locus_tag="PSPA7_0295"
                     /db_xref="GeneID:5353939"
     CDS             307936..308799
                     /gene="mdcD"
                     /locus_tag="PSPA7_0295"
                     /EC_number="4.1.-.-"
                     /note="The beta subunit catalyzes the decarboxylation of
                     the malonyl moiety on coenzyme A"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit beta"
                     /protein_id="YP_001345691.1"
                     /db_xref="GI:152987256"
                     /db_xref="GeneID:5353939"
                     /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSP
                     WLERQGIVPQADDGVVIARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAE
                     DNRNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCF
                     GGMSIAAGLCSHVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFAS
                     GLADAYLADDLDEIRASVLAHFAKGLPARPRCRRAGDYLRRLDDLDTAGQPDAADVRR
                     LYRGLSQGDVA"
     misc_feature    307939..308775
                     /gene="mdcD"
                     /locus_tag="PSPA7_0295"
                     /note="malonate decarboxylase subunit beta; Reviewed;
                     Region: PRK07189"
                     /db_xref="CDD:235954"
     gene            308796..309602
                     /gene="mdcE"
                     /locus_tag="PSPA7_0296"
                     /db_xref="GeneID:5354082"
     CDS             308796..309602
                     /gene="mdcE"
                     /locus_tag="PSPA7_0296"
                     /EC_number="4.1.-.-"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF06833; match to protein family HMM TIGR03134"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit gamma"
                     /protein_id="YP_001345692.1"
                     /db_xref="GI:152988758"
                     /db_xref="GeneID:5354082"
                     /translation="MSQPSASRGQAWFQALAGNLPPRAGDPASLRVADLELDGYPARV
                     LAVVPDAGNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAY
                     GRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALRD
                     PGVMVHAMGKAAAARITLRSVEELEALAAQVPPMAYDIDSYASLGLLWKTLEVEAIEA
                     PTTNDLARVRECLGAALLDILAGPRDLGGRLGAANREASARVRRLLREQW"
     misc_feature    308826..309599
                     /gene="mdcE"
                     /locus_tag="PSPA7_0296"
                     /note="Malonate decarboxylase gamma subunit (MdcE);
                     Region: MdcE; cl17835"
                     /db_xref="CDD:266870"
     gene            309618..310310
                     /gene="mdcG"
                     /locus_tag="PSPA7_0297"
                     /db_xref="GeneID:5353824"
     CDS             309618..310310
                     /gene="mdcG"
                     /locus_tag="PSPA7_0297"
                     /EC_number="2.7.7.61"
                     /note="Catalyzes the transfer of
                     2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A to the
                     apo-acyl carrier protein of malonate dehydrogenase to form
                     holo-acyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-dephospho-CoA transferase"
                     /protein_id="YP_001345693.1"
                     /db_xref="GI:152984336"
                     /db_xref="GeneID:5353824"
                     /translation="MVIANSSQRGSSRRRLAPVPMREASAPEPHDLLLGMAPEHLADD
                     APPWAREVLAAGWPVVVRRAPGDPATVAIGVRGPAREQRWAGWMPLVAITRRLRPEAL
                     CQREPPLSRDLPAWRALRQLRAPLNALGLAWGVIGGAGFELASGVAVLHPDSDLDLLL
                     RTPRPFPRDDALRLLRCFEHCPCRIDLQLQTPAGGVALREWAEGRPRVLAKGVEAPVL
                     LEDPWRVAEIGA"
     misc_feature    309690..310298
                     /gene="mdcG"
                     /locus_tag="PSPA7_0297"
                     /note="phosphoribosyl-dephospho-CoA transferase;
                     Provisional; Region: PRK01293"
                     /db_xref="CDD:234936"
     gene            310307..311239
                     /gene="mdcH"
                     /locus_tag="PSPA7_0298"
                     /db_xref="GeneID:5355341"
     CDS             310307..311239
                     /gene="mdcH"
                     /locus_tag="PSPA7_0298"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00698; match to protein family HMM TIGR03131"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit epsilon"
                     /protein_id="YP_001345694.1"
                     /db_xref="GI:152986419"
                     /db_xref="GeneID:5355341"
                     /translation="MSTLFAYPGQGAQRPGMLAALPDEPVVRDCLAQAADCLGQAPAE
                     LDSAEALRGTRAVQLCLLIAGVAASRLLEQRGHRPGLVAGLSIGAYAAAVAAGALDFD
                     DALRLVALRGELMQAAWPQGYGMSAILGLDQAQLEALIQAVRRAHPSLYLANVNGERQ
                     LVVAGSDAALAALAERARDAGASAAKRLAVSVPSHCPLLDEPAARLAEAFAGIRLRRP
                     RVPYLSGSRARLVGDPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLS
                     GLARPLFGCATPAFEGTHPDTLDALLREEERRTR"
     misc_feature    310316..311215
                     /gene="mdcH"
                     /locus_tag="PSPA7_0298"
                     /note="malonate decarboxylase, epsilon subunit; Region:
                     malonate_mdcH; TIGR03131"
                     /db_xref="CDD:132175"
     gene            311295..311699
                     /gene="madL"
                     /locus_tag="PSPA7_0299"
                     /db_xref="GeneID:5355514"
     CDS             311295..311699
                     /gene="madL"
                     /locus_tag="PSPA7_0299"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF03817; match to protein family HMM TIGR00807"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter subunit MadL"
                     /protein_id="YP_001345695.1"
                     /db_xref="GI:152986225"
                     /db_xref="GeneID:5355514"
                     /translation="MIIYGVALLSLCTLAGLFIGEVLGVLLGVPANVGGVGIAMLLLI
                     FVGSYLGKRGLLSAKTEQGVEFWSAIYIPIVVAMAAQQNVIGALSGGPAAILAGIAAV
                     AVAFALVPLLDRVGRGKPEGVPPLKPHTSAQG"
     misc_feature    311295..311660
                     /gene="madL"
                     /locus_tag="PSPA7_0299"
                     /note="Malonate transporter MadL subunit; Region: MadL;
                     cl04273"
                     /db_xref="CDD:141813"
     gene            311705..312469
                     /gene="madM"
                     /locus_tag="PSPA7_0300"
                     /db_xref="GeneID:5355583"
     CDS             311705..312469
                     /gene="madM"
                     /locus_tag="PSPA7_0300"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF03818; match to protein family HMM TIGR00808"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter subunit MadM"
                     /protein_id="YP_001345696.1"
                     /db_xref="GI:152985775"
                     /db_xref="GeneID:5355583"
                     /translation="MIESLNKVINGYGLISGFAIIGVTMALSYWLSARLTRGRLHGSA
                     IAIFLGLLLSYVGGLATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELR
                     RAGVSGVASLFLGVGSSFVAGVGVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGA
                     SSEVMALSIAAGLVKAILVMVLTPFIAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAAT
                     DPKLVPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
     misc_feature    311705..312466
                     /gene="madM"
                     /locus_tag="PSPA7_0300"
                     /note="Malonate/sodium symporter MadM subunit; Region:
                     MadM; cl04274"
                     /db_xref="CDD:141814"
     gene            complement(312580..313509)
                     /locus_tag="PSPA7_0301"
                     /db_xref="GeneID:5353566"
     CDS             complement(312580..313509)
                     /locus_tag="PSPA7_0301"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate utilization transcriptional regulator"
                     /protein_id="YP_001345697.1"
                     /db_xref="GI:152984400"
                     /db_xref="GeneID:5353566"
                     /translation="MLIDEEITLKKLETFLAFMRTGNLARAAVELGTSNVSVHRAIHS
                     LESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLG
                     ALYSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSD
                     PDCECLPLFSDDIYLAVPVDSPYAGLAEIDLSTLRDAPFVTLTQGFATHQDGTRVFRQ
                     AGFEPQIAMQVNDIFTLLSMVSSGVGYALLPKRIEAVYENRVRLIPLQPRYRLQQHIG
                     VVFLKAKERDPNLLALLAECRMHSLRLEQEATG"
     misc_feature    complement(312592..313491)
                     /locus_tag="PSPA7_0301"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(313321..313485)
                     /locus_tag="PSPA7_0301"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(312622..313218)
                     /locus_tag="PSPA7_0301"
                     /note="The C-terminal substrate-binding domian of
                     LysR-type transcriptional regulator MdcR, which involved
                     in the malonate catabolism contains the type 2 periplasmic
                     binding fold; Region: PBP2_MdcR; cd08416"
                     /db_xref="CDD:176108"
     misc_feature    complement(order(312787..312792,312796..312801,
                     312817..312834,313114..313134,313138..313140,
                     313150..313152,313159..313164,313168..313173))
                     /locus_tag="PSPA7_0301"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176108"
     gene            complement(313695..314126)
                     /locus_tag="PSPA7_0302"
                     /db_xref="GeneID:5357716"
     CDS             complement(313695..314126)
                     /locus_tag="PSPA7_0302"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345698.1"
                     /db_xref="GI:152986787"
                     /db_xref="GeneID:5357716"
                     /translation="MKKYLLPAFLFAAASLTGCTSYNISQPSAPVDGLVKTDLKADVA
                     VGAPISGQSSVNILFGFIRFGGDSQFADGVTYGGGESGLGLGFDPISSTKAAAAFKAV
                     KSADADLIVAPRYEVAVNDYFVFKKVDVKVTGSKGTIQSIR"
     gene            complement(314318..315238)
                     /locus_tag="PSPA7_0303"
                     /db_xref="GeneID:5359274"
     CDS             complement(314318..315238)
                     /locus_tag="PSPA7_0303"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345699.1"
                     /db_xref="GI:152985111"
                     /db_xref="GeneID:5359274"
                     /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEE
                     SFGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCF
                     ETVAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIE
                     TEPLMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLT
                     PNIAFSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVVMVDLAEPVSTSGLAAA
                     WLKRAQLTKPARLFVDYCREQLGKLAVRRY"
     misc_feature    complement(314327..315226)
                     /locus_tag="PSPA7_0303"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(315044..315223)
                     /locus_tag="PSPA7_0303"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(314357..314953)
                     /locus_tag="PSPA7_0303"
                     /note="The C-terminal substrate-binding domain of putative
                     LysR-type transcriptional regulator PAO1-like, a member of
                     the type 2 periplasmic binding fold protein superfamily;
                     Region: PBP2_PAO1_like; cd08412"
                     /db_xref="CDD:176104"
     misc_feature    complement(order(314504..314506,314555..314557,
                     314627..314629,314729..314731,314786..314788,
                     314915..314917,314927..314929))
                     /locus_tag="PSPA7_0303"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176104"
     misc_feature    complement(order(314471..314476,314495..314497,
                     314525..314530,314537..314542,314552..314560,
                     314564..314572,314588..314593,314816..314818,
                     314825..314827,314849..314851,314855..314857,
                     314894..314899,314903..314908,314915..314923))
                     /locus_tag="PSPA7_0303"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176104"
     gene            complement(315259..315444)
                     /locus_tag="PSPA7_0304"
                     /db_xref="GeneID:5353537"
     CDS             complement(315259..315444)
                     /locus_tag="PSPA7_0304"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345700.1"
                     /db_xref="GI:152989034"
                     /db_xref="GeneID:5353537"
                     /translation="MSSGHKKKLARRAPAKCVVLGYRAGGQLSSRPAPRRSAAACNLL
                     AARRTQQSRRARPARGG"
     gene            315589..317079
                     /locus_tag="PSPA7_0305"
                     /db_xref="GeneID:5357780"
     CDS             315589..317079
                     /locus_tag="PSPA7_0305"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00171"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="YP_001345701.1"
                     /db_xref="GI:152987744"
                     /db_xref="GeneID:5357780"
                     /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNR
                     LLARVAACDATDVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALL
                     DSLNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAREALATITRVPLGVIG
                     AVVPWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGVPEGVLNVV
                     PGLGEQAGKALGLHPEVDALVFTGSTEVGKYFMQYSAQSNLKQVWLECGGKSPNLVFA
                     DCRDLDLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLD
                     PASRAGAIVDRRQTAGILAAIERAQGEGATLLGGGRRLTINGSDNFIEPTLFGGVRPD
                     MQLAREEIFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGT
                     VSVNTVDALDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
     misc_feature    315682..317064
                     /locus_tag="PSPA7_0305"
                     /note="Escherichia coli NADP+-dependent
                     gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
                     PuuC-like; Region: ALDH_GABALDH-PuuC; cd07112"
                     /db_xref="CDD:143430"
     misc_feature    order(316072..316086,316108..316110,316153..316155,
                     316159..316164,316306..316317,316324..316326,
                     316333..316338,316381..316389,316486..316488,
                     316783..316785,316789..316791,316867..316869,
                     316981..316983)
                     /locus_tag="PSPA7_0305"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143430"
     misc_feature    order(316084..316086,316381..316383,316477..316479,
                     316486..316488)
                     /locus_tag="PSPA7_0305"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143430"
     gene            317137..318570
                     /locus_tag="PSPA7_0306"
                     /db_xref="GeneID:5355234"
     CDS             317137..318570
                     /locus_tag="PSPA7_0306"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00324"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="YP_001345702.1"
                     /db_xref="GI:152989729"
                     /db_xref="GeneID:5355234"
                     /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGT
                     AGPGFIVPLGVAYLLALSYAFSFSELALMIPRAGGLSSYTEVAIGHFPAILATFSGYV
                     VVAMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALA
                     LLMMIVLLVLGLGAVSSEHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLV
                     EETRRPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGE
                     YGQLFLVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFRQLSRRARTPWVAVLF
                     VAAITGLPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTP
                     FYPLPQLFGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLF
                     VPEPLETAGETAQGKSVALDPLQSPSA"
     misc_feature    317170..318378
                     /locus_tag="PSPA7_0306"
                     /note="amino acid transporter; Region: 2A0306; TIGR00909"
                     /db_xref="CDD:129987"
     misc_feature    <317701..>318150
                     /locus_tag="PSPA7_0306"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            318601..319983
                     /locus_tag="PSPA7_0307"
                     /db_xref="GeneID:5358268"
     CDS             318601..319983
                     /locus_tag="PSPA7_0307"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00202"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminotransferase"
                     /protein_id="YP_001345703.1"
                     /db_xref="GI:152988121"
                     /db_xref="GeneID:5358268"
                     /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGN
                     GLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVE
                     LSELLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS
                     TLGSTALGGMKFMHEMGGMLPDFAHVDEPYWYANGGELSPAEFGRRAALQLEEKILEL
                     GAENVAAFVAEPFQGAGGMIFPPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFA
                     HEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAA
                     VAIANLKALRDEGVVTRVRDETGPYLQGCLREVFGAHPLVGEVQGAGFVAALQFAEDK
                     ATRRRFANENELAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAV
                     DRTAREIGVL"
     misc_feature    318640..319950
                     /locus_tag="PSPA7_0307"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    318646..319974
                     /locus_tag="PSPA7_0307"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(318967..318975,319069..319074,319078..319080,
                     319285..319287,319384..319386,319390..319395,
                     319471..319473)
                     /locus_tag="PSPA7_0307"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(318970..318975,319069..319074,319285..319287,
                     319384..319386,319393..319395,319471..319473)
                     /locus_tag="PSPA7_0307"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    319471..319473
                     /locus_tag="PSPA7_0307"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            320147..321205
                     /locus_tag="PSPA7_0308"
                     /db_xref="GeneID:5353696"
     CDS             320147..321205
                     /locus_tag="PSPA7_0308"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345704.1"
                     /db_xref="GI:152988354"
                     /db_xref="GeneID:5353696"
                     /translation="MYKSLHQCAHVFSRLSLFGLAFAAAVQAQGQSLTVISFGGATKA
                     AQEQAYFKPFERSGGGRVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEG
                     LFERLDPARFGDPAQFVPGTFSECGVATYVWSMVLAYDSTKLARAPQSWADFWNVREF
                     PGKRGLRKGAKYTLEVALLADGVKAEDIYKVLATPEGVSRAFAKLDQLKPNIQWWEAG
                     AQPPQWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALA
                     EKFIAFASQPQTQKVFSEQIPYGPVHKGTLALLPETVQEALPTAPANLEGARAVDAGF
                     WVDHGEELEQRFNAWAAR"
     misc_feature    320147..321196
                     /locus_tag="PSPA7_0308"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            complement(321283..322164)
                     /locus_tag="PSPA7_0309"
                     /db_xref="GeneID:5359057"
     CDS             complement(321283..322164)
                     /locus_tag="PSPA7_0309"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00701"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="YP_001345705.1"
                     /db_xref="GI:152986427"
                     /db_xref="GeneID:5359057"
                     /translation="MSAPIHGIIGYTITPFAADGALDLPALGRSIERLINGGVHAIAP
                     LGSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEA
                     VMVLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDN
                     VTMVKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCTAAPNLIPTLN
                     GQLYQAVLDGDLERARALFYRQLPLLDFILRRGLPTTIKAGLALSGLEVGAPRLPVQA
                     LDTEGCRYLQGLLEELR"
     misc_feature    complement(321298..322143)
                     /locus_tag="PSPA7_0309"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(321670..321672,321757..321759,
                     322021..322029,322036..322038,322132..322134))
                     /locus_tag="PSPA7_0309"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(321544..321546,321670..321672,
                     321757..321759,322021..322029,322036..322038))
                     /locus_tag="PSPA7_0309"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(321346..321351,321802..321804,
                     321814..321816,321835..321840,321910..321915,
                     322006..322011,322024..322026))
                     /locus_tag="PSPA7_0309"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(321670..321672)
                     /locus_tag="PSPA7_0309"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(322224..323006)
                     /locus_tag="PSPA7_0310"
                     /db_xref="GeneID:5354447"
     CDS             complement(322224..323006)
                     /locus_tag="PSPA7_0310"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00596"
                     /codon_start=1
                     /transl_table=11
                     /product="class II aldolase/adducin domain-containing
                     protein"
                     /protein_id="YP_001345706.1"
                     /db_xref="GI:152986557"
                     /db_xref="GeneID:5354447"
                     /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFE
                     AGHDSGLAGQITSRGPETGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPAN
                     RFHSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVP
                     VGNEEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGE
                     IKPIPPTLAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
     misc_feature    complement(322227..323006)
                     /locus_tag="PSPA7_0310"
                     /note="class II aldolase/adducin domain protein;
                     Provisional; Region: PRK07090"
                     /db_xref="CDD:180832"
     misc_feature    complement(order(322371..322373,322392..322394,
                     322404..322406,322425..322427,322458..322460,
                     322539..322541,322584..322586,322590..322592,
                     322611..322619,322632..322637,322641..322643,
                     322779..322784,322788..322790,322860..322862,
                     322884..322886,322896..322898))
                     /locus_tag="PSPA7_0310"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(322455..322457,322641..322643,
                     322647..322649,322701..322706,322794..322799,
                     322845..322847))
                     /locus_tag="PSPA7_0310"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(322455..322457,322641..322643,
                     322647..322649))
                     /locus_tag="PSPA7_0310"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            323160..323699
                     /locus_tag="PSPA7_0311"
                     /db_xref="GeneID:5357987"
     CDS             323160..323699
                     /locus_tag="PSPA7_0311"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01381; match to protein family HMM PF07883"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345707.1"
                     /db_xref="GI:152986086"
                     /db_xref="GeneID:5357987"
                     /translation="MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAA
                     ALKLAKALNVQVEELFCEENDGLDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARAL
                     LPFIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHR
                     IRSLGETQAELLVVIHSEE"
     misc_feature    323160..>323354
                     /locus_tag="PSPA7_0311"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    323169..>323285
                     /locus_tag="PSPA7_0311"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(323175..323177,323187..323189,323262..323264)
                     /locus_tag="PSPA7_0311"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(323184..323186,323259..323261)
                     /locus_tag="PSPA7_0311"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(323205..323210,323241..323243,323250..323252,
                     323262..323267)
                     /locus_tag="PSPA7_0311"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    <323529..323684
                     /locus_tag="PSPA7_0311"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            323928..324779
                     /locus_tag="PSPA7_0312"
                     /db_xref="GeneID:5355985"
     CDS             323928..324779
                     /locus_tag="PSPA7_0312"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01144"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CoA transferase, subunit A"
                     /protein_id="YP_001345708.1"
                     /db_xref="GI:152985218"
                     /db_xref="GeneID:5355985"
                     /translation="MAEILSLREAVQRFVHDGDSVALEGFTHLIPTAAGHELIRQGKK
                     DLTLIRMTPDLVYDLLIGAGCARKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEH
                     SHADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDV
                     SVIHAQKADRKGNVLLWGILGVQKEAALAARRCIVTVEEIVDELDAPMNACVLPSWAL
                     SAVCLVPGGAHPSYAHGYYERDNRFYQDWDPIARDRDAFTAWIDDYIRGTEDFGAFQA
                     KLAEGKR"
     misc_feature    323928..324611
                     /locus_tag="PSPA7_0312"
                     /note="Acyl CoA:acetate/3-ketoacid CoA transferase, alpha
                     subunit [Lipid metabolism]; Region: AtoD; COG1788"
                     /db_xref="CDD:224702"
     gene            324776..325558
                     /locus_tag="PSPA7_0313"
                     /db_xref="GeneID:5358481"
     CDS             324776..325558
                     /locus_tag="PSPA7_0313"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01144"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CoA transferase, subunit B"
                     /protein_id="YP_001345709.1"
                     /db_xref="GI:152988423"
                     /db_xref="GeneID:5358481"
                     /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSP
                     DVVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAA
                     QVDRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAREVLIILKQSHRTFVDKLAFVT
                     SVGHGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEAT
                     GWAIRFAERVAETPAPNEVELTALRDLEARTAAAHGQKGSDE"
     misc_feature    324776..325483
                     /locus_tag="PSPA7_0313"
                     /note="Acyl CoA:acetate/3-ketoacid CoA transferase, beta
                     subunit [Lipid metabolism]; Region: AtoA; COG2057"
                     /db_xref="CDD:224968"
     gene            325555..326760
                     /gene="pcaF"
                     /locus_tag="PSPA7_0314"
                     /db_xref="GeneID:5358343"
     CDS             325555..326760
                     /gene="pcaF"
                     /locus_tag="PSPA7_0314"
                     /EC_number="2.3.1.-"
                     /note="catalyzes the thiolytic cleavage of
                     beta-ketoadipyl-CoA to succinate and acetyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoadipyl CoA thiolase"
                     /protein_id="YP_001345710.1"
                     /db_xref="GI:152986310"
                     /db_xref="GeneID:5358343"
                     /translation="MSREVFICDAVRTPIGRFGGSLAAVRADDLAAVPLKALVERNPG
                     VDWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAF
                     RAIASGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYG
                     IDPMPQTADNVADDYRVSRADQDAFALRSQQRAGRAQAAGFFAEEIVPVTIRGRKGDT
                     LVEHDEHPRPDTSLEALARLKPVNGPEKTVTAGNASGVNDGAAALILASAEAVERHRL
                     TPRARVLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACL
                     RELGVADDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQ
                     GLALAIERV"
     misc_feature    325561..326757
                     /gene="pcaF"
                     /locus_tag="PSPA7_0314"
                     /note="beta-ketoadipyl CoA thiolase; Validated; Region:
                     PRK09050"
                     /db_xref="CDD:181624"
     misc_feature    325570..326754
                     /gene="pcaF"
                     /locus_tag="PSPA7_0314"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(325624..325626,325708..325710,325753..325755,
                     325762..325764,325774..325776,325807..325818,
                     325840..325842,325861..325866,325873..325875,
                     325918..325920,326407..326409,326413..326415,
                     326419..326421,326479..326481,326722..326727)
                     /gene="pcaF"
                     /locus_tag="PSPA7_0314"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(325825..325827,326623..326625,326713..326715)
                     /gene="pcaF"
                     /locus_tag="PSPA7_0314"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            326913..328214
                     /gene="pcaT"
                     /locus_tag="PSPA7_0315"
                     /db_xref="GeneID:5359555"
     CDS             326913..328214
                     /gene="pcaT"
                     /locus_tag="PSPA7_0315"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00083; match to protein family HMM PF07690; match to
                     protein family HMM TIGR00883"
                     /codon_start=1
                     /transl_table=11
                     /product="dicarboxylic acid transporter PcaT"
                     /protein_id="YP_001345711.1"
                     /db_xref="GI:152989305"
                     /db_xref="GeneID:5359555"
                     /translation="MTAPVHQYSHEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYF
                     APAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAG
                     SLAIACMPTYASIGTLAPTLLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASF
                     QYVTLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETA
                     SKSTLERKESGTFAELFGKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAK
                     TASAVMTFALLAYMLMQPLFGMLSDRIGRKTSMLWFGALGTLCTLPILLALKTVSSPY
                     MAFFLIILALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALG
                     LKSVGMENVFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
     misc_feature    326946..328172
                     /gene="pcaT"
                     /locus_tag="PSPA7_0315"
                     /note="alpha-ketoglutarate transporter; Provisional;
                     Region: PRK10406"
                     /db_xref="CDD:182433"
     misc_feature    326970..328166
                     /gene="pcaT"
                     /locus_tag="PSPA7_0315"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(327012..327014,327021..327029,327033..327038,
                     327105..327107,327114..327119,327126..327128,
                     327138..327143,327147..327152,327312..327317,
                     327324..327329,327336..327341,327348..327350,
                     327384..327389,327396..327401,327417..327419,
                     327669..327671,327678..327683,327690..327695,
                     327702..327704,327744..327746,327756..327758,
                     327768..327770,327777..327779,327789..327791,
                     327939..327941,327948..327953,327960..327962,
                     327972..327977,327987..327989,328020..328025,
                     328032..328037,328044..328049,328056..328058)
                     /gene="pcaT"
                     /locus_tag="PSPA7_0315"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            328237..329616
                     /gene="pcaB"
                     /locus_tag="PSPA7_0316"
                     /db_xref="GeneID:5357541"
     CDS             328237..329616
                     /gene="pcaB"
                     /locus_tag="PSPA7_0316"
                     /EC_number="5.5.1.2"
                     /note="Catalyzes the cycloisomerization of
                     cis,cis-muconate"
                     /codon_start=1
                     /transl_table=11
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /protein_id="YP_001345712.1"
                     /db_xref="GI:152986680"
                     /db_xref="GeneID:5357541"
                     /translation="MSDVPANQLFDAYFTAAPMRAVFSDRGRLQGMLDFEAALARAEA
                     RVGVVPATAVAPIEAACRAELYDPLALAEAVANAGNSAIPLVKALGRQVAAGDAEAER
                     YIHLGATSQDAMDSGLVLQLRRALALLEEDLQRLAAALADQAARHADTPLAGRTWLQH
                     ATPVTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALA
                     EELGLALPEQPWHTQRDRLVEFASVLGLVAGSLGKLGRDVSLLMQTEAGEVFEPAGTG
                     RGGSSTMPHKRNPVGSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPEL
                     CCLVSGALRQAIGLLEGLEVDAGRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLV
                     EQCCRRAVEQRRGLRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHH
                     ALGFEPHPA"
     misc_feature    328249..329592
                     /gene="pcaB"
                     /locus_tag="PSPA7_0316"
                     /note="3-carboxy-cis,cis-muconate cycloisomerase;
                     Provisional; Region: PRK09053"
                     /db_xref="CDD:181627"
     misc_feature    328261..329580
                     /gene="pcaB"
                     /locus_tag="PSPA7_0316"
                     /note="prokaryotic 3-carboxy-cis,cis-muconate
                     cycloisomerase (CMLE)_like; Region: pCLME; cd01597"
                     /db_xref="CDD:176469"
     misc_feature    order(328303..328311,328318..328323,328450..328452,
                     328459..328464,328540..328545,328699..328707,
                     328711..328716,328720..328725,328741..328743,
                     328747..328749,328762..328764,328771..328773,
                     328780..328785,328792..328794,328834..328842,
                     328849..328851,328864..328869,328912..328917,
                     328930..328935,328939..328944,328948..328953,
                     328960..328962,328969..328974,328993..328995,
                     329002..329007,329020..329025,329029..329031,
                     329095..329100,329113..329115,329134..329139,
                     329152..329154,329164..329166,329179..329193,
                     329209..329214,329218..329220,329224..329226,
                     329341..329343,329542..329547,329557..329559,
                     329566..329568)
                     /gene="pcaB"
                     /locus_tag="PSPA7_0316"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176469"
     misc_feature    order(328474..328479,328561..328569,328702..328707,
                     328831..328833,329089..329094,329098..329100,
                     329191..329193)
                     /gene="pcaB"
                     /locus_tag="PSPA7_0316"
                     /note="active site"
                     /db_xref="CDD:176469"
     gene            329631..330422
                     /gene="pcaD"
                     /locus_tag="PSPA7_0317"
                     /db_xref="GeneID:5355915"
     CDS             329631..330422
                     /gene="pcaD"
                     /locus_tag="PSPA7_0317"
                     /EC_number="3.1.1.24"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00561; match to protein family HMM TIGR02427"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoadipate enol-lactone hydrolase"
                     /protein_id="YP_001345713.1"
                     /db_xref="GI:152988981"
                     /db_xref="GeneID:5355915"
                     /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPAL
                     TAHFRVLRYDTRGHGASLVTPGPYTIGQLGADVVALLDALDLPRVHFCGLSMGGLIGQ
                     WLGIHAGARIGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASLARWFTAG
                     FAEREPAQAERIVAMLAATSPQGYAANCAAVRDADFREQLELVQAPTLVVAGSHDAVT
                     TPDDARFMQARIADAQLVVFAAAHLSNVEAGDAFSRRLVDFLLSA"
     misc_feature    329661..330410
                     /gene="pcaD"
                     /locus_tag="PSPA7_0317"
                     /note="3-oxoadipate enol-lactonase; Region: protocat_pcaD;
                     TIGR02427"
                     /db_xref="CDD:131480"
     misc_feature    329661..>329993
                     /gene="pcaD"
                     /locus_tag="PSPA7_0317"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    <330087..330335
                     /gene="pcaD"
                     /locus_tag="PSPA7_0317"
                     /note="homoserine O-acetyltransferase; Provisional;
                     Region: metX; cl17114"
                     /db_xref="CDD:247710"
     gene            330433..330834
                     /gene="pcaC"
                     /locus_tag="PSPA7_0318"
                     /db_xref="GeneID:5357016"
     CDS             330433..330834
                     /gene="pcaC"
                     /locus_tag="PSPA7_0318"
                     /EC_number="4.1.1.44"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF02627; match to protein family HMM TIGR02425"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-carboxymuconolactone decarboxylase"
                     /protein_id="YP_001345714.1"
                     /db_xref="GI:152986013"
                     /db_xref="GeneID:5357016"
                     /translation="MDEKQRYEAGMQVRRAVLGDAHVDRSLASLTPFNEEFQEMITRH
                     AWGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSA
                     IYCGIPAANATFHLAESVWDELGVESQQETR"
     misc_feature    330439..330807
                     /gene="pcaC"
                     /locus_tag="PSPA7_0318"
                     /note="4-carboxymuconolactone decarboxylase; Region:
                     decarb_PcaC; TIGR02425"
                     /db_xref="CDD:131478"
     gene            330985..331926
                     /locus_tag="PSPA7_0319"
                     /db_xref="GeneID:5358114"
     CDS             330985..331926
                     /locus_tag="PSPA7_0319"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345715.1"
                     /db_xref="GI:152986017"
                     /db_xref="GeneID:5358114"
                     /translation="MSRKLHIHAPAIHYFDMVRRCDSIREAARRLNVASSAVNRQILK
                     LEDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLCTGHVEIA
                     TIEAVTSDLLPCVLKAMRERYPDVTVGVTLLGSQAIPDAVASGAVDLGLAFALPRSAD
                     LQQISVGHFRLGAIVAPQHPLARRDAITFADCAGHGLIMAKSELSIHHLLAPLQRRLR
                     EPCRAALESSSLELSRQLARRGLGVAFQTRLGIEADIASGELRFLPLQDNGGIHSDLG
                     LYVRTGRYLPVAVDALARQIAEEVRLREREEARLNDA"
     misc_feature    331015..331872
                     /locus_tag="PSPA7_0319"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    331015..331188
                     /locus_tag="PSPA7_0319"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    331276..331872
                     /locus_tag="PSPA7_0319"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(331321..331326,331330..331335,331342..331344,
                     331354..331356,331360..331380,331654..331671,
                     331687..331692,331696..331701)
                     /locus_tag="PSPA7_0319"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            332106..332939
                     /locus_tag="PSPA7_0320"
                     /db_xref="GeneID:5355432"
     CDS             332106..332939
                     /locus_tag="PSPA7_0320"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345716.1"
                     /db_xref="GI:152988021"
                     /db_xref="GeneID:5355432"
                     /translation="MKKMMRGAAALVALVGAGESMALEWMSNSVGFRYGQQFTNPNNP
                     DKFAKRIYSFTHADGYRYGSNFFNLDVFLSDSRDPRKGTDHGGSEVYAVYRHQLYASR
                     VFDRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYR
                     EKNHFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGEKGEDYNDKD
                     TAAETLVRAALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFT
                     F"
     gene            complement(333059..334405)
                     /gene="pcaK"
                     /locus_tag="PSPA7_0321"
                     /db_xref="GeneID:5355652"
     CDS             complement(333059..334405)
                     /gene="pcaK"
                     /locus_tag="PSPA7_0321"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00083; match to protein family HMM PF07690; match to
                     protein family HMM TIGR00895"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate transporter PcaK"
                     /protein_id="YP_001345717.1"
                     /db_xref="GI:152985113"
                     /db_xref="GeneID:5355652"
                     /translation="MNSSSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLD
                     TAAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVF
                     LFGLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFC
                     GFNLGMACGGFVSAKLIPLFGWHSLLLLGGLLPLALALVLLFRLPESARYLVVRNRGS
                     ERVRRALAPIAPAQVALAQGFHVPEQHTVQARNVFAVIFSGTYSAGTLLLWLTYFMGL
                     VIVYLLTSWLPTLMRDSGASLEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLF
                     YLLAGVFAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSW
                     MLGIGRFGAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
     misc_feature    complement(333170..334369)
                     /gene="pcaK"
                     /locus_tag="PSPA7_0321"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    complement(333158..334315)
                     /gene="pcaK"
                     /locus_tag="PSPA7_0321"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(333203..333205,333212..333217,
                     333224..333229,333236..333241,333272..333274,
                     333281..333286,333296..333298,333305..333310,
                     333317..333319,333461..333463,333473..333475,
                     333482..333484,333494..333496,333506..333508,
                     333545..333547,333554..333559,333566..333571,
                     333578..333580,333908..333910,333926..333931,
                     333938..333943,333977..333979,333986..333991,
                     333998..334003,334010..334015,334151..334156,
                     334160..334165,334175..334177,334184..334189,
                     334196..334198,334247..334252,334256..334264,
                     334271..334273))
                     /gene="pcaK"
                     /locus_tag="PSPA7_0321"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            334436..334597
                     /locus_tag="PSPA7_0322"
                     /db_xref="GeneID:5353539"
     CDS             334436..334597
                     /locus_tag="PSPA7_0322"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345718.1"
                     /db_xref="GI:152987705"
                     /db_xref="GeneID:5353539"
                     /translation="MGRSRTRTQVPAVERGVCSGMSEFPCCSCMGSQAARARNTLGRE
                     GGARNPVID"
     gene            334694..335572
                     /locus_tag="PSPA7_0323"
                     /db_xref="GeneID:5357618"
     CDS             334694..335572
                     /locus_tag="PSPA7_0323"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00892"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345719.1"
                     /db_xref="GI:152988358"
                     /db_xref="GeneID:5357618"
                     /translation="MNATSSALPGNDQPLRGIFLICAAVFLFASHDGLSKFLSGFYPI
                     VMVVWARYLVHTLLMVVVFVPRNGLAVIRTRRPFMQLARALCLIGTSLFFTTGLRYLP
                     LAEATAVNFLAPLLVTALSVPLLKEKVSPGQWLAVLTGFVGVLFIVRPGGALFTPAAL
                     FPLGSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLM
                     MIALGGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHAPDAWALLGI
                     LVICASGLLVAWRRGR"
     misc_feature    334724..335569
                     /locus_tag="PSPA7_0323"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    334769..335140
                     /locus_tag="PSPA7_0323"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(335600..336850)
                     /locus_tag="PSPA7_0324"
                     /db_xref="GeneID:5359061"
     CDS             complement(335600..336850)
                     /locus_tag="PSPA7_0324"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03573"
                     /codon_start=1
                     /transl_table=11
                     /product="putative porin"
                     /protein_id="YP_001345720.1"
                     /db_xref="GI:152987751"
                     /db_xref="GeneID:5359061"
                     /translation="MSHPSLVRALCASLCLGAGLPVHAERGFLEDAKVSLTARNFYLN
                     RDFVGHASQDKAEEWTQSFILDARSGFTEGSVGFGLDVLGLYSLKLDGGKGTAGTQLL
                     PTHGDGRPADDFGRLAVAGRLRVSNTELKLGEWMPVLPILRSDDGRSLPQTFRGGQLS
                     ASEIAGLTLHAGQLRGNSPRNDASMQDMSLFGRPAATSDRFDFVGGEYRFNGERTLLG
                     LWHAELKDIYRQQYLQLQHSQPLGGWLLGANLGWFRGRDDGSARAGELDNRTVSALFS
                     VRHGLHALYLGLQKVGGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFV
                     GLGLPGLTFMTRYLHGSHVRLAGVTDDGSEWGRESELGYTVQGGAFKRLNLRWRNSSQ
                     RRDWGSNTRFDENRLIVSYPLGLF"
     misc_feature    complement(335612..336772)
                     /locus_tag="PSPA7_0324"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            complement(336916..338244)
                     /locus_tag="PSPA7_0325"
                     /db_xref="GeneID:5355241"
     CDS             complement(336916..338244)
                     /locus_tag="PSPA7_0325"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="YP_001345721.1"
                     /db_xref="GI:152987494"
                     /db_xref="GeneID:5355241"
                     /translation="MIHSSSSRLPAADTAARATRGGRMRSALAVGHTRWGMLALVFFA
                     TTLNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDRVGVKR
                     AFFLAVLLWSLTTGLHGLATSAAGFMLCRFVLGLTEAANYPACVKTTRLWFPAGERAV
                     ATGIFNAGTNVGAMVTPALLPLVLSVWGWQAAFLCMSALGLVWLAFWWRNYHNPEEHP
                     RVRRSELDYIQQQEEPPVTRVPFSRILRRRGTWAFALAYSITAPVFWFYLYWLPPFLN
                     QQYGLGISVTQMGIPLILIWLTADFGSIGGGILSSWLVGRGMPAVRARLLSMLLFACT
                     IVGVVFAANADGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPRHLMSTVFGFGGMCA
                     ALGGMFMTQLVGGVLTATNNNYAVLFCMIPAMYFIALAWLYFMAPRRIEA"
     misc_feature    complement(336943..338133)
                     /locus_tag="PSPA7_0325"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(336940..338115)
                     /locus_tag="PSPA7_0325"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(337057..337059,337066..337071,
                     337078..337083,337090..337095,337126..337128,
                     337135..337140,337150..337152,337159..337164,
                     337171..337173,337336..337338,337348..337350,
                     337357..337359,337369..337371,337381..337383,
                     337429..337431,337438..337443,337450..337455,
                     337462..337464,337726..337728,337744..337749,
                     337756..337761,337795..337797,337804..337809,
                     337816..337821,337828..337833,337969..337974,
                     337978..337983,337993..337995,338002..338007,
                     338014..338016,338065..338070,338074..338082,
                     338089..338091))
                     /locus_tag="PSPA7_0325"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            338236..338394
                     /locus_tag="PSPA7_0326"
                     /db_xref="GeneID:5353929"
     CDS             338236..338394
                     /locus_tag="PSPA7_0326"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345722.1"
                     /db_xref="GI:152986848"
                     /db_xref="GeneID:5353929"
                     /translation="MDHRWGHPFDGRCASARPGFVVLVSHAGVSVAGALGPGGRPGDG
                     AAEQGRSR"
     gene            338772..340676
                     /locus_tag="PSPA7_0327"
                     /db_xref="GeneID:5359759"
     CDS             338772..340676
                     /locus_tag="PSPA7_0327"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345723.1"
                     /db_xref="GI:152987263"
                     /db_xref="GeneID:5359759"
                     /translation="MQRSIATVSLSGTLPEKLEAIAAAGFDGVEVFENDLLHYDGSPR
                     DVRRLCADLGLDILLFQPFRDFEGCRRERLARNLERAERKFDLMQELGTDLVLVCSNV
                     AADALGEPALLVDDLRLLAERAAARGLRIGYEALAWGRQVSTWEQAWELVRRADQPNL
                     GLILDSFHTLSLNGDARGIAGLPAEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGF
                     DLAGFLAPIVASGYRGPLSLEVFNDGFRAAPTRANAADGLRALLYLEEKTRERLRREA
                     PQVAVDGLFAPPPASVCDGIEFLEFAVDEALRARLGQWLRQLGFARVGQHRSKNVSLL
                     RQGGINLVLNAEPYSFAHGFFEAHGPSLCATALRVRDAGQALERARRYGGQPYRGLVG
                     PNEREIPAVRALDGSLLYLVEQEGGGRDIYQTDFEMTGEATPGLGLRRIDHVAMALPA
                     EGLDSWVLFYKSLFDFSADDEVVLPDPYGLVTSRAVRSRCGQVRLPLNISEDRNTAIA
                     RALSSYRGSGVHHIAFDCADIFAAVAQAKEAGLTLLEIPLNYYDDLAARFDFTEEFLS
                     ELAYYNVLYDRDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVAVRLAAMAQ
                     ARRGVRRVKL"
     misc_feature    338772..339581
                     /locus_tag="PSPA7_0327"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    338823..339425
                     /locus_tag="PSPA7_0327"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     misc_feature    339591..340673
                     /locus_tag="PSPA7_0327"
                     /note="4-hydroxyphenylpyruvate dioxygenase and related
                     hemolysins [Amino acid transport and metabolism / General
                     function prediction only]; Region: COG3185"
                     /db_xref="CDD:225726"
     misc_feature    339657..340052
                     /locus_tag="PSPA7_0327"
                     /note="N-terminal domain of 4-hydroxyphenylpyruvate
                     dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS);
                     Region: HPPD_N_like; cd08342"
                     /db_xref="CDD:176690"
     misc_feature    order(339690..339698,339708..339713,339759..339761,
                     339765..339767,339849..339851)
                     /locus_tag="PSPA7_0327"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176690"
     misc_feature    340083..340643
                     /locus_tag="PSPA7_0327"
                     /note="C-terminal domain of 4-hydroxyphenylpyruvate
                     dioxygenase (HppD) and hydroxymandelate Synthase (HmaS);
                     Region: HPPD_C_like; cd07250"
                     /db_xref="CDD:176673"
     misc_feature    order(340098..340100,340218..340220,340257..340259,
                     340263..340265,340287..340289,340332..340334,
                     340533..340535,340566..340568,340599..340601,
                     340611..340616)
                     /locus_tag="PSPA7_0327"
                     /note="active site"
                     /db_xref="CDD:176673"
     misc_feature    order(340098..340100,340332..340334,340566..340568)
                     /locus_tag="PSPA7_0327"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:176673"
     gene            340769..341437
                     /locus_tag="PSPA7_0328"
                     /db_xref="GeneID:5354089"
     CDS             340769..341437
                     /locus_tag="PSPA7_0328"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345724.1"
                     /db_xref="GI:152989587"
                     /db_xref="GeneID:5354089"
                     /translation="MSNPDPAAVEAPAPRGKGRKNNPEKTRQDILRAAADEFVAQGLS
                     GARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIENSLQLGELPPVKAM
                     RKLVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNGSIVQGIAEILRRGEA
                     EGVFRPGLVALDVHLLISSFCFYRVSNRYTVSRIFRTDLHDAGVRQRHLEMICEAVLR
                     YLRA"
     misc_feature    340817..341356
                     /locus_tag="PSPA7_0328"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    340856..340996
                     /locus_tag="PSPA7_0328"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(341502..342338)
                     /locus_tag="PSPA7_0329"
                     /db_xref="GeneID:5355042"
     CDS             complement(341502..342338)
                     /locus_tag="PSPA7_0329"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_001345725.1"
                     /db_xref="GI:152988387"
                     /db_xref="GeneID:5355042"
                     /translation="MLAGLIGAGIQASRTPALHEHEGDAQGIRYLYRLIDLDLLGKSA
                     DDLESLLAAASDLGFTGLNVTFPCKQAIIPLLDELSAEARGIGAVNTVVLRDGRRIGH
                     NTDCLGFAEGFRRGLADAPRQRVVQLGAGGAGAAVAHALLAEGVERLILFDVETARAQ
                     ALADNLNAHFGAARTLAGNDLASALGAAQGLVNTTPVGMAKLPGMPLPAELLRSELWV
                     AEVIYFPLETELLRQARALGCRTLDGGSMAVFQAVKAFELFSGVKADAARMQAHFASL
                     GD"
     misc_feature    complement(341505..342338)
                     /locus_tag="PSPA7_0329"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region:
                     PRK12549"
                     /db_xref="CDD:183586"
     misc_feature    complement(342063..342326)
                     /locus_tag="PSPA7_0329"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    complement(341556..342029)
                     /locus_tag="PSPA7_0329"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(341586..341588,341595..341597,
                     341670..341672,342024..342026))
                     /locus_tag="PSPA7_0329"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(341595..341600,341607..341609,
                     341676..341678,341751..341759,341877..341882,
                     341940..341942,341949..341951))
                     /locus_tag="PSPA7_0329"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            complement(342353..342799)
                     /gene="aroQ2"
                     /locus_tag="PSPA7_0330"
                     /db_xref="GeneID:5359091"
     CDS             complement(342353..342799)
                     /gene="aroQ2"
                     /locus_tag="PSPA7_0330"
                     /EC_number="4.2.1.10"
                     /note="catalyzes the formation of 3-dehydroshikimate from
                     3-dehydroquinate in chorismate biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="YP_001345726.1"
                     /db_xref="GI:152985421"
                     /db_xref="GeneID:5359091"
                     /translation="MTRTVLVLNGPNLNLLGTREPRTYGRQTLAGIAAQCAAFAESRG
                     FAVEFRQTNHEGELLDWIHQARGRIAGLVINPAAWTHTSVALRDALAAVELPVLEVHL
                     SNVHQREPFRHHSHVSPLATGVICGLGGLGYRLALEYFASQFEAAA"
     misc_feature    complement(342374..342790)
                     /gene="aroQ2"
                     /locus_tag="PSPA7_0330"
                     /note="Dehydroquinase (DHQase), type II. Dehydroquinase
                     (or 3-dehydroquinate dehydratase) catalyzes the reversible
                     dehydration of 3-dehydroquinate to form
                     3-dehydroshikimate. This reaction is part of two metabolic
                     pathways: the biosynthetic shikimate pathway...; Region:
                     DHQase_II; cd00466"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(342464..342466,342524..342526,
                     342533..342538,342545..342547,342566..342568,
                     342611..342613,342620..342622,342629..342643,
                     342758..342760,342764..342766))
                     /gene="aroQ2"
                     /locus_tag="PSPA7_0330"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(342464..342466,342491..342499,
                     342536..342538,342557..342559,342566..342571,
                     342575..342577,342728..342730,342743..342745))
                     /gene="aroQ2"
                     /locus_tag="PSPA7_0330"
                     /note="active site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(342374..342376,342383..342385,
                     342395..342397,342407..342409,342416..342424,
                     342428..342439,342443..342448,342479..342484,
                     342488..342490))
                     /gene="aroQ2"
                     /locus_tag="PSPA7_0330"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     gene            complement(342916..344463)
                     /locus_tag="PSPA7_0331"
                     /db_xref="GeneID:5356483"
     CDS             complement(342916..344463)
                     /locus_tag="PSPA7_0331"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF07690; match to protein family HMM TIGR00711"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="YP_001345727.1"
                     /db_xref="GI:152987119"
                     /db_xref="GeneID:5356483"
                     /translation="MPAALRVASVPGAVLPELAHNPPVVRTVLVGLMLSIFLSALDQT
                     IVAVSLPAISADFADLDLLAWVISGYMVAMTVSMPIYGKLGDLYGRRRLMLFAIAVFS
                     AASLLCGLAQSMGQLVLGRVLQGIGAGGLMAVSQAIVGDIVPPRERGRYQGYFSSMYA
                     IASVAGPVLGGLLTEYLSWRWVFWINLPIGLLALAISRRTLVGLPVPRRQPLIDYPGI
                     ALMVVGLTALLLGITQIGQGVAWNDPALLGLFALAAVVLLLFILQERRFREPLVPMQL
                     FCIRAATLSWLVAFFASFQAISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAY
                     CCGRLTASLGRYKPLILGGALLLPCSIAGLALTPATHPWLSGLFMLLTGIAVGTQFPT
                     SLVAAQNAVEQRHIGVATSNATLFRSLGGAVGVALMSAILLALLKHLRIGGGIDQGFS
                     ESALLSSLNAASGPAQIIFQHVLADAFKVLFLINAAVALLGLAVAAALPDMPLRGRPV
                     AEPAAGE"
     misc_feature    complement(343033..344379)
                     /locus_tag="PSPA7_0331"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     misc_feature    complement(343168..344379)
                     /locus_tag="PSPA7_0331"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(343201..343203,343210..343215,
                     343222..343227,343234..343239,343270..343272,
                     343279..343284,343294..343296,343303..343308,
                     343315..343317,343465..343467,343477..343479,
                     343486..343488,343498..343500,343510..343512,
                     343552..343554,343561..343566,343573..343578,
                     343585..343587,343975..343977,343993..343998,
                     344005..344010,344044..344046,344053..344058,
                     344065..344070,344077..344082,344218..344223,
                     344227..344232,344242..344244,344251..344256,
                     344263..344265,344311..344316,344320..344328,
                     344335..344337))
                     /locus_tag="PSPA7_0331"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(344581..345765)
                     /gene="pobA"
                     /locus_tag="PSPA7_0332"
                     /db_xref="GeneID:5357244"
     CDS             complement(344581..345765)
                     /gene="pobA"
                     /locus_tag="PSPA7_0332"
                     /EC_number="1.14.13.2"
                     /note="catalyzes the formation of protocatechuate from
                     4-hydroxybenzoate"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate 3-monooxygenase"
                     /protein_id="YP_001345728.1"
                     /db_xref="GI:152983577"
                     /db_xref="GeneID:5357244"
                     /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQAPDYVLGRIR
                     AGVLEQGMVDLLREAGVDQRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGRTVTVYGQ
                     TEVTRDLMEARAACGATTIYQAAEVRLHDLEGEHPHVTFERDGERVRLDCDYIAGCDG
                     FHGVSRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYASHPRGFALCSQRSATR
                     SRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAQRLVTGPALEKSIAPLRSFVVEPM
                     QHGRLFLAGDAAHIVPPTGAKGLNLAASDVATLYHLLLKAYREDRADLLERYSAICLR
                     RIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEA
                     VE"
     misc_feature    complement(344590..345765)
                     /gene="pobA"
                     /locus_tag="PSPA7_0332"
                     /note="4-hydroxybenzoate 3-monooxygenase; Validated;
                     Region: PRK08243"
                     /db_xref="CDD:236198"
     misc_feature    complement(344605..345765)
                     /gene="pobA"
                     /locus_tag="PSPA7_0332"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases [Coenzyme metabolism
                     / Energy production and conversion]; Region: UbiH;
                     COG0654"
                     /db_xref="CDD:223727"
     gene            345943..346809
                     /locus_tag="PSPA7_0334"
                     /db_xref="GeneID:5355968"
     CDS             345943..346809
                     /locus_tag="PSPA7_0334"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00165"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345729.1"
                     /db_xref="GI:152988432"
                     /db_xref="GeneID:5355968"
                     /translation="MTLPTGAVPVFKLYGEPLEWPTPDLLHCESIPARSRLHDWEIKP
                     HRHADLGQLLYVRRGWAQLQVEGELTRVERPAIQFVPPLCIHGFQFSERIDGYVLTLA
                     APLLARLQAHLGAQRQALEAPGLYPVGADRRYIDTLFDAIDGEYAGTAPARELLLQSL
                     IGVLAVWLGRQVMVRRAEARPGRGQEYLSGFSQLVERHFREHLGIDEYARRLGITPAH
                     LNGVARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRL
                     SGVAPSVFRKGG"
     misc_feature    346549..346797
                     /locus_tag="PSPA7_0334"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    346690..346800
                     /locus_tag="PSPA7_0334"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(346806..347252)
                     /locus_tag="PSPA7_0333"
                     /db_xref="GeneID:5358352"
     CDS             complement(346806..347252)
                     /locus_tag="PSPA7_0333"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="YP_001345730.1"
                     /db_xref="GI:152986121"
                     /db_xref="GeneID:5358352"
                     /translation="MSSPLQFRRYTPADRDATLAIWLEASRIGHGFLGEAELQKQKAL
                     VRDHYLDASETWLALDGETPLGFIGLLDAFIGGLFVAPAAHGRGIGRQLLEHAAALKG
                     ALEVEVYAANREALGFYGHCGFVETGRRKEDDEGRPLEIVHLRRGD"
     misc_feature    complement(346881..347213)
                     /locus_tag="PSPA7_0333"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(346926..347087)
                     /locus_tag="PSPA7_0333"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(346980..346985,347013..347021))
                     /locus_tag="PSPA7_0333"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(347344..347778)
                     /locus_tag="PSPA7_0335"
                     /db_xref="GeneID:5359106"
     CDS             complement(347344..347778)
                     /locus_tag="PSPA7_0335"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00571"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345731.1"
                     /db_xref="GI:152986795"
                     /db_xref="GeneID:5359106"
                     /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVLN
                     HGEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHL
                     RHLPVVEEGRLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
     misc_feature    complement(347404..347739)
                     /locus_tag="PSPA7_0335"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair_10; cd04623"
                     /db_xref="CDD:239995"
     misc_feature    complement(347410..347736)
                     /locus_tag="PSPA7_0335"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     gene            complement(347920..348561)
                     /locus_tag="PSPA7_0336"
                     /db_xref="GeneID:5359282"
     CDS             complement(347920..348561)
                     /locus_tag="PSPA7_0336"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345732.1"
                     /db_xref="GI:152985774"
                     /db_xref="GeneID:5359282"
                     /translation="MNDYIARLRARYDEHFGCAPAMTLDCRGFWKHCAAVPDMAVFAY
                     RLENSRRAHHVAITAGMSQRPMHFAPYMGKARWSTELICYLDHLGGEDLRHLQWLAGM
                     PFHDQLALGRGHSVAFGFPLYEYSLLRHFLLLGTPDREDAGLFDGFADSAYPVDLLWV
                     VPLTEPEYQVKVKRNLEGIGALLSQSAHPLSLDRHRHCYVTGERPEGLGRVLH"
     misc_feature    complement(347974..348453)
                     /locus_tag="PSPA7_0336"
                     /note="Suppressor of fused protein (SUFU); Region: SUFU;
                     pfam05076"
                     /db_xref="CDD:252993"
     gene            complement(349039..349488)
                     /locus_tag="PSPA7_0337"
                     /db_xref="GeneID:5353565"
     CDS             complement(349039..349488)
                     /locus_tag="PSPA7_0337"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01047"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345733.1"
                     /db_xref="GI:152988810"
                     /db_xref="GeneID:5353565"
                     /translation="MNETNALGLPRGPLNLMTEIVRQRERQLTALLAPLGLGLHEWRA
                     LRIIHAFDGDVPMSLLIEHSQTDRTALGRTIERLVQRGWASRLPDPEDGRAVLVRRSR
                     AAQAVFEQALERVARLDEALLASLEAGEDGTLVVALGKLLRALDGRS"
     misc_feature    complement(349051..349368)
                     /locus_tag="PSPA7_0337"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(349099..349368)
                     /locus_tag="PSPA7_0337"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            complement(349541..351031)
                     /locus_tag="PSPA7_0338"
                     /db_xref="GeneID:5353876"
     CDS             complement(349541..351031)
                     /locus_tag="PSPA7_0338"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01977; match to protein family HMM TIGR00148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345734.1"
                     /db_xref="GI:152987714"
                     /db_xref="GeneID:5353876"
                     /translation="MNRSALDFRHFIDHLRHQGDLVDIHAEVDADLEIGAITRRVYER
                     GAPAPLFHTIRGSLPGARILGAPAGLRADKARAHGRLALHFGLPDHSGPREIVAALRA
                     AMRAAPIAPRRVERGPVQENVWIGERVDLTRFPVPLLHAQDGGRYFGTYGFHIVQTPD
                     RRWDSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRQGRPTPWAMALGAPPAALAA
                     AGMPLPEGVSEADYVGALVGEPVEVVRARTNGLWVPANAEIVLEGEISLDETALEGPM
                     GEYHGYCFPTGKPQPLFHVHAVTFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVL
                     QDAGLPVDMTWCSYEAATCWAVLSIDVQQLAALRTDAAAFAARIAEVAFGSHPGHLVP
                     KLILVGNDIDVSEIDQVVWALATRAHPLHDHFVFPAIRDFPMVPYLDAEDRARGSGGR
                     LVINCLYPEQFAGRMRASTASFRHSYPPALRQRVEERWREYGFADD"
     misc_feature    complement(349547..351025)
                     /locus_tag="PSPA7_0338"
                     /note="3-polyprenyl-4-hydroxybenzoate decarboxylase and
                     related decarboxylases [Coenzyme metabolism]; Region:
                     UbiD; COG0043"
                     /db_xref="CDD:223121"
     gene            complement(351163..351864)
                     /locus_tag="PSPA7_0339"
                     /db_xref="GeneID:5355204"
     CDS             complement(351163..351864)
                     /locus_tag="PSPA7_0339"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF06912"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345735.1"
                     /db_xref="GI:152988305"
                     /db_xref="GeneID:5355204"
                     /translation="MLPDSVVGSSARRLRLRRVRGRVGLGLVAGLSVLAGMTDAIGFL
                     ATGDFVSFMSGNTTRLAVSLGEGDLGGMARLAIALASFVAGNALGVILARFSGRRAAP
                     ILVCCAMLLALSAVWPFDWNVPALVAAIIAMGMLNAVVEQVNGLPIGLTYVTGALSRF
                     GRGLGRWLLGERRNGWRVQLVPWSGMCIGAVLGALLEQRLGLAAMAASAALAALLALA
                     ALVIPRPWQMDYMAR"
     misc_feature    complement(351172..351780)
                     /locus_tag="PSPA7_0339"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3619"
                     /db_xref="CDD:226146"
     gene            complement(352228..352306)
                     /locus_tag="PSPA7_0340"
                     /db_xref="GeneID:5354907"
     tRNA            complement(352228..352306)
                     /locus_tag="PSPA7_0340"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:5354907"
     gene            complement(352494..352910)
                     /locus_tag="PSPA7_0341"
                     /db_xref="GeneID:5354312"
     CDS             complement(352494..352910)
                     /locus_tag="PSPA7_0341"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345736.1"
                     /db_xref="GI:152986192"
                     /db_xref="GeneID:5354312"
                     /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIREGQRPGAPFPSPCAS
                     GAAATGRPPRAMGGQERSRPPTNVGEDTKESRGKGIAKQTPRRRHGGPTARKAGRATG
                     RSERGHSRGTRPAELKPIPRSPIVVALGAFEISNES"
     misc_feature    complement(<352566..352829)
                     /locus_tag="PSPA7_0341"
                     /note="transcription termination factor Rho; Provisional;
                     Region: PRK12678"
                     /db_xref="CDD:237171"
     gene            352935..354386
                     /gene="gabD"
                     /locus_tag="PSPA7_0343"
                     /db_xref="GeneID:5359626"
     CDS             352935..354386
                     /gene="gabD"
                     /locus_tag="PSPA7_0343"
                     /note="catalyzes the formation of succinate from succinate
                     semialdehyde; NADP dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase I"
                     /protein_id="YP_001345737.1"
                     /db_xref="GI:152988220"
                     /db_xref="GeneID:5359626"
                     /translation="MQLKDAKLFRQQAYIDGAWVDADSGQTIKVNNPATGEIVGSVPK
                     MGAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPL
                     AEAKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPS
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGG
                     ELTSNPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEG
                     ALISKYRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDA
                     KAVTKVEEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKDALVSRDETFGPLA
                     PVFRFKDEAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVA
                     PFGGIKASGLGREGSKYGIEDYLEIKYLCLGGI"
     misc_feature    353022..354374
                     /gene="gabD"
                     /locus_tag="PSPA7_0343"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(353136..353138,353163..353165,353286..353288,
                     353295..353300,353304..353330,353346..353354,
                     353367..353369,353613..353615,353649..353651,
                     353661..353663,353670..353672,353841..353843,
                     353853..353855,353991..353993,354195..354197,
                     354201..354206,354216..354218,354222..354224,
                     354231..354233,354237..354257,354273..354275,
                     354282..354287,354303..354305,354318..354320,
                     354354..354374)
                     /gene="gabD"
                     /locus_tag="PSPA7_0343"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(353391..353405,353427..353429,353472..353474,
                     353478..353483,353625..353636,353643..353645,
                     353652..353657,353697..353705,353799..353801,
                     354090..354092,354096..354098,354174..354176,
                     354288..354290)
                     /gene="gabD"
                     /locus_tag="PSPA7_0343"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(353403..353405,353697..353699,353790..353792,
                     353799..353801)
                     /gene="gabD"
                     /locus_tag="PSPA7_0343"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            complement(354358..354588)
                     /locus_tag="PSPA7_0342"
                     /db_xref="GeneID:5357359"
     CDS             complement(354358..354588)
                     /locus_tag="PSPA7_0342"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345738.1"
                     /db_xref="GI:152984165"
                     /db_xref="GeneID:5357359"
                     /translation="MKAGRKLPKAAYDDRLSRDLQARQGSEPLRDRRPRLPVRPVPPP
                     ATSTPDGAALACRPAPPDRCLAGLRYRPGRGT"
     gene            354631..355911
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /db_xref="GeneID:5359852"
     CDS             354631..355911
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /EC_number="2.6.1.19"
                     /note="catalyzes the formation of succinate semialdehyde
                     and glutamate from 4-aminobutanoate and 2-oxoglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="YP_001345739.1"
                     /db_xref="GI:152986520"
                     /db_xref="GeneID:5359852"
                     /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREY
                     IDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDF
                     PKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVN
                     SKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFP
                     ISGVAGKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKA
                     GLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCG
                     TYYNVIRFLMPVTIPDAQLEKGLAILAECFDELA"
     misc_feature    354652..355896
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    354700..355908
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(354961..354969,355045..355050,355054..355056,
                     355249..355251,355348..355350,355354..355359,
                     355435..355437)
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(354964..354969,355045..355050,355249..355251,
                     355348..355350,355357..355359,355435..355437)
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    355435..355437
                     /gene="gabT"
                     /locus_tag="PSPA7_0344"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            356225..357424
                     /locus_tag="PSPA7_0345"
                     /db_xref="GeneID:5357950"
     CDS             356225..357424
                     /locus_tag="PSPA7_0345"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345740.1"
                     /db_xref="GI:152985394"
                     /db_xref="GeneID:5357950"
                     /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLSVRCDARLILCGDGGE
                     ALEHCRRRSFALVLAESNLPQVDGFELLREARLRRPVAEQPFILISDRADQASVRAAV
                     ALAPTAYLVKPFQAGNLLQRLRGLLLKDDEVIACPLPEVTPDEDLLAFLERARDATEG
                     APLLADVRAASDRCLGAEEQPLRVLEDEFGRDPQITAGLIAAANSAARHVGPPCQTLG
                     QALRRLGLGHSLNLVLGFSLQRAIQLDEPLLAARALQFWELSQRCADIAWELADALGA
                     DVERCYTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDEALGRFGASFGSALRARWR
                     LPLELRRLIAAAYQFGGVLSREELILSLATQAASLPEAETGQLADSKAARMLGLDGER
                     LVKLLQP"
     misc_feature    356255..356566
                     /locus_tag="PSPA7_0345"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(356264..356269,356402..356404,356426..356428,
                     356492..356494,356549..356551,356558..356563)
                     /locus_tag="PSPA7_0345"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    356402..356404
                     /locus_tag="PSPA7_0345"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(356411..356416,356420..356428)
                     /locus_tag="PSPA7_0345"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    356558..356566
                     /locus_tag="PSPA7_0345"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    356627..357421
                     /locus_tag="PSPA7_0345"
                     /note="Predicted signal transduction protein [Signal
                     transduction mechanisms]; Region: COG1639"
                     /db_xref="CDD:224554"
     misc_feature    356708..357271
                     /locus_tag="PSPA7_0345"
                     /note="HDOD domain; Region: HDOD; pfam08668"
                     /db_xref="CDD:254961"
     gene            complement(357659..359089)
                     /locus_tag="PSPA7_0346"
                     /db_xref="GeneID:5355087"
     CDS             complement(357659..359089)
                     /locus_tag="PSPA7_0346"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00155; match to protein family HMM PF00392"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_001345741.1"
                     /db_xref="GI:152983897"
                     /db_xref="GeneID:5355087"
                     /translation="MELQLTLDGRHDLVGQLYRQLRDAILRGRLATGDRLPPTRYLAE
                     RLEVSRKTVSEAYERLASEGFLEGRVGNGTFVARGLAQQQPPAGAEGPLRPAARWARI
                     EPQSGLMDQRPALRYSFAGGTTDKRRFPFDAWRTCVLQALRLQQRTPAFYKDTEGDPE
                     LRLATSRYLAISRAVQCDWNALMITQGAQQGLDLLGRVMLEPGDLAVVEEPGYPPARA
                     SLLATGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQ
                     RQRALIIEDDYDSEYRFDGRSLESLRSLDRHGQVAYLGTFSKTLFPELRLGYLLPPAS
                     LREAVLAARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRDRLLERLRGD
                     LEPWLEALPAVAGIHLAARCREPLDVDRIARHLRQQGLEVGTLPPFYAETPPQAGFLF
                     GFGCIECDDIDPALDLLRAELQRSGG"
     misc_feature    complement(358859..359053)
                     /locus_tag="PSPA7_0346"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(358868..358879,358883..358888,
                     358916..358918,358925..358930,358934..358948,
                     358970..358975,358979..358981,359048..359050))
                     /locus_tag="PSPA7_0346"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(357671..359044)
                     /locus_tag="PSPA7_0346"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(357683..358741)
                     /locus_tag="PSPA7_0346"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(358115..358117,358136..358141,
                     358145..358147,358226..358228,358319..358321,
                     358451..358453,358523..358531))
                     /locus_tag="PSPA7_0346"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(358019..358021,358028..358030,
                     358115..358123,358247..358249,358421..358423,
                     358520..358522))
                     /locus_tag="PSPA7_0346"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(358136..358138)
                     /locus_tag="PSPA7_0346"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            359216..359653
                     /locus_tag="PSPA7_0347"
                     /db_xref="GeneID:5359344"
     CDS             359216..359653
                     /locus_tag="PSPA7_0347"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02627; match to protein family HMM TIGR00778"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345742.1"
                     /db_xref="GI:152986528"
                     /db_xref="GeneID:5359344"
                     /translation="MTTRLEWAKAAPDAYTAMLGLEKALAKASLERPLIELVYLRTSQ
                     INGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERAALAWTEQLARLSQGP
                     LPHALLDELREHFDDREIAELTLAVSAINAWNRFGVGMGMQPE"
     misc_feature    359249..359497
                     /locus_tag="PSPA7_0347"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; pfam02627"
                     /db_xref="CDD:251430"
     misc_feature    <359255..359650
                     /locus_tag="PSPA7_0347"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2128"
                     /db_xref="CDD:225039"
     gene            359665..360072
                     /locus_tag="PSPA7_0348"
                     /db_xref="GeneID:5357958"
     CDS             359665..360072
                     /locus_tag="PSPA7_0348"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345743.1"
                     /db_xref="GI:152986748"
                     /db_xref="GeneID:5357958"
                     /translation="MRLSRTFACLLCAVLPALAAAHDAEKVVTLRDQPLAEPPGYRGL
                     MLTVSFKPGQVSAPHVHPGPVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVAHVL
                     ARNPDPMRPAKLLVWELLKDGEPVLKPLSPGAH"
     misc_feature    359686..360036
                     /locus_tag="PSPA7_0348"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            360101..360385
                     /locus_tag="PSPA7_0349"
                     /db_xref="GeneID:5359235"
     CDS             360101..360385
                     /locus_tag="PSPA7_0349"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345744.1"
                     /db_xref="GI:152987916"
                     /db_xref="GeneID:5359235"
                     /translation="MSASQVIRIRARKGQSDRLGLRLRQLSGPGREAPGCLDFQVRRD
                     ALEADVWLIRSQWREPQQMLDYLCGEIQQVFAEVLWRSLAASLEVRDEEG"
     misc_feature    360116..360382
                     /locus_tag="PSPA7_0349"
                     /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
                     cl10022"
                     /db_xref="CDD:263948"
     gene            complement(360503..361273)
                     /locus_tag="PSPA7_0350"
                     /db_xref="GeneID:5357093"
     CDS             complement(360503..361273)
                     /locus_tag="PSPA7_0350"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345745.1"
                     /db_xref="GI:152987793"
                     /db_xref="GeneID:5357093"
                     /translation="MPRLALSALLCLCSLLSTLPARAALDDQQRALQQLQVQACRVVG
                     SLLLLRGEGFQEQHAAQLEKDLASLDRALAAVPEGVLLRQGEKALVARIREGAAYGPR
                     EEDLPWRYPQQLSRALRDFLNLVERQVPPTPPGQPLPLWQLPARVEYLSLQYLARAYL
                     GGLEIAREQPRDYLGQDESVLVPLIDRRIALLVANSANPAGLKKLENRWEYLSQALRD
                     LNSKSSALVSASGRPWAPIIVDRHARVLSDSLMRLSAE"
     gene            complement(361384..362070)
                     /locus_tag="PSPA7_0351"
                     /db_xref="GeneID:5356716"
     CDS             complement(361384..362070)
                     /locus_tag="PSPA7_0351"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00027"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345746.1"
                     /db_xref="GI:152989662"
                     /db_xref="GeneID:5356716"
                     /translation="MNARTDYRSQLQAGRWFQGLPEALQTHLLALAQPRQLPPGQRLF
                     ARGDAPCGLYCVVEGAIRISAVSEHGKEALLILVEPPHWFGEIALFDGQARTHDAYAE
                     GPTELLQVPQAALLELLRREPRYWRDMALLMSHKLRLAFIALEEMALLPAAQRLARRL
                     LMLAEGYDNSRSRQILHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILD
                     LAGLRAASHG"
     misc_feature    complement(361417..362028)
                     /locus_tag="PSPA7_0351"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(361681..362025)
                     /locus_tag="PSPA7_0351"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(361780..361788,361813..361818))
                     /locus_tag="PSPA7_0351"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(361696..361704,361714..361722))
                     /locus_tag="PSPA7_0351"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(361396..361611)
                     /locus_tag="PSPA7_0351"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(361603..361608)
                     /locus_tag="PSPA7_0351"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(361501..361503,361528..361536,
                     361540..361542))
                     /locus_tag="PSPA7_0351"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(361483..361503)
                     /locus_tag="PSPA7_0351"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(361483..361485,361495..361500))
                     /locus_tag="PSPA7_0351"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(361495..361500)
                     /locus_tag="PSPA7_0351"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            362113..362661
                     /locus_tag="PSPA7_0352"
                     /db_xref="GeneID:5354662"
     CDS             362113..362661
                     /locus_tag="PSPA7_0352"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345747.1"
                     /db_xref="GI:152986870"
                     /db_xref="GeneID:5354662"
                     /translation="MMRRPWRETTTMKTLVDHLAQYAAYHRDRRNILSHFIGIPMIVL
                     SIAVLLARPSPGFGLSPASLLALAAVLFYLRLDLRFGATMAALLALTVWSGAQLAAGS
                     TAAWLGWGIGLFVVGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRG
                     EVQREVEERAGPTCIREHKRAA"
     misc_feature    362146..362658
                     /locus_tag="PSPA7_0352"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4539"
                     /db_xref="CDD:226914"
     gene            complement(362701..363459)
                     /locus_tag="PSPA7_0353"
                     /db_xref="GeneID:5359781"
     CDS             complement(362701..363459)
                     /locus_tag="PSPA7_0353"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01435"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_001345748.1"
                     /db_xref="GI:152985241"
                     /db_xref="GeneID:5359781"
                     /translation="MNTRLSLSALALACAALAGCQNLSQQDLMQHGMMAMKAATLSDA
                     EVRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEDVNA
                     WAMANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQATYAAAAVRGAAGA
                     SKSGTLAALSGSQLGELTESLINAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEK
                     LARLGGGDSSMFDSHPGSQARADHIRQRIAADRK"
     misc_feature    complement(362704..363393)
                     /locus_tag="PSPA7_0353"
                     /note="Zn-dependent protease with chaperone function
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: HtpX; COG0501"
                     /db_xref="CDD:223575"
     gene            complement(363620..364204)
                     /locus_tag="PSPA7_0354"
                     /db_xref="GeneID:5354261"
     CDS             complement(363620..364204)
                     /locus_tag="PSPA7_0354"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01925"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345749.1"
                     /db_xref="GI:152986530"
                     /db_xref="GeneID:5354261"
                     /translation="MTNLWQLACGPSFLGLMKRLAGMLFGVVVGTLLVGAWLGDDAPR
                     QATGVLGLALVVYALLGLAAIALHLPARHERWVGPLVGLATGALTAVTGVFVIPAVPY
                     LGALGLQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLL
                     GQWLRQRISATLFRRCFFVGLLLLGADLAWRGFH"
     misc_feature    complement(363668..>364147)
                     /locus_tag="PSPA7_0354"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            364553..364864
                     /locus_tag="PSPA7_0355"
                     /db_xref="GeneID:5357960"
     CDS             364553..364864
                     /locus_tag="PSPA7_0355"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345750.1"
                     /db_xref="GI:152988714"
                     /db_xref="GeneID:5357960"
                     /translation="MTEHRKVLTIRDPDPELIRQAKIATGRGTGSQALIASAEKMIHQ
                     REQIEQMQEQIAQMREQISAYQAVLADAHSAATRLAEVAGQGDIFAPSNPLRLGHRRQ
                     R"
     misc_feature    <364580..>364768
                     /locus_tag="PSPA7_0355"
                     /note="hypothetical protein; Validated; Region: PRK09039"
                     /db_xref="CDD:181619"
     gene            complement(365677..366429)
                     /locus_tag="PSPA7_0356"
                     /db_xref="GeneID:5353780"
     CDS             complement(365677..366429)
                     /locus_tag="PSPA7_0356"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease SbcC"
                     /protein_id="YP_001345751.1"
                     /db_xref="GI:152984824"
                     /db_xref="GeneID:5353780"
                     /translation="MSFKTIDRGTLNPALKERLAHFEMNRHAYADAQQRFSDIAQEDT
                     RLAAEASKLEAQAEATEQAWRKRAIQPQVDQTEISAEIERGAALKRQVQALRATVEAR
                     SGLTAPVLLEMAELRAGLQKEPAAINTAYWRALLDQVLAQDGLRDALLQAFTLSRDIY
                     LSQLDSLEPVLAARCSGQRERQAFIAQGIWEAFADELKRLFAGAENGMGSPMLASLPS
                     PLRDEVVAETPGELYRLRQASASPLNGRTALR"
     gene            complement(366452..367480)
                     /locus_tag="PSPA7_0357"
                     /db_xref="GeneID:5357730"
     CDS             complement(366452..367480)
                     /locus_tag="PSPA7_0357"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF05125; match to protein family HMM TIGR01551"
                     /codon_start=1
                     /transl_table=11
                     /product="P2 family phage major capsid protein"
                     /protein_id="YP_001345752.1"
                     /db_xref="GI:152989333"
                     /db_xref="GeneID:5357730"
                     /translation="MMSKYLSARASTQYFQLQRTVAEAYHVDDAARTFAVEPTHAQEL
                     NDQITERVDFLGRINVIPVSEVKGEKVMLGLSGPATSRTDTNARDREPRHLLDLKNNT
                     YELAHTETDVALSFATIDAWAKFPDFVDRYLTAVQKRIALDRILVGWSGTHAATQTDP
                     AKYPQLEDVNKGWLQIAREQIPEQVLRSEDPAKKITLGPGGDYANLDALVHDVKQMID
                     PVLRDEGDLVAIIGSDLLAAEKSTLYAAQGQKPTEKERIEEVKVTETYGGLPSLLVPF
                     FPVMGVVVTSLDNLSIYYQDSSWRRHLLENPKRSRAEDFNGRNEGYVIEQLGKFAALE
                     GSSLELVR"
     misc_feature    complement(366461..367420)
                     /locus_tag="PSPA7_0357"
                     /note="Phage major capsid protein, P2 family; Region:
                     Phage_cap_P2; cl04947"
                     /db_xref="CDD:262373"
     gene            367732..368004
                     /locus_tag="PSPA7_0358"
                     /db_xref="GeneID:5357658"
     CDS             367732..368004
                     /locus_tag="PSPA7_0358"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF04606"
                     /codon_start=1
                     /transl_table=11
                     /product="phage transcriptional activator Ogr/delta"
                     /protein_id="YP_001345753.1"
                     /db_xref="GI:152988248"
                     /db_xref="GeneID:5357658"
                     /translation="MRIYCPECDSKARIATREEISRQFVKLYCQCTNGHCGHRFVMQL
                     TFSHALYGPSKPLDKLLFDRLREMPSQERRVLFDQLENMGVMDRNT"
     misc_feature    367741..367881
                     /locus_tag="PSPA7_0358"
                     /note="Ogr/Delta-like zinc finger; Region: Ogr_Delta;
                     pfam04606"
                     /db_xref="CDD:252697"
     gene            368015..368275
                     /locus_tag="PSPA7_0359"
                     /db_xref="GeneID:5354850"
     CDS             368015..368275
                     /locus_tag="PSPA7_0359"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF04606"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-finger protein"
                     /protein_id="YP_001345754.1"
                     /db_xref="GI:152987529"
                     /db_xref="GeneID:5354850"
                     /translation="MKIECPKCGGKARIYTRQKVTSDFCKLYCQCLDTKACHQRFVMN
                     LSLSHCLERPETVLDELVHERLRGLSVQQIKEMQDRIERTAI"
     misc_feature    368024..368167
                     /locus_tag="PSPA7_0359"
                     /note="Ogr/Delta-like zinc finger; Region: Ogr_Delta;
                     pfam04606"
                     /db_xref="CDD:252697"
     gene            complement(368359..369690)
                     /locus_tag="PSPA7_0360"
                     /db_xref="GeneID:5353964"
     CDS             complement(368359..369690)
                     /locus_tag="PSPA7_0360"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein"
                     /protein_id="YP_001345755.1"
                     /db_xref="GI:152988083"
                     /db_xref="GeneID:5353964"
                     /translation="MNDMTLGAVSAQVRPGFAVYDQDVTIDGKAYRAGLWYHGQERKG
                     AARTVEPVDQWVSIPLHIEAETLDENGYTGRLLRFTNRGRPVRWVLPMGMLATHGGNV
                     LKALFRQGFTADHQGHRQVLTYLREHPRPERLIQIATKPGWHDSGVFVLPGKPIGAAD
                     VYLDASRQQASLYHRRGTLDGWRQSVGLGCLGDPALELAVCLALAGPLLDALGVPGGG
                     VHLLGGTDSSAPLAVRVAASVWGDPFDLTASWHSTQAALIQEAIQRNNTVLPLNGGDW
                     PDLNAEKLGDAIARGRLDIYRHGSCSTLAWRVLMLSHGRRRLFSDARTDWPLVDIATD
                     RPAQAARLDVGHALETHYGHLGPAFVESLLACGGPDTLVPMFHEVRKRLLEVETPHVW
                     RVADRFAAMAVAGEHAIACELLDWSRGKALETCHRLYEQWRTTRKRPASRR"
     misc_feature    complement(368878..369606)
                     /locus_tag="PSPA7_0360"
                     /note="Domain of unknown function (DUF927); Region:
                     DUF927; cl12098"
                     /db_xref="CDD:264546"
     gene            complement(369687..369977)
                     /locus_tag="PSPA7_0361"
                     /db_xref="GeneID:5355714"
     CDS             complement(369687..369977)
                     /locus_tag="PSPA7_0361"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345756.1"
                     /db_xref="GI:152984745"
                     /db_xref="GeneID:5355714"
                     /translation="MKSHLDYLRERGFEVASVGQDVTVFPLENLTPSLRLWINLHRSE
                     LLAELAAGDGIARHCVWRVYLRGEFVCTAVSEPMSLDEVRKRVRFPGAEVRP"
     gene            complement(369974..371530)
                     /locus_tag="PSPA7_0362"
                     /db_xref="GeneID:5354834"
     CDS             complement(369974..371530)
                     /locus_tag="PSPA7_0362"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345757.1"
                     /db_xref="GI:152986966"
                     /db_xref="GeneID:5354834"
                     /translation="MAVKKDPYGDQWAGSDTLNDAIKKLGTDAGALYETKALAQLKKM
                     RGSDPAAFARLRAKVKDSKMLSMAEFDRLTIPAEDEEVAAGGDIFTEVEAWPKPVKGD
                     ELLDEICAVLRRYVAADKETIRAAALWSTFTWLIDVVQVAPIANITAPEKRCGKSILL
                     TALGKLAYRPMQVSNIAPAALYRAIELWSPTLLIDEVDAFLAAYDDARGILNAGFTRD
                     SASVIRCVGDDHMPTRFNVWGAKALCGIGKIADTLADRSIPLRLRRRVAGEKVERLRH
                     SDPVMWERLQAKLARWTADNAVTVGDARPAPIQGLNDRANDCWEPLLAIAEAAGGHWP
                     KSARQAAIVLHGLEGEAPSIGAELLQDVKAVFEDKNITKIFSGELLDALLSDDESPWA
                     TWNRGKPISTRQLSGKLGDFGIKSKQIRIGSDSKKGYEIKDFLDAFNRYLSANPPSAS
                     ETSKQTSNHAASSDFSNETLGDGVSDKKTLQPSNHAGCFDVSDKTPPPGRKGGKKGAT
                     SQVSYEEVRG"
     misc_feature    complement(370208..370750)
                     /locus_tag="PSPA7_0362"
                     /note="Protein of unknown function (DUF3631); Region:
                     DUF3631; pfam12307"
                     /db_xref="CDD:256969"
     gene            complement(371530..371913)
                     /locus_tag="PSPA7_0363"
                     /db_xref="GeneID:5354370"
     CDS             complement(371530..371913)
                     /locus_tag="PSPA7_0363"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence-associated protein E"
                     /protein_id="YP_001345758.1"
                     /db_xref="GI:152984717"
                     /db_xref="GeneID:5354370"
                     /translation="MTPIDKVLGRLDKVKRVKVNGKHRWKACCPAHDDKSPSLDVTEA
                     EDGTVLLKCWVGCSAAEIVGAIGLELRDLFPGEKRERSGPSPAAVRHERTIYLIGKNQ
                     LDQGGEMSAEDLERFNLAKQRLGVQ"
     misc_feature    complement(<371734..371904)
                     /locus_tag="PSPA7_0363"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     gene            complement(371910..372476)
                     /locus_tag="PSPA7_0364"
                     /db_xref="GeneID:5355073"
     CDS             complement(371910..372476)
                     /locus_tag="PSPA7_0364"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345759.1"
                     /db_xref="GI:152988919"
                     /db_xref="GeneID:5355073"
                     /translation="MKNIQERRSALTGSACPEKADDTLHQDRTDNCEGYVAPQRTCRH
                     VGDRQCVQVGDFGTAVAGERGYALAGESGFALAGDRGTARAGDFGTAMVGEFGKAIAG
                     DCGMASACDGGSARAGFRGIASAGFQGAVAAGEFGELRLTYWDSPSKRYRTAVGYIGE
                     DGLLADTFYTLDSSHQFVPAKTEREARV"
     misc_feature    complement(371943..>372113)
                     /locus_tag="PSPA7_0364"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09946"
                     /db_xref="CDD:182159"
     gene            complement(372543..372929)
                     /locus_tag="PSPA7_0365"
                     /db_xref="GeneID:5357219"
     CDS             complement(372543..372929)
                     /locus_tag="PSPA7_0365"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF05930"
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family transcriptional regulator"
                     /protein_id="YP_001345760.1"
                     /db_xref="GI:152986107"
                     /db_xref="GeneID:5357219"
                     /translation="MTAARRKASPAPILTEWLSASQLCAKYQVCLTTLWRWAKTPGFP
                     KAVRVGRVLRWDAGEVDAFLPKGLSADELCERYQISRATLWRWTKLPGFPVASGIGRM
                     LRWEPQAVDAFLSRQRRAGTAPVQSA"
     misc_feature    complement(372738..372881)
                     /locus_tag="PSPA7_0365"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:257254"
     misc_feature    complement(372576..372728)
                     /locus_tag="PSPA7_0365"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:257254"
     gene            complement(372926..373153)
                     /locus_tag="PSPA7_0366"
                     /db_xref="GeneID:5355375"
     CDS             complement(372926..373153)
                     /locus_tag="PSPA7_0366"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345761.1"
                     /db_xref="GI:152983998"
                     /db_xref="GeneID:5355375"
                     /translation="MTGLTSTQVIDNARQRIEAAQCREGLDVAWDQGLGALHTLLALG
                     RIDLSTWRWHHADFDSRAELRAFALEQGGEQ"
     gene            complement(373150..373350)
                     /locus_tag="PSPA7_0367"
                     /db_xref="GeneID:5355186"
     CDS             complement(373150..373350)
                     /locus_tag="PSPA7_0367"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345762.1"
                     /db_xref="GI:152987491"
                     /db_xref="GeneID:5355186"
                     /translation="MSALVPAPPRTSVRFSVLALLGEAVIVNRVTGTSASRTRLLALA
                     DMAYAVSMVSELERQAVIGGAK"
     gene            complement(374267..375676)
                     /locus_tag="PSPA7_0368"
                     /db_xref="GeneID:5353926"
     CDS             complement(374267..375676)
                     /locus_tag="PSPA7_0368"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase"
                     /protein_id="YP_001345763.1"
                     /db_xref="GI:152985084"
                     /db_xref="GeneID:5353926"
                     /translation="MHAIRGIHGDMAKRNRLTEMEAYSVKKRKSEPVGARGKGTLLLE
                     RKAAGTISGYYRERVEGKDKRIYLGTLNRKPRSGTDELTLDAMRLAALRLSQTALEAG
                     GLEHVKLSAAKQLHSSGEGSFGDLLDSYCDHLEQAGKVSARPVRRMLDAHVKAHHPAL
                     LRRPASKVRPEDIQLVLSQVLNRPPLPGGAGRTAKAHAANGMRTVCENLRLALQAAFS
                     HAAKAHLSPERLATRGKTFAISSNPVRDIPAIRGARRAITESLTPDELGVLLRHLETL
                     PEAHRAIAQALIYFGGQRIAQFCAVPWAAVTDSTISLLDSKGKKERPWEHILPITPRL
                     TEIMHPLLQHRIGPGPFSLRESNTASPSSVMKIFGAAGQSLAASGKARPFSYRNVRVT
                     AETLMAHLGISSEIRAWILSHGRSGVQAKHYDRYSYLPEKRAALERWGDYLDGLARGD
                     APADNVMLLSRNRKESDER"
     misc_feature    complement(374354..375550)
                     /locus_tag="PSPA7_0368"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(374360..>374992)
                     /locus_tag="PSPA7_0368"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    complement(order(374408..374410,374516..374524,
                     374720..374722,374792..374797))
                     /locus_tag="PSPA7_0368"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(374408..374410,374438..374440,
                     374507..374509,374516..374518,374720..374722,
                     374795..374797))
                     /locus_tag="PSPA7_0368"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(374408..374410,374438..374440,
                     374507..374509,374516..374518,374795..374797))
                     /locus_tag="PSPA7_0368"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(375786..375971)
                     /locus_tag="PSPA7_0369"
                     /db_xref="GeneID:5358207"
     CDS             complement(375786..375971)
                     /locus_tag="PSPA7_0369"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345764.1"
                     /db_xref="GI:152988078"
                     /db_xref="GeneID:5358207"
                     /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPP
                     MQAAALLIVPSMVTNVR"
     gene            376066..376764
                     /locus_tag="PSPA7_0370"
                     /db_xref="GeneID:5355709"
     CDS             376066..376764
                     /locus_tag="PSPA7_0370"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01022"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345765.1"
                     /db_xref="GI:152987202"
                     /db_xref="GeneID:5355709"
                     /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVS
                     PSSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALASASLALQPQRRSLPP
                     SHGTPSALREARTCYDHLAGELSVGVFARMLDAGWIEQEGRTVRLSATGEAGLAGLGI
                     DLVEARRRRRQFACACPDWSERKPHLGGALGAALLEACLRQGWLRPQDGSRALRVSPK
                     GRAGLRGLAERTAG"
     misc_feature    376096..376323
                     /locus_tag="PSPA7_0370"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(376096..376101,376105..376107,376114..376116,
                     376123..376128,376135..376140,376147..376149,
                     376240..376242,376297..376302,376306..376314,
                     376318..376323)
                     /locus_tag="PSPA7_0370"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(376099..376104,376114..376122,376162..376170,
                     376195..376206,376210..376215,376222..376227,
                     376231..376236,376252..376260,376273..376281)
                     /locus_tag="PSPA7_0370"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(376162..376164,376171..376173,376297..376299)
                     /locus_tag="PSPA7_0370"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(376778..377767)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /db_xref="GeneID:5357863"
     CDS             complement(376778..377767)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00005; match to protein family HMM TIGR00968"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transport protein CysA"
                     /protein_id="YP_001345766.1"
                     /db_xref="GI:152984256"
                     /db_xref="GeneID:5357863"
                     /translation="MSIEIRNVSKNFNAFKALDAINLDIQSGELVALLGPSGCGKTTL
                     LRIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMK
                     PKGERPGESAIKAKVHELLSMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLL
                     DEPFGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQI
                     GSPGEVYENPASDFVYHFLGDSNRLQLGDDQHLLFRPHEVSLSRSAVAEHRAAEVRDI
                     RPLGAITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
     misc_feature    complement(376784..377767)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="ABC-type sulfate/molybdate transport systems,
                     ATPase component [Inorganic ion transport and metabolism];
                     Region: CysA; COG1118"
                     /db_xref="CDD:224043"
     misc_feature    complement(377051..377767)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="ATP-binding cassette domain of the sulfate
                     transporter; Region: ABC_CysA_sulfate_importer; cd03296"
                     /db_xref="CDD:213263"
     misc_feature    complement(377642..377665)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(order(377183..377185,377282..377287,
                     377525..377527,377639..377647,377651..377656))
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(377525..377536)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(377330..377359)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(377282..377299)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="Walker B; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(377264..377275)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="D-loop; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(377177..377197)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213263"
     misc_feature    complement(376805..376960)
                     /gene="cysA"
                     /locus_tag="PSPA7_0371"
                     /note="TOBE-like domain; Region: TOBE_3; pfam12857"
                     /db_xref="CDD:257353"
     gene            complement(377771..378637)
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /db_xref="GeneID:5356244"
     CDS             complement(377771..378637)
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00528; match to protein family HMM TIGR00969; match to
                     protein family HMM TIGR02140"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transport protein CysW"
                     /protein_id="YP_001345767.1"
                     /db_xref="GI:152987667"
                     /db_xref="GeneID:5356244"
                     /translation="MSSASISAATASARRGHAGGRLTLIVLAWLVFALFLLLPLYVVL
                     SEALKQGFGTFFEAILEPDALAALKLTLLAVAISVPLNLLFGVAAAWCVSKFEFRGKS
                     ILVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSEHDIQIVFAVPGIVLATLFVTV
                     PFVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMG
                     EFGAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSES
                     RMSRLKSNADEE"
     misc_feature    complement(377894..378568)
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="sulfate transport protein; Provisional; Region:
                     cysT; CHL00187"
                     /db_xref="CDD:214388"
     misc_feature    complement(377867..378409)
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(377867..377872,377876..377881,
                     377888..377893,377921..377926,377963..377968,
                     377975..377986,378005..378007,378014..378019,
                     378059..378061,378110..378112,378119..378124,
                     378134..378136,378140..378145,378152..378154,
                     378161..378163,378167..378172,378266..378268,
                     378272..378277,378284..378313,378317..378328,
                     378356..378358,378371..378376,378383..378388))
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(377969..377986,378266..378310))
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(377891..377893,377921..377923,
                     377930..377932,377966..377968,378185..378187,
                     378266..378268))
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378038..378040,378050..378055,
                     378071..378109))
                     /gene="cysW"
                     /locus_tag="PSPA7_0372"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(378648..379466)
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /db_xref="GeneID:5357580"
     CDS             complement(378648..379466)
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00528; match to protein family HMM TIGR00969; match to
                     protein family HMM TIGR02139"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transport protein CysT"
                     /protein_id="YP_001345768.1"
                     /db_xref="GI:152984585"
                     /db_xref="GeneID:5357580"
                     /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWE
                     QFWAIVSAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLP
                     FALPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQP
                     VLADIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIA
                     GNMPMKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
     misc_feature    complement(378699..379466)
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    complement(378699..379292)
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378699..378704,378711..378716,
                     378723..378728,378732..378737,378744..378749,
                     378777..378782,378819..378824,378831..378842,
                     378861..378863,378870..378875,378915..378917,
                     378966..378968,378975..378980,378990..378992,
                     378996..379001,379008..379010,379014..379016,
                     379020..379025,379122..379124,379128..379133,
                     379140..379169,379173..379184,379212..379214,
                     379227..379232,379239..379244))
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378825..378842,379122..379166))
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378747..378749,378777..378779,
                     378786..378788,378822..378824,379038..379040,
                     379122..379124))
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378894..378896,378906..378911,
                     378927..378965))
                     /gene="cysT"
                     /locus_tag="PSPA7_0373"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(379624..380622)
                     /gene="sbp"
                     /locus_tag="PSPA7_0374"
                     /db_xref="GeneID:5359153"
     CDS             complement(379624..380622)
                     /gene="sbp"
                     /locus_tag="PSPA7_0374"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01547; match to protein family HMM TIGR00971"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate-binding protein"
                     /protein_id="YP_001345769.1"
                     /db_xref="GI:152988811"
                     /db_xref="GeneID:5359153"
                     /translation="MSLRRFALAALASALLSGPAAAATQLLNVSYDPTRELYQAYNAA
                     FIEHWKTQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELNKLGKLLPA
                     DWQARLPDNSTPYTSTIVFLVRKGNPKGIEDWGDLTKEGVEVITPNPKTSGGARWNFL
                     AAWAWAKKQYGSDEKARDYVQALYRHVPVLDTGARGSTITFVNNQIGDVLLAWENEAF
                     LAKKEQGGENFEIVVPSLSILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIA
                     AQNFYRPRNQKVAAEFAAQFPKLDLVTVDADFGGWKSAQPKFFNDGGIFDQIYQAQ"
     misc_feature    complement(379633..380571)
                     /gene="sbp"
                     /locus_tag="PSPA7_0374"
                     /note="ABC-type sulfate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: Sbp; COG1613"
                     /db_xref="CDD:224529"
     gene            complement(380798..380980)
                     /locus_tag="PSPA7_0375"
                     /db_xref="GeneID:5353877"
     CDS             complement(380798..380980)
                     /locus_tag="PSPA7_0375"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345770.1"
                     /db_xref="GI:152985927"
                     /db_xref="GeneID:5353877"
                     /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQI
                     ERKEKFRLQQPSVKQA"
     misc_feature    complement(380801..380950)
                     /locus_tag="PSPA7_0375"
                     /note="Uncharacterized small protein [Function unknown];
                     Region: COG5583"
                     /db_xref="CDD:227870"
     gene            complement(381137..383419)
                     /locus_tag="PSPA7_0376"
                     /db_xref="GeneID:5359476"
     CDS             complement(381137..383419)
                     /locus_tag="PSPA7_0376"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00563; match to protein family HMM PF00989; match to
                     protein family HMM PF00990; match to protein family HMM
                     PF08447; match to protein family HMM PF08448; match to
                     protein family HMM TIGR00229; match to protein family HMM
                     TIGR00254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345771.1"
                     /db_xref="GI:152986676"
                     /db_xref="GeneID:5359476"
                     /translation="MNPRLSALRLSLAYLAVAIAWAFLSDHLLQNQVQDHDQLVFWMT
                     AKRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTG
                     RMFVSPGYAALVGLTPEELGDPIETWKKRLHPEEFATVLEAHRNHLQGLTDNLDHIYR
                     LRHKDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREG
                     VLVTDAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDV
                     WSGEIWNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHD
                     SLTGLPNRVLLRQRIEQALEDGKDRAVAGALLLIDLDHFKHINDSLGHTTGDMLLKEV
                     SKRLQHQLGERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYI
                     SASLGVSLYPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESA
                     LRHALDHDELRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIA
                     ALDNWVLKRACRQMREWQDRGVGLEFIAVNVSSRLFNRGGLEERIANALEESGLEPRY
                     LELEVTESAVMEDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQ
                     GFVAGLPGAVDDAAIARAIIALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYG
                     RPQPPETLRFDAPPVALPED"
     misc_feature    complement(382835..383146)
                     /locus_tag="PSPA7_0376"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(382844..383113)
                     /locus_tag="PSPA7_0376"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    complement(order(382922..382924,382937..382939,
                     383018..383029,383072..383074,383090..383092,
                     383102..383104))
                     /locus_tag="PSPA7_0376"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(382895..382897,382901..382903,
                     382988..382993,383000..383002,383024..383026,
                     383036..383038))
                     /locus_tag="PSPA7_0376"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(382469..382777)
                     /locus_tag="PSPA7_0376"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(382466..382771)
                     /locus_tag="PSPA7_0376"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(order(382556..382558,382571..382573,
                     382649..382660,382697..382699,382715..382717,
                     382727..382729))
                     /locus_tag="PSPA7_0376"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(382529..382531,382535..382537,
                     382619..382624,382631..382633,382655..382657,
                     382667..382669))
                     /locus_tag="PSPA7_0376"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(381953..382426)
                     /locus_tag="PSPA7_0376"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(382184..382186,382313..382315))
                     /locus_tag="PSPA7_0376"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(382181..382192,382196..382198,
                     382262..382264,382274..382276,382286..382291,
                     382298..382300))
                     /locus_tag="PSPA7_0376"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(382124..382126,382208..382210))
                     /locus_tag="PSPA7_0376"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(381182..381901)
                     /locus_tag="PSPA7_0376"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            383592..384770
                     /locus_tag="PSPA7_0377"
                     /db_xref="GeneID:5355911"
     CDS             383592..384770
                     /locus_tag="PSPA7_0377"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00487"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fatty acid desaturase"
                     /protein_id="YP_001345772.1"
                     /db_xref="GI:152984301"
                     /db_xref="GeneID:5355911"
                     /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDL
                     HPALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAEL
                     YKAEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQ
                     MAWIPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKL
                     SVKKWEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMA
                     QYRKLVIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQAL
                     KVIYEKRLALQQIWAKTSANGHDMLAAMKDWVHEAEASGIQSLKEFAAQLKTYSLRPA
                     "
     misc_feature    383625..384314
                     /locus_tag="PSPA7_0377"
                     /note="The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like
                     CD includes the delta-9 and delta-11 acyl CoA desaturases
                     found in various eukaryotes including vertebrates,
                     insects, higher plants, and fungi. The delta-9 acyl-lipid
                     desaturases are found in a wide...; Region:
                     Delta9-FADS-like; cd03505"
                     /db_xref="CDD:239582"
     misc_feature    order(383691..383693,383706..383708,383802..383804,
                     383811..383816,384207..384209,384216..384221)
                     /locus_tag="PSPA7_0377"
                     /note="Di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239582"
     misc_feature    <384390..384752
                     /locus_tag="PSPA7_0377"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            384999..386384
                     /locus_tag="PSPA7_0378"
                     /db_xref="GeneID:5356036"
     CDS             384999..386384
                     /locus_tag="PSPA7_0378"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00474"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:solute symporter"
                     /protein_id="YP_001345773.1"
                     /db_xref="GI:152985684"
                     /db_xref="GeneID:5356036"
                     /translation="MLLDYLIMLVYALAMLGLGWYGMRKARSQSDFLVAGRRLGPGLY
                     LGTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTV
                     TQVLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIV
                     IVYSVIGGMWSLTLTDIIQFVIKTIGIFLVLLPLSIDGAGGLGGMREALPAGFFDLGQ
                     IGLDTILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGTACALIG
                     AAARVLLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQE
                     DIYARFLRPGTTSDIRLSRCITLLMGVAMLALACLVNDVIAALSIAYNLLVGGLLVPI
                     VGALLWRRASPQGAIASIVVGCLAVVACMARDGLLANSPIVYGLLASLATFVVVSLAT
                     RPAAGLRAQPE"
     misc_feature    385005..386360
                     /locus_tag="PSPA7_0378"
                     /note="Uncharacterized bacterial solute carrier 5
                     subfamily; putative solute-binding domain; Region:
                     SLC5sbd_u3; cd11479"
                     /db_xref="CDD:212049"
     misc_feature    order(385146..385148,385155..385157,385944..385946,
                     385953..385958)
                     /locus_tag="PSPA7_0378"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212049"
     gene            386439..387395
                     /gene="speB2"
                     /locus_tag="PSPA7_0379"
                     /db_xref="GeneID:5356084"
     CDS             386439..387395
                     /gene="speB2"
                     /locus_tag="PSPA7_0379"
                     /EC_number="3.5.3.11"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00491; match to protein family HMM TIGR01230"
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="YP_001345774.1"
                     /db_xref="GI:152984033"
                     /db_xref="GeneID:5356084"
                     /translation="MSNDNPQPLDAAEIPRFAGIPTFMRLPAFTDPAAVRVGLIGVPW
                     DGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSL
                     RRIEGFYRQVHAAGTLPLSIGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGD
                     NPYTHGTPFRRAIEEGLLDPRRTVQIGIRGSVYSPNDDAFARECGIRVIHMEEFVELG
                     VEATLVEARRVVGDGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLD
                     LVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAARSA"
     misc_feature    386493..387359
                     /gene="speB2"
                     /locus_tag="PSPA7_0379"
                     /note="Agmatinase-like family includes proclavaminic acid
                     amidinohydrolase; Region: Agmatinase_PAH; cd11592"
                     /db_xref="CDD:212538"
     misc_feature    order(386565..386567,386574..386576,386601..386606,
                     386613..386615,386622..386624,386697..386699,
                     386706..386711,387186..387188,387198..387200,
                     387210..387212,387222..387227,387318..387320,
                     387327..387332,387339..387341,387351..387353)
                     /gene="speB2"
                     /locus_tag="PSPA7_0379"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212538"
     misc_feature    order(386814..386816,386880..386882,386886..386894,
                     386931..386936,387156..387158,387162..387164,
                     387288..387290)
                     /gene="speB2"
                     /locus_tag="PSPA7_0379"
                     /note="putative active site [active]"
                     /db_xref="CDD:212538"
     misc_feature    order(386814..386816,386880..386882,386886..386888,
                     386892..386894,387156..387158,387162..387164)
                     /gene="speB2"
                     /locus_tag="PSPA7_0379"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:212538"
     gene            387462..388412
                     /locus_tag="PSPA7_0380"
                     /db_xref="GeneID:5357148"
     CDS             387462..388412
                     /locus_tag="PSPA7_0380"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00126; match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_001345775.1"
                     /db_xref="GI:152985199"
                     /db_xref="GeneID:5357148"
                     /translation="MLGNLNDIDLRLLRTFCAIVEAGGFTAAQARLNTSLSRLSVLVR
                     DLEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDREALHL
                     GCVDGVIGQHCLPLPLAIRLFRQRAPEVRLNLHTRRPDELEHAVLEERLQLAVGAFHH
                     RLSGLCYQPLFREEQNLYCGRAHPFFARADDEPTLDEICAADYVGRGYMAENQRPHDL
                     RFRHGINAYTMEAIATLVFSGTYIGYLPTHYAANWVAEGRMRAIRPSQLAYDSEFHCV
                     TRQGHDERPTLSLFLSSLFEAQEQLGAQAPANMSGIARQL"
     misc_feature    387483..388370
                     /locus_tag="PSPA7_0380"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    387489..387668
                     /locus_tag="PSPA7_0380"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    387759..388343
                     /locus_tag="PSPA7_0380"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(387804..387806,387810..387812,387819..387824,
                     387831..387833,387843..387845,387849..387869,
                     388128..388145,388161..388166,388170..388175)
                     /locus_tag="PSPA7_0380"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            388525..389496
                     /locus_tag="PSPA7_0381"
                     /db_xref="GeneID:5359454"
     CDS             388525..389496
                     /locus_tag="PSPA7_0381"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345776.1"
                     /db_xref="GI:152984841"
                     /db_xref="GeneID:5359454"
                     /translation="MDDLPSIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNS
                     VLWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLRQVLE
                     RGAVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKRMESELQR
                     LATTDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQ
                     VLQRIAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEG
                     EHSFGITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
     misc_feature    388687..388968
                     /locus_tag="PSPA7_0381"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    388693..388959
                     /locus_tag="PSPA7_0381"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(388699..388701,388711..388713,388729..388731,
                     388774..388785,388861..388863,388876..388878)
                     /locus_tag="PSPA7_0381"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(388765..388767,388777..388779,388801..388803,
                     388810..388815,388897..388899,388906..388908)
                     /locus_tag="PSPA7_0381"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    389011..389487
                     /locus_tag="PSPA7_0381"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(389122..389124,389251..389253)
                     /locus_tag="PSPA7_0381"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(389137..389139,389146..389151,389161..389163,
                     389173..389175,389239..389241,389245..389256)
                     /locus_tag="PSPA7_0381"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(389227..389229,389311..389313)
                     /locus_tag="PSPA7_0381"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            390109..391491
                     /gene="oprE"
                     /locus_tag="PSPA7_0382"
                     /db_xref="GeneID:5359144"
     CDS             390109..391491
                     /gene="oprE"
                     /locus_tag="PSPA7_0382"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03573"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin OprE"
                     /protein_id="YP_001345777.1"
                     /db_xref="GI:152986570"
                     /db_xref="GeneID:5359144"
                     /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRN
                     FYINTDNRNGSASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAG
                     KNGLDRQPGTVFPLESDGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGR
                     LLPVTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSASSRDSNKF
                     YYAGGDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGK
                     NGSRSGRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFP
                     FLNRGDGEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFATVGVPGLTFNTIYLSGDK
                     IKTARGDQSEWERDISLAYVIPDGTFKGLGFTWKNASFRSGLPAAGSSNNQRDQDENR
                     LIVSYTLPLL"
     misc_feature    390196..391485
                     /gene="oprE"
                     /locus_tag="PSPA7_0382"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            complement(391582..392688)
                     /gene="aguA"
                     /locus_tag="PSPA7_0383"
                     /db_xref="GeneID:5358000"
     CDS             complement(391582..392688)
                     /gene="aguA"
                     /locus_tag="PSPA7_0383"
                     /EC_number="3.5.3.12"
                     /note="catalyzes the formation of carbamoylputrescine from
                     agmatine in the arginine decarboxylase pathway of
                     putrescine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="YP_001345778.1"
                     /db_xref="GI:152987588"
                     /db_xref="GeneID:5358000"
                     /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQ
                     AAFTAVAKAIARFEPVTVCASAAQYENARARLDDTNIRVVEISTDDAWVRDTGPTFVI
                     DDQGDVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSI
                     HVDGEGTLITTEECLLNHNRNPHLSQAEIEGILRDHLAVDSIIWLPNGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDQDDPNYLRCQAALRILEESRDAKGRKLVVHKMPIPGPLY
                     ATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPKDAEARAILQRV
                     FPEHEVVMVPGREILLGGGNIHCITQQQPAPRKA"
     misc_feature    complement(391591..392676)
                     /gene="aguA"
                     /locus_tag="PSPA7_0383"
                     /note="agmatine deiminase; Provisional; Region: PRK13551"
                     /db_xref="CDD:184135"
     gene            complement(392750..393628)
                     /gene="aguB"
                     /locus_tag="PSPA7_0384"
                     /db_xref="GeneID:5354724"
     CDS             complement(392750..393628)
                     /gene="aguB"
                     /locus_tag="PSPA7_0384"
                     /EC_number="3.5.1.53"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00795; match to protein family HMM TIGR03381"
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="YP_001345779.1"
                     /db_xref="GI:152985033"
                     /db_xref="GeneID:5354724"
                     /translation="MSRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQE
                     LFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSI
                     AIIDADGSNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFP
                     ESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGR
                     EEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRR
                     PNLYGPLKTLDGSLES"
     misc_feature    complement(392774..393616)
                     /gene="aguB"
                     /locus_tag="PSPA7_0384"
                     /note="N-carbamoylputrescine amidohydrolase (CPA) (class
                     11 nitrilases); Region: CPA; cd07573"
                     /db_xref="CDD:143597"
     misc_feature    complement(order(393092..393094,393155..393160,
                     393164..393169,393245..393247,393266..393268,
                     393278..393280,393497..393499))
                     /gene="aguB"
                     /locus_tag="PSPA7_0384"
                     /note="putative active site; other site"
                     /db_xref="CDD:143597"
     misc_feature    complement(order(393167..393169,393278..393280,
                     393497..393499))
                     /gene="aguB"
                     /locus_tag="PSPA7_0384"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143597"
     misc_feature    complement(order(392798..392812,392936..392941,
                     393014..393019,393023..393031,393035..393040,
                     393134..393139,393146..393160,393164..393166,
                     393221..393229,393248..393250,393266..393277))
                     /gene="aguB"
                     /locus_tag="PSPA7_0384"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143597"
     gene            complement(393820..394455)
                     /locus_tag="PSPA7_0385"
                     /db_xref="GeneID:5354519"
     CDS             complement(393820..394455)
                     /locus_tag="PSPA7_0385"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00440"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator AguR"
                     /protein_id="YP_001345780.1"
                     /db_xref="GI:152983911"
                     /db_xref="GeneID:5354519"
                     /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLSIYSVAE
                     RAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLERPVDHAGLRCWRDLSRIVEERM
                     LAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIF
                     SLAMELGDRVYALSVQRHGTIDARLAEEGMRVFDAYLGLYLPPFLEKRSEP"
     misc_feature    complement(393865..394440)
                     /locus_tag="PSPA7_0385"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(394255..394395)
                     /locus_tag="PSPA7_0385"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(394516..395577)
                     /locus_tag="PSPA7_0386"
                     /db_xref="GeneID:5358047"
     CDS             complement(394516..395577)
                     /locus_tag="PSPA7_0386"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01547"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic polyamine binding protein"
                     /protein_id="YP_001345781.1"
                     /db_xref="GI:152985846"
                     /db_xref="GeneID:5358047"
                     /translation="MPRLSVLLFLAFAPWLAQAEETLRVYNWNDYIDPQVLEAFQKDT
                     GIRVEYHTFATAEELDRALRSGEPIDVAVPSHDTLPALLKDNLLRPLDFARLPNRSHL
                     DRQLLSKLAAVDPDNRHAIPYLWGAVGLAINTPQAEAAYGGPLPDSWSLLFDASQSQR
                     LKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAADALHGLRPNLRYVDSERYI
                     ADLEGGRLCVAMAWVGDALRAAKAGQPVSFTVPQEGSVLFIDNLVIPASAQHPQQALR
                     FIDYLMQPQVAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPP
                     EKLQPVLGEIWQAFRDAAH"
     misc_feature    complement(394531..395568)
                     /locus_tag="PSPA7_0386"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            complement(395833..397209)
                     /locus_tag="PSPA7_0387"
                     /db_xref="GeneID:5358436"
     CDS             complement(395833..397209)
                     /locus_tag="PSPA7_0387"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00120"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_001345782.1"
                     /db_xref="GI:152985114"
                     /db_xref="GeneID:5358436"
                     /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIER
                     NSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKR
                     PTAQLLMTMHELEGEPFFADPREVLRQVVEKFTEMELTIVAAFELEFYLIDQENVNGR
                     PQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFE
                     VNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDK
                     HGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWG
                     LDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLSNKVEPGAPIEG
                     NSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLE
                     YNWYLHTV"
     misc_feature    complement(395839..397167)
                     /locus_tag="PSPA7_0387"
                     /note="Glutamine synthetase [Amino acid transport and
                     metabolism]; Region: GlnA; COG0174"
                     /db_xref="CDD:223252"
     misc_feature    complement(396880..397146)
                     /locus_tag="PSPA7_0387"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    complement(396088..396849)
                     /locus_tag="PSPA7_0387"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            397488..398240
                     /locus_tag="PSPA7_0388"
                     /db_xref="GeneID:5353540"
     CDS             397488..398240
                     /locus_tag="PSPA7_0388"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00117; match to protein family HMM PF07722"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glutamine amidotransferase"
                     /protein_id="YP_001345783.1"
                     /db_xref="GI:152983792"
                     /db_xref="GeneID:5353540"
                     /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIP
                     ALGELLDQATLLDSIDGLLFTGSPSNVEPRHYSGAASEPGTLHDPDRDATTLPLVRAA
                     IDAGIPVLGICRGFQEMNVAFGGSLHQKVHEAGTFMDHREPADQPLEVQYAPRHAMHV
                     QPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGV
                     QWHPEWQVLTNPNYLAIFQAFGKACGKRAGQR"
     misc_feature    397488..398228
                     /locus_tag="PSPA7_0388"
                     /note="Predicted glutamine amidotransferases [General
                     function prediction only]; Region: COG2071"
                     /db_xref="CDD:224982"
     misc_feature    397506..398207
                     /locus_tag="PSPA7_0388"
                     /note="Subgroup of proteins having the Type 1 glutamine
                     amidotransferase (GATase1) domain; Region: GATase1_2;
                     cd01745"
                     /db_xref="CDD:153216"
     misc_feature    order(397824..397826,398148..398150,398154..398156)
                     /locus_tag="PSPA7_0388"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153216"
     gene            398281..399639
                     /locus_tag="PSPA7_0389"
                     /db_xref="GeneID:5356882"
     CDS             398281..399639
                     /locus_tag="PSPA7_0389"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00120"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_001345784.1"
                     /db_xref="GI:152989046"
                     /db_xref="GeneID:5356882"
                     /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAE
                     KGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVI
                     HDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPV
                     GRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHG
                     DALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGRNIF
                     SNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTV
                     GLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERR
                     NLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLL
                     SV"
     misc_feature    398314..399627
                     /locus_tag="PSPA7_0389"
                     /note="Glutamine synthetase [Amino acid transport and
                     metabolism]; Region: GlnA; COG0174"
                     /db_xref="CDD:223252"
     misc_feature    398620..399390
                     /locus_tag="PSPA7_0389"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            399705..401075
                     /locus_tag="PSPA7_0390"
                     /db_xref="GeneID:5357792"
     CDS             399705..401075
                     /locus_tag="PSPA7_0390"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00202"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminotransferase"
                     /protein_id="YP_001345785.1"
                     /db_xref="GI:152986027"
                     /db_xref="GeneID:5357792"
                     /translation="MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEG
                     VYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVEL
                     AKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGST
                     VAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEV
                     GEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFG
                     SQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAV
                     ALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKT
                     RERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQT
                     AAAVLA"
     misc_feature    399738..401069
                     /locus_tag="PSPA7_0390"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    399741..401045
                     /locus_tag="PSPA7_0390"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(400068..400076,400170..400175,400179..400181,
                     400389..400391,400488..400490,400494..400499,
                     400575..400577)
                     /locus_tag="PSPA7_0390"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(400071..400076,400170..400175,400389..400391,
                     400488..400490,400497..400499,400575..400577)
                     /locus_tag="PSPA7_0390"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    400575..400577
                     /locus_tag="PSPA7_0390"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            401191..402294
                     /gene="potF2"
                     /locus_tag="PSPA7_0391"
                     /db_xref="GeneID:5355442"
     CDS             401191..402294
                     /gene="potF2"
                     /locus_tag="PSPA7_0391"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01547"
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine transport protein"
                     /protein_id="YP_001345786.1"
                     /db_xref="GI:152988404"
                     /db_xref="GeneID:5355442"
                     /translation="MMKRFGKTLLALTLAGTVAGMAQAADNKVLHVYNWSDYIAPDTL
                     EKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKS
                     KLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDL
                     VFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYV
                     TYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDM
                     VAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYP
                     SEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK"
     misc_feature    401230..402291
                     /gene="potF2"
                     /locus_tag="PSPA7_0391"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            402713..403810
                     /gene="potF3"
                     /locus_tag="PSPA7_0392"
                     /db_xref="GeneID:5358324"
     CDS             402713..403810
                     /gene="potF3"
                     /locus_tag="PSPA7_0392"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01547"
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine transport protein"
                     /protein_id="YP_001345787.1"
                     /db_xref="GI:152989077"
                     /db_xref="GeneID:5358324"
                     /translation="MQHPIGKTLLVATLAAAIAGPVQAEKKSLHIYNWTDYIAPTTLK
                     DFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSK
                     LPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILF
                     EPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKEYKKAEEVLTKVRPYVSY
                     FHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMA
                     IPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAVPGARPLMDKSVSDSEEVYPPQ
                     AVLDKAYVSAVLPAKVLRLQTRTWTRIKTGK"
     misc_feature    402737..403807
                     /gene="potF3"
                     /locus_tag="PSPA7_0392"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            403867..405021
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /db_xref="GeneID:5357823"
     CDS             403867..405021
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00005; match to protein family HMM PF08402; match to
                     protein family HMM TIGR01187"
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine transport protein PotG"
                     /protein_id="YP_001345788.1"
                     /db_xref="GI:152984584"
                     /db_xref="GeneID:5357823"
                     /translation="MAIASGAYKKALEGSQQPKEVLVKIDRVTKQFDETLAVDTVSLT
                     INKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQS
                     YALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQR
                     VALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMT
                     MAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACP
                     QLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHPGHNWAQGTVYDIAYL
                     GGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
     misc_feature    403930..405012
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="putrescine transporter ATP-binding subunit;
                     Provisional; Region: potG; PRK11607"
                     /db_xref="CDD:183226"
     misc_feature    403933..404628
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    404029..404052
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(404038..404043,404047..404055,404167..404169,
                     404395..404400,404497..404499)
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    404158..404169
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    404323..404352
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    404383..404400
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    404407..404418
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    404485..404505
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    404764..405012
                     /gene="potG"
                     /locus_tag="PSPA7_0393"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            405018..405929
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /db_xref="GeneID:5359152"
     CDS             405018..405929
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine transport protein PotH"
                     /protein_id="YP_001345789.1"
                     /db_xref="GI:152985709"
                     /db_xref="GeneID:5359152"
                     /translation="MKFANSLKKRMPGGRHAVIGVPFLWLFLFFLLPFAIVLKISLAE
                     ADVAIPPYTEIFAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFVSTLICLLV
                     GYPMAYAIARSSQSTQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGII
                     SEPLTILNTNVAVYIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKI
                     TVPLSKNGIIAGCMLVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASAL
                     AVVMLAILIIPIILFNKNQAKELEGKV"
     misc_feature    405270..405857
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(405318..405323,405330..405335,405348..405350,
                     405378..405389,405393..405422,405429..405434,
                     405438..405440,405549..405554,405561..405563,
                     405567..405569,405576..405581,405585..405587,
                     405597..405602,405609..405611,405660..405662,
                     405702..405707,405714..405716,405735..405746,
                     405753..405758,405795..405800,405822..405827,
                     405834..405839,405843..405848,405855..405857)
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(405396..405440,405735..405752)
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(405438..405440,405534..405536,405753..405755,
                     405789..405791,405798..405800,405822..405824)
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(405612..405650,405666..405671,405681..405683)
                     /gene="potH"
                     /locus_tag="PSPA7_0394"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            406012..406881
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /db_xref="GeneID:5359484"
     CDS             406012..406881
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine transport protein PotI"
                     /protein_id="YP_001345790.1"
                     /db_xref="GI:152985751"
                     /db_xref="GeneID:5359484"
                     /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSV
                     KWYVGLLDNTQLVSSVGRSLEIAFYTAFSSVILGTLAAFVLTRIPRFRGRTLFGGMVT
                     APLVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRE
                     LDLSIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGS
                     TTLPMEVFSAVRLGVKPEINAVASLILLSVSLFTFLAWYFTRQAEERRRRAIQQAMEE
                     TASDWQKGSPTPA"
     misc_feature    406015..406788
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    406198..406755
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(406237..406242,406249..406254,406267..406269,
                     406300..406311,406315..406344,406351..406356,
                     406360..406362,406438..406443,406450..406452,
                     406456..406458,406465..406470,406474..406476,
                     406486..406491,406498..406500,406549..406551,
                     406591..406596,406603..406605,406624..406635,
                     406642..406647,406684..406689,406717..406722,
                     406729..406734,406738..406743,406750..406755)
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(406318..406362,406624..406641)
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(406360..406362,406423..406425,406642..406644,
                     406678..406680,406687..406689,406717..406719)
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(406501..406539,406555..406560,406570..406572)
                     /gene="potI"
                     /locus_tag="PSPA7_0395"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(407064..409451)
                     /locus_tag="PSPA7_0396"
                     /db_xref="GeneID:5359654"
     CDS             complement(407064..409451)
                     /locus_tag="PSPA7_0396"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345791.1"
                     /db_xref="GI:152984103"
                     /db_xref="GeneID:5359654"
                     /translation="MKRTLTVIAVAVAAAAAGAAWYLHAKQPVRSGSLALAHLQAPVD
                     VRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLSRGELAEVLGPRLVDTD
                     RLFRTLRIRDHAAAYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRP
                     FTPEDTLSIAGYMAYSFAAAFRTEPALTYVRDELGGDYLRIFDLDWHPQGVLTPSGAL
                     GAGDWQDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRSASGKPLLAGDPHIRFAAP
                     AVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLIAEKVNPDNP
                     NQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWA
                     FLESENPVLDAFYELNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKR
                     PEGVNPSFILDGSQGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYY
                     NLADRGQWLDAQLADRSVKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREAVDDAEGK
                     RLVEQLAAWKGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDNLIATRAIDSALP
                     RLAADADSPWWDDRRTERRESRADIVKAAWAASLAHLRGTLGNDPSGWLWGKAHTLTH
                     EHALGQQPLLRRLLNVGPFAAPGTHEVPNNLSAKIGPAPWPVTYGPSTRRLVDFADPT
                     HSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
     misc_feature    complement(407094..409451)
                     /locus_tag="PSPA7_0396"
                     /note="Protein related to penicillin acylase [General
                     function prediction only]; Region: COG2366"
                     /db_xref="CDD:225241"
     misc_feature    complement(407838..408710)
                     /locus_tag="PSPA7_0396"
                     /note="Penicillin G acylase (PGA) belongs to a family of
                     beta-lactam acylases that includes cephalosporin acylase
                     (CA) and aculeacin A acylase. PGA and CA are crucial for
                     the production of backbone chemicals like
                     6-aminopenicillanic acid and...; Region: Ntn_PGA_like;
                     cd03747"
                     /db_xref="CDD:239716"
     misc_feature    complement(order(407973..407975,408168..408170,
                     408240..408242,408498..408500,408504..408506,
                     408540..408542,408639..408641,408708..408710))
                     /locus_tag="PSPA7_0396"
                     /note="active site"
                     /db_xref="CDD:239716"
     gene            409473..409592
                     /locus_tag="PSPA7_0397"
                     /db_xref="GeneID:5354290"
     CDS             409473..409592
                     /locus_tag="PSPA7_0397"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345792.1"
                     /db_xref="GI:152985933"
                     /db_xref="GeneID:5354290"
                     /translation="MASILRMPSTRGIDRMLGAWKSLVNHEEPPCRTTRPPVP"
     gene            409562..410614
                     /locus_tag="PSPA7_0399"
                     /db_xref="GeneID:5358118"
     CDS             409562..410614
                     /locus_tag="PSPA7_0399"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_001345793.1"
                     /db_xref="GI:152984755"
                     /db_xref="GeneID:5358118"
                     /translation="MQDDPSTSPLTHSATLRRLLYEAFDALGLDPTRVYRSVYRRTPL
                     PPPVLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEE
                     ALRSFVRFQHILSGGFAARLEVEGDSARLILDINYLGHASLRQQIECLMLLFLKLLAL
                     ISDDEFVAEHIEFRHPAPARLGEHRRLFGRLPLFSREHDALLFPAALLRRPSRNANPD
                     MHALLTRHAEEQSRELSENRLLNRVRYLVELRLGEGYGMRQCAAELGLGAGALQRALA
                     AGGASFRQVREEVRRQRAGEMLRAGSAIREVAKACGFAELSPFYRAFRRWYAAPPEQY
                     RARLAREERDYSTSGT"
     misc_feature    409643..410194
                     /locus_tag="PSPA7_0399"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    410234..410590
                     /locus_tag="PSPA7_0399"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     gene            complement(410593..411099)
                     /locus_tag="PSPA7_0398"
                     /db_xref="GeneID:5358169"
     CDS             complement(410593..411099)
                     /locus_tag="PSPA7_0398"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345794.1"
                     /db_xref="GI:152983783"
                     /db_xref="GeneID:5358169"
                     /translation="MSLRPTLALLAALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDL
                     ADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGN
                     VTDDQASKLIDRVEELQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEI
                     GRQVPLVE"
     gene            complement(411204..411788)
                     /locus_tag="PSPA7_0400"
                     /db_xref="GeneID:5359312"
     CDS             complement(411204..411788)
                     /locus_tag="PSPA7_0400"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345795.1"
                     /db_xref="GI:152986199"
                     /db_xref="GeneID:5359312"
                     /translation="MNAMTPRRKTLLVSLVGLLWAGGLLTAYWWFEIRYIRPFSEQTT
                     LFSGDSLRLPAGLAGPGPIRLVHFWDPACPCNVGNQQHLGELIERFAGQGVEFHVLQK
                     PGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNS
                     FIEPILEALLQGRPVNATHTLAVGCYCPWAGEKD"
     misc_feature    complement(411222..>411395)
                     /locus_tag="PSPA7_0400"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            411892..412833
                     /locus_tag="PSPA7_0401"
                     /db_xref="GeneID:5359633"
     CDS             411892..412833
                     /locus_tag="PSPA7_0401"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345796.1"
                     /db_xref="GI:152987206"
                     /db_xref="GeneID:5359633"
                     /translation="MSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRARHPDL
                     RARLGSMLVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLAC
                     DLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELALPQPWHLCGQSTGGAILLDYLL
                     HGGERPELGETILMAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPRFLDFLR
                     EHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGEADETVDWRHGLKVLREK
                     FDEPRILLLDEARHHLANESEGLRRRYFDFLSDALGA"
     misc_feature    412003..412824
                     /locus_tag="PSPA7_0401"
                     /note="Lysophospholipase [Lipid metabolism]; Region: PldB;
                     COG2267"
                     /db_xref="CDD:225176"
     misc_feature    412054..412260
                     /locus_tag="PSPA7_0401"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    412180..>412377
                     /locus_tag="PSPA7_0401"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(412853..413605)
                     /locus_tag="PSPA7_0402"
                     /db_xref="GeneID:5357867"
     CDS             complement(412853..413605)
                     /locus_tag="PSPA7_0402"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345797.1"
                     /db_xref="GI:152986088"
                     /db_xref="GeneID:5357867"
                     /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAA
                     QKRYQDKLPPALYQTLVDNSNRRFAPAEVDRRALNGLRENLPDSANPLNFFESPLGRK
                     VVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVA
                     ADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRGLSDAELTQY
                     VSFAESSAGRSYYQAALAALKAGLAVDQSVAQ"
     misc_feature    complement(413222..413398)
                     /locus_tag="PSPA7_0402"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2059); Region: DUF2059; pfam09832"
                     /db_xref="CDD:255593"
     gene            413723..414352
                     /locus_tag="PSPA7_0403"
                     /db_xref="GeneID:5355987"
     CDS             413723..414352
                     /locus_tag="PSPA7_0403"
                     /note="identified by match to protein family HMM PF03171"
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="YP_001345798.1"
                     /db_xref="GI:152984505"
                     /db_xref="GeneID:5355987"
                     /translation="MHINVDHPLLQRIVDELVDQGWSHQSVFMPERLTTRLAEECRSR
                     ACAGELTPAAIGRGDGQVIREGIRGDLTQWLEPAESAACDEYLGVMDSLRQALNASLF
                     LGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPG
                     RQLDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRDESPLLLP"
     misc_feature    413828..414319
                     /locus_tag="PSPA7_0403"
                     /note="Prolyl 4-hydroxylase alpha subunit homologues;
                     Region: P4Hc; smart00702"
                     /db_xref="CDD:214780"
     gene            complement(414368..414922)
                     /locus_tag="PSPA7_0404"
                     /db_xref="GeneID:5358572"
     CDS             complement(414368..414922)
                     /locus_tag="PSPA7_0404"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345799.1"
                     /db_xref="GI:152983473"
                     /db_xref="GeneID:5358572"
                     /translation="MFPTRSLLPYLLTSALLASGASQAAMEALDNHSLSQVTGQAGIN
                     LRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCAKAGDCPDGRGGNIPLGAAQLGLSLP
                     IFGVEQPTLALDVTTGSGGRQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLHIG
                     ENSIGRLELRDITDLRGTLKVRGH"
     gene            415187..415681
                     /locus_tag="PSPA7_0405"
                     /db_xref="GeneID:5356111"
     CDS             415187..415681
                     /locus_tag="PSPA7_0405"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF04463"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345800.1"
                     /db_xref="GI:152985494"
                     /db_xref="GeneID:5356111"
                     /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWQAQGRIVALCPEV
                     AGGLPTPRPPAEIPGGQGGEVLDRLNQVLTVDGEDVSEAFLLGAEVAVQLVRRHDIRM
                     AVLKARSPSCGNLENYDGRFNGSRIAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGL
                     DAGG"
     misc_feature    415187..415654
                     /locus_tag="PSPA7_0405"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1683"
                     /db_xref="CDD:224597"
     gene            complement(415686..416378)
                     /locus_tag="PSPA7_0406"
                     /db_xref="GeneID:5359504"
     CDS             complement(415686..416378)
                     /locus_tag="PSPA7_0406"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00528; match to protein family HMM TIGR01726"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001345801.1"
                     /db_xref="GI:152986551"
                     /db_xref="GeneID:5359504"
                     /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGL
                     VLGFSVAVVRVTKVPLVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGI
                     LALTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLS
                     NSLISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQK
                     ALENRLTAPLRR"
     misc_feature    complement(415698..416357)
                     /locus_tag="PSPA7_0406"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(415740..416294)
                     /locus_tag="PSPA7_0406"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(415746..415751,415758..415763,
                     415767..415772,415779..415784,415812..415817,
                     415854..415859,415866..415877,415896..415898,
                     415905..415910,415950..415952,416001..416003,
                     416010..416015,416025..416027,416031..416036,
                     416043..416045,416049..416051,416055..416060,
                     416124..416126,416130..416135,416142..416171,
                     416175..416186,416214..416216,416229..416234,
                     416241..416246))
                     /locus_tag="PSPA7_0406"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(415860..415877,416124..416168))
                     /locus_tag="PSPA7_0406"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(415782..415784,415812..415814,
                     415821..415823,415857..415859,416073..416075,
                     416124..416126))
                     /locus_tag="PSPA7_0406"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(415929..415931,415941..415946,
                     415962..416000))
                     /locus_tag="PSPA7_0406"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(416452..417222)
                     /locus_tag="PSPA7_0407"
                     /db_xref="GeneID:5357981"
     CDS             complement(416452..417222)
                     /locus_tag="PSPA7_0407"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00497"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter binding protein
                     subunit"
                     /protein_id="YP_001345802.1"
                     /db_xref="GI:152987979"
                     /db_xref="GeneID:5357981"
                     /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFN
                     FKQGGKLTGFETELGELLAAELKVRPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQR
                     RKVFDFSAPYTISSAQLIVRADETRQFKSLEDLKGLKLGVGQGTNYADLAKSVAGVNV
                     RTYPGAPEYLQDLASKRIDAALNDRLLIPFAIREARLPVKPGAAVGPVANMAIPYRKN
                     NPKFGEALDAALEKLKADGRFARLSEKWFGLDVSQPPK"
     misc_feature    complement(416464..417222)
                     /locus_tag="PSPA7_0407"
                     /note="cystine transporter subunit; Provisional; Region:
                     PRK11260"
                     /db_xref="CDD:183061"
     misc_feature    complement(416482..417129)
                     /locus_tag="PSPA7_0407"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(416671..416673,416782..416784,
                     416917..416919,416992..416994,417103..417105))
                     /locus_tag="PSPA7_0407"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(416692..416694,416710..416712,
                     416722..416724))
                     /locus_tag="PSPA7_0407"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(416587..416592,416596..416607))
                     /locus_tag="PSPA7_0407"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            417514..417951
                     /locus_tag="PSPA7_0408"
                     /db_xref="GeneID:5357422"
     CDS             417514..417951
                     /locus_tag="PSPA7_0408"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345803.1"
                     /db_xref="GI:152985185"
                     /db_xref="GeneID:5357422"
                     /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPAD
                     GATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFG
                     KGQTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
     misc_feature    417673..417933
                     /locus_tag="PSPA7_0408"
                     /note="Domain of unknown function (DUF4399); Region:
                     DUF4399; pfam14347"
                     /db_xref="CDD:258520"
     gene            complement(418009..419238)
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /db_xref="GeneID:5356506"
     CDS             complement(418009..419238)
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="catalyzes the formation of 3-phosphonooxypyruvate
                     from 3-phospho-D-glycerate in serine biosynthesis; can
                     also reduce alpha ketoglutarate to form
                     2-hydroxyglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="YP_001345804.1"
                     /db_xref="GI:152988887"
                     /db_xref="GeneID:5356506"
                     /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSG
                     DELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVF
                     NAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYG
                     SIGTQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQ
                     WMIGEKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEE
                     FASPLRGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPS
                     HPGKHRLLHIHANIPGVMSEINKVFADNGINVSGQYLQTNEKVGYVVIDVDAEYSDLA
                     LEKLQQVNGTIRSRVLF"
     misc_feature    complement(418012..419238)
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="D-3-phosphoglycerate dehydrogenase; Provisional;
                     Region: PRK11790"
                     /db_xref="CDD:236985"
     misc_feature    complement(418294..419208)
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="Phosphoglycerate dehydrogenases, NAD-binding and
                     catalytic domains; Region: PGDH_3; cd12176"
                     /db_xref="CDD:240653"
     misc_feature    complement(order(418915..418917,418984..418992,
                     419056..419061))
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240653"
     misc_feature    complement(order(418354..418359,418363..418365,
                     418447..418449,418519..418527,418579..418581,
                     418588..418593,418603..418611,418684..418686,
                     418693..418701,418753..418767,418903..418905,
                     418915..418917,418921..418923,418987..418989))
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240653"
     misc_feature    complement(order(418336..418338,418342..418353,
                     418357..418380,418387..418389,418393..418398,
                     418408..418413,418420..418422,418429..418434,
                     418441..418443,418720..418725,418783..418785,
                     418789..418824,418828..418830,418834..418839,
                     418846..418851,418858..418860,418864..418866,
                     418873..418878,418882..418890,418894..418899,
                     418906..418911))
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240653"
     misc_feature    complement(order(418363..418365,418432..418434,
                     418519..418521))
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240653"
     misc_feature    complement(418015..418221)
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="C-terminal ACT (regulatory) domain of
                     D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi
                     and bacteria; Region: ACT_3PGDH; cd04901"
                     /db_xref="CDD:153173"
     misc_feature    complement(order(418144..418146,418198..418200,
                     418204..418206))
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="L-serine binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153173"
     misc_feature    complement(order(418120..418140,418144..418146,
                     418171..418173,418180..418185,418192..418194,
                     418198..418200))
                     /gene="serA"
                     /locus_tag="PSPA7_0409"
                     /note="ACT domain interface; other site"
                     /db_xref="CDD:153173"
     gene            419442..420836
                     /locus_tag="PSPA7_0410"
                     /db_xref="GeneID:5357187"
     CDS             419442..420836
                     /locus_tag="PSPA7_0410"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345805.1"
                     /db_xref="GI:152988713"
                     /db_xref="GeneID:5357187"
                     /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAI
                     VFPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDFNA
                     FDRTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMT
                     RNWVAGLKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPK
                     NLTAMVLGAPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPF
                     YALLEFEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISH
                     WTPYKNDISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGK
                     DEFFAKCATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVF
                     DPNGIMNPGKLFAE"
     misc_feature    419466..420830
                     /locus_tag="PSPA7_0410"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    419562..419981
                     /locus_tag="PSPA7_0410"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    420087..420824
                     /locus_tag="PSPA7_0410"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            420928..421593
                     /locus_tag="PSPA7_0411"
                     /db_xref="GeneID:5353779"
     CDS             420928..421593
                     /locus_tag="PSPA7_0411"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01557"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345806.1"
                     /db_xref="GI:152989658"
                     /db_xref="GeneID:5353779"
                     /translation="MSYQHHYIDGTPIHFSLGKLVCVGRNYAEHARELNNPVPSEPLL
                     FIKPGSCVVPVGGGLSLPQARGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPAL
                     DLTLREVQAKLKEKGLPWELAKSFDGAGVLAPFVNADQFPDPTDIGIRLTINGEVRQD
                     GNSRDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLHSGDELVLELPGASRFET
                     RVL"
     misc_feature    420934..421590
                     /locus_tag="PSPA7_0411"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; cl11421"
                     /db_xref="CDD:264359"
     misc_feature    420937..421590
                     /locus_tag="PSPA7_0411"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     gene            421749..422681
                     /locus_tag="PSPA7_0412"
                     /db_xref="GeneID:5354658"
     CDS             421749..422681
                     /locus_tag="PSPA7_0412"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01436; match to protein family HMM PF06977"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_001345807.1"
                     /db_xref="GI:152988662"
                     /db_xref="GeneID:5354658"
                     /translation="MSLASKLPRFRWLLLAFVALVGVVLTVIMHWDDRAGLWWKESQA
                     SQQLRDESIWLPGYRVVIDAKPLQGLEEEETSDLAYNPATRTLFTVTGKRPLLVELSL
                     TGDVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTIFHVDPQTAELSTKSLAEFP
                     LGNLGKKNKGFEGIAWDRRQQRLLLSKERDPMTLFSWKSDGGPRLSGAMTALPSDDLY
                     MRNVSALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFISLLGGFNGLDSRIPRAEGV
                     AIDDDGTIYMVSEPNLFYVFRKKSGERLATSDAD"
     misc_feature    421920..422639
                     /locus_tag="PSPA7_0412"
                     /note="SdiA-regulated; Region: SdiA-regulated; cd09971"
                     /db_xref="CDD:197380"
     misc_feature    order(421974..421976,422022..422024,422097..422099,
                     422103..422105,422262..422264,422415..422417,
                     422568..422570,422613..422615)
                     /locus_tag="PSPA7_0412"
                     /note="putative active site [active]"
                     /db_xref="CDD:197380"
     gene            422765..423115
                     /locus_tag="PSPA7_0413"
                     /db_xref="GeneID:5355139"
     CDS             422765..423115
                     /locus_tag="PSPA7_0413"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF04076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345808.1"
                     /db_xref="GI:152988481"
                     /db_xref="GeneID:5355139"
                     /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAAD
                     DTPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTQVKLTGEVDRDL
                     VGREIDVEFVEVIK"
     misc_feature    422771..423112
                     /locus_tag="PSPA7_0413"
                     /note="Periplasmic protein with OB-fold [Function
                     unknown]; Region: COG3111"
                     /db_xref="CDD:225653"
     gene            complement(423196..424230)
                     /locus_tag="PSPA7_0414"
                     /db_xref="GeneID:5355757"
     CDS             complement(423196..424230)
                     /locus_tag="PSPA7_0414"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00850"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylpolyamine aminohydrolase"
                     /protein_id="YP_001345809.1"
                     /db_xref="GI:152985610"
                     /db_xref="GeneID:5355757"
                     /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRIRAVG
                     LGDVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLASGRSHDMLPIAWPTRRLRQTEP
                     DNIDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELAGGARSVFSLCRPPGHHA
                     AADYMGGYCFLNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIH
                     GDPRFEYPYFLGYADEKGKGVGEGYNCNYPLASGSDWATWSLALQAAIRQIQAYAPDV
                     LVVSLGVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFVMEGGYAVEEIGINAVN
                     VLQGFEGVHR"
     misc_feature    complement(423211..424227)
                     /locus_tag="PSPA7_0414"
                     /note="Histone deacetylase class IIa; Region:
                     HDAC_classII_APAH; cd10001"
                     /db_xref="CDD:212525"
     misc_feature    complement(order(423268..423270,423379..423381,
                     423640..423642,423646..423648,423727..423732,
                     423754..423759))
                     /locus_tag="PSPA7_0414"
                     /note="active site"
                     /db_xref="CDD:212525"
     misc_feature    complement(order(423379..423381,423640..423642,
                     423646..423648))
                     /locus_tag="PSPA7_0414"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:212525"
     gene            complement(424246..425640)
                     /locus_tag="PSPA7_0415"
                     /db_xref="GeneID:5358651"
     CDS             complement(424246..425640)
                     /locus_tag="PSPA7_0415"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00324"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="YP_001345810.1"
                     /db_xref="GI:152987528"
                     /db_xref="GeneID:5358651"
                     /translation="MASERNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYM
                     VPLTMFTTYGVVTEMTGGRTAGAYLITLAAMLFTAFSYSFMVRKYPIAGSAYSYTSLS
                     FGPCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLAAIALVTLLNVI
                     GISSVAGMSNVIVGAQFVFALVFIAMAIKHLAGIPSLDFSLPFVGDGSQPGFTPLMAG
                     AAVLCLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSV
                     FQDAESAANEVMLAAGGQFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPR
                     RVFGGLSERFQTPVIAILVVSLISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSY
                     LLLDGRRAPRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLAWFAAGLAYLAFHTGG
                     FRRKAPSVTFSEQN"
     misc_feature    complement(424303..425583)
                     /locus_tag="PSPA7_0415"
                     /note="Amino acid transporters [Amino acid transport and
                     metabolism]; Region: PotE; COG0531"
                     /db_xref="CDD:223605"
     misc_feature    complement(424477..>424968)
                     /locus_tag="PSPA7_0415"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(426099..426296)
                     /locus_tag="PSPA7_0416"
                     /db_xref="GeneID:5353963"
     CDS             complement(426099..426296)
                     /locus_tag="PSPA7_0416"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345811.1"
                     /db_xref="GI:152989551"
                     /db_xref="GeneID:5353963"
                     /translation="MRKAATVFLTASRLACSILWPPPSFCSRGVPVIIEPQQVKRAAE
                     TANPRNDNCLTAWNPLLLAKA"
     gene            complement(426296..426451)
                     /locus_tag="PSPA7_0417"
                     /db_xref="GeneID:5355006"
     CDS             complement(426296..426451)
                     /locus_tag="PSPA7_0417"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345812.1"
                     /db_xref="GI:152986763"
                     /db_xref="GeneID:5355006"
                     /translation="MDIHSIEPGAVWKRAAPDLSYANYGSRLKPSLKSASRPDHSDGS
                     EFSVRKR"
     gene            426440..427405
                     /locus_tag="PSPA7_0418"
                     /db_xref="GeneID:5359250"
     CDS             426440..427405
                     /locus_tag="PSPA7_0418"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345813.1"
                     /db_xref="GI:152984496"
                     /db_xref="GeneID:5359250"
                     /translation="MNIHARTPEPFSMSRAFTPRRLLLAVLLVALAALALLGQNFRVF
                     DRAWFAVQEWRHADAWKERSIWLPDYRVRVEAQPIEGLSDDVSALTFDPDRRTLFTVT
                     NQPAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDEREQRLVKVRLEDDTR
                     FIDAADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADK
                     PFAVHVVDDPGRDRRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSL
                     LRGMHGLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
     misc_feature    426647..427381
                     /locus_tag="PSPA7_0418"
                     /note="SdiA-regulated; Region: SdiA-regulated; cd09971"
                     /db_xref="CDD:197380"
     misc_feature    426656..427381
                     /locus_tag="PSPA7_0418"
                     /note="Esterase-like activity of phytase; Region:
                     Phytase-like; pfam13449"
                     /db_xref="CDD:257774"
     misc_feature    order(426698..426700,426746..426748,426821..426823,
                     426827..426829,426986..426988,427157..427159,
                     427310..427312,427355..427357)
                     /locus_tag="PSPA7_0418"
                     /note="putative active site [active]"
                     /db_xref="CDD:197380"
     gene            complement(427435..429378)
                     /locus_tag="PSPA7_0419"
                     /db_xref="GeneID:5358589"
     CDS             complement(427435..429378)
                     /locus_tag="PSPA7_0419"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345814.1"
                     /db_xref="GI:152986662"
                     /db_xref="GeneID:5358589"
                     /translation="MFKPLAVAVSLGCAALSSGANAYQYGEYAGETLERLITDYPGRY
                     RGTASFAGATELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKVLVLGAHYD
                     TYYGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVES
                     LDASQRANLLGMINLDSLVTGDRMYAHAGSNSVANPALGAYREQILRIARELDIPLFT
                     NPGLNAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTW
                     HDPAEDNKEVLTGAFGQERIDQRMRDFSRLLTRLVLELTNADLLASTASGGALARQME
                     DQLQRQHQALTRLHDRRWLTLLGSSRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRA
                     GVHLLGDYRYSEALTLGASLAFQRSRDKLDHGGRIEGDTWQLGLFGLYHDGGPQWLAG
                     ELNLGHTRYDSKRPVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGP
                     LAGLDYMRYRIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYA
                     SLRWVRELADGRLDDIDLTSRGDGRIRVADMGDVDKDFGRAQFGAQLAITEQLGIFAE
                     ANSRFAHSEGNQAGYSLGVNWQF"
     misc_feature    complement(428428..429378)
                     /locus_tag="PSPA7_0419"
                     /note="alkaline phosphatase isozyme conversion
                     aminopeptidase; Provisional; Region: PRK10199"
                     /db_xref="CDD:182299"
     misc_feature    complement(428437..429285)
                     /locus_tag="PSPA7_0419"
                     /note="M28 Zn-peptidases include aminopeptidases and
                     carboxypeptidases; Region: M28; cd02690"
                     /db_xref="CDD:193493"
     misc_feature    complement(order(428548..428550,428851..428853,
                     428935..428940,429034..429036,429079..429081))
                     /locus_tag="PSPA7_0419"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193493"
     misc_feature    complement(427438..428196)
                     /locus_tag="PSPA7_0419"
                     /note="Autotransporter protein or domain, integral
                     membrane beta-barrel involved in protein secretion [Cell
                     motility and secretion]; Region: COG5571"
                     /db_xref="CDD:227858"
     gene            429669..430394
                     /locus_tag="PSPA7_0420"
                     /db_xref="GeneID:5355897"
     CDS             429669..430394
                     /locus_tag="PSPA7_0420"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF00132"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="YP_001345815.1"
                     /db_xref="GI:152988022"
                     /db_xref="GeneID:5355897"
                     /translation="MNIFREALLNRRLRKALARHGCRMASGVETLRDGTLVTLEPNVK
                     LGKAKIYSPALEIGAYTDVVSGCEFMEVASIGRFCSIAAGVVIGQPRRSHPMHWLSTH
                     AFTANPKLLRKPLQPEREATPARIGHDVWIGRDALILDGVEIGTGAVVGAQSLVNRDV
                     PPYAVVAGSPARVIRYRFEPELIERLLASRWWELPLDLLGELPLDDPRACVEALERQP
                     PKARQETRRLRIRHKPFAIEWLD"
     misc_feature    429831..430253
                     /locus_tag="PSPA7_0420"
                     /note="Xenobiotic acyltransferase (XAT): The XAT class of
                     hexapeptide acyltransferases is composed of a large number
                     of microbial enzymes that catalyze the CoA-dependent
                     acetylation of a variety of hydroxyl-bearing acceptors
                     such as chloramphenicol and...; Region: LbH_XAT; cd03349"
                     /db_xref="CDD:100040"
     misc_feature    order(429846..429848,429852..429854,429906..429908,
                     429948..429953,429966..429968,429972..429974,
                     429978..429980,430053..430055,430059..430061,
                     430068..430070,430125..430127,430173..430175,
                     430197..430199)
                     /locus_tag="PSPA7_0420"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100040"
     misc_feature    order(429852..429854,429858..429860,429945..429950,
                     429954..429956,429981..429986,430059..430061,
                     430068..430070,430119..430124,430137..430139,
                     430161..430163,430167..430172,430176..430178,
                     430188..430190)
                     /locus_tag="PSPA7_0420"
                     /note="active site"
                     /db_xref="CDD:100040"
     misc_feature    order(429852..429854,429858..429860,429945..429947,
                     429981..429986)
                     /locus_tag="PSPA7_0420"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100040"
     misc_feature    order(429948..429950,429954..429956,430029..430031,
                     430059..430061,430068..430070,430083..430085,
                     430119..430124,430137..430139,430161..430163,
                     430167..430172,430176..430178,430188..430190)
                     /locus_tag="PSPA7_0420"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100040"
     gene            complement(430431..430763)
                     /locus_tag="PSPA7_0421"
                     /db_xref="GeneID:5355653"
     CDS             complement(430431..430763)
                     /locus_tag="PSPA7_0421"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF07411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345816.1"
                     /db_xref="GI:152984348"
                     /db_xref="GeneID:5355653"
                     /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALNGID
                     SVRKNAQRDGAFEVKPASNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAP
                     EAGLSDES"
     misc_feature    complement(430587..430763)
                     /locus_tag="PSPA7_0421"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3422"
                     /db_xref="CDD:225956"
     misc_feature    complement(430437..430583)
                     /locus_tag="PSPA7_0421"
                     /note="Domain of unknown function (DUF1508); Region:
                     DUF1508; pfam07411"
                     /db_xref="CDD:254192"
     gene            complement(430887..431558)
                     /gene="rpiA"
                     /locus_tag="PSPA7_0422"
                     /db_xref="GeneID:5358389"
     CDS             complement(430887..431558)
                     /gene="rpiA"
                     /locus_tag="PSPA7_0422"
                     /EC_number="5.3.1.6"
                     /note="Catalyzes D-ribose 5-phosphate --> D-ribulose
                     5-phosphate in the nonoxidative branch of the pentose
                     phosphate pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase A"
                     /protein_id="YP_001345817.1"
                     /db_xref="GI:152985055"
                     /db_xref="GeneID:5358389"
                     /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALA
                     RHKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGA
                     ALTREKIVAAVARTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVY
                     REGVLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGV
                     QTLKA"
     misc_feature    complement(430917..431543)
                     /gene="rpiA"
                     /locus_tag="PSPA7_0422"
                     /note="RPI_A: Ribose 5-phosphate isomerase type A (RPI_A)
                     subfamily; RPI catalyzes the reversible conversion of
                     ribose-5-phosphate to ribulose 5-phosphate, the first step
                     of the non-oxidative branch of the pentose phosphate
                     pathway. This reaction leads to the...; Region: RPI_A;
                     cd01398"
                     /db_xref="CDD:238692"
     misc_feature    complement(order(431046..431048,431058..431060,
                     431064..431066,431073..431078,431256..431261,
                     431340..431342,431346..431348,431373..431378,
                     431385..431387,431463..431465))
                     /gene="rpiA"
                     /locus_tag="PSPA7_0422"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238692"
     misc_feature    complement(order(431184..431186,431238..431240,
                     431256..431267,431295..431297,431301..431306,
                     431454..431459,431463..431465))
                     /gene="rpiA"
                     /locus_tag="PSPA7_0422"
                     /note="active site"
                     /db_xref="CDD:238692"
     misc_feature    complement(order(430968..430970,430983..430988,
                     431112..431114,431121..431129,431133..431138,
                     431220..431222,431241..431243,431325..431327,
                     431337..431339))
                     /gene="rpiA"
                     /locus_tag="PSPA7_0422"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238692"
     gene            431817..433331
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /db_xref="GeneID:5357746"
     CDS             431817..433331
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /EC_number="4.3.1.19"
                     /note="threonine deaminase; threonine dehydratase; in
                     Escherichia coli, IlvA is part of the isoleucine
                     biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="YP_001345818.1"
                     /db_xref="GI:152989630"
                     /db_xref="GeneID:5357746"
                     /translation="MLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQVLLKREDL
                     QPVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRAVIVMPKTT
                     PEIKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTIAGQGTVAM
                     EILRQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGE
                     RVVLGQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITE
                     PAGALAVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGERREAIIAVT
                     IPERPGSFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREALVAYLREK
                     GFPVLDLTDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLTKLGGRWNI
                     SMFHYRNHGAADGRVVAGLQVPEDERQLIPQTLEAIGYPYWDETDNPAYQLFLG"
     misc_feature    431817..433328
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="threonine dehydratase; Reviewed; Region: PRK09224"
                     /db_xref="CDD:236417"
     misc_feature    431832..432746
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="Threonine dehydratase: The first step in amino acid
                     degradation is the removal of nitrogen. Although the
                     nitrogen atoms of most amino acids are transferred to
                     alpha-ketoglutarate before removal, the alpha-amino group
                     of threonine can be directly...; Region: Thr-dehyd;
                     cd01562"
                     /db_xref="CDD:107205"
     misc_feature    order(431832..431837,431844..431846,431853..431858,
                     431943..431948,432387..432392,432597..432599,
                     432606..432611,432618..432620,432630..432638,
                     432735..432746)
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107205"
     misc_feature    order(431967..431969,432048..432050,432348..432362,
                     432729..432731)
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107205"
     misc_feature    431967..431969
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107205"
     misc_feature    432798..433052
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="First of two tandem C-terminal ACT domains of
                     threonine dehydratase I (ThrD-I; L-threonine hydrolyase);
                     Region: ACT_ThrD-I_1; cd04906"
                     /db_xref="CDD:153178"
     misc_feature    432834..432851
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="putative Ile/Val binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153178"
     misc_feature    433083..433325
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="Second of two tandem C-terminal ACT domains of
                     threonine dehydratase I (ThrD-I; L-threonine hydrolyase);
                     Region: ACT_ThrD-I_2; cd04907"
                     /db_xref="CDD:153179"
     misc_feature    433119..433136
                     /gene="ilvA2"
                     /locus_tag="PSPA7_0423"
                     /note="putative Ile/Val binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153179"
     gene            433450..433917
                     /locus_tag="PSPA7_0424"
                     /db_xref="GeneID:5354630"
     CDS             433450..433917
                     /locus_tag="PSPA7_0424"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345819.1"
                     /db_xref="GI:152984056"
                     /db_xref="GeneID:5354630"
                     /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRSADAARIARG
                     FRRIRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLLLAG
                     RLARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
     misc_feature    433453..433914
                     /locus_tag="PSPA7_0424"
                     /note="Predicted integral membrane protein (DUF2269);
                     Region: DUF2269; cl02335"
                     /db_xref="CDD:261249"
     gene            433968..435239
                     /locus_tag="PSPA7_0425"
                     /db_xref="GeneID:5358917"
     CDS             433968..435239
                     /locus_tag="PSPA7_0425"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345820.1"
                     /db_xref="GI:152985160"
                     /db_xref="GeneID:5358917"
                     /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPADAPAGARW
                     LALDLERLAERPDSFAWPAGVDLLVNAAGVMSLDEASMARVQDSGARALFDLAAGHGA
                     KILQISALGAGEHPDVPFLASKAAADRHLLGLGIAALVLRPSLLLGPGGASSAWLERL
                     SPLPLIPLLDNRARLQPLHVDDLVGAVLALLRDWPERAQVIPLVGPQALTQGELLDRL
                     RRAQGWPRGRYLVPPAALLDALGGLGRRLGWRVLSPPMLKLVRQDNLADPAILQAACG
                     YRCAPLSSRLLGWPQAQNALASLLRPLMLAALVLIWLGTLVACLGPGYAWGLSILGEA
                     GIHGWPASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLVISLILPHYWY
                     DPYMAVGKNLVLMVATLWLLGGEPRAKEARG"
     misc_feature    433968..434774
                     /locus_tag="PSPA7_0425"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    433968..434759
                     /locus_tag="PSPA7_0425"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(433986..433988,433992..433997,434001..434003,
                     434058..434066,434178..434186,434286..434294,
                     434325..434327,434337..434339,434394..434405)
                     /locus_tag="PSPA7_0425"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(434223..434225,434292..434294,434325..434327,
                     434337..434339)
                     /locus_tag="PSPA7_0425"
                     /note="active site"
                     /db_xref="CDD:187535"
     misc_feature    434886..435194
                     /locus_tag="PSPA7_0425"
                     /note="DoxX-like family; Region: DoxX_3; pfam13781"
                     /db_xref="CDD:258065"
     gene            435236..435703
                     /locus_tag="PSPA7_0427"
                     /db_xref="GeneID:5354782"
     CDS             435236..435703
                     /locus_tag="PSPA7_0427"
                     /note="Annotation was generated automatically without
                     manual curation"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_001345821.1"
                     /db_xref="GI:152985308"
                     /db_xref="GeneID:5354782"
                     /translation="MNLYLLLKTLHILSSTILFGTGLGSAYYALRAWRSGQLPVIAVT
                     FRHLVTADWLFIATTAVFQPLSGLAMVHVAGWPLTQGWLLWSLGLYVFAGLCWLPVVW
                     LQIRVRDMAESALREARPIEPLAHRYMRAWFILGWPAFIAFMAIFYLMVNKPV"
     misc_feature    435248..435697
                     /locus_tag="PSPA7_0427"
                     /note="Predicted integral membrane protein (DUF2269);
                     Region: DUF2269; pfam10027"
                     /db_xref="CDD:255706"
     gene            complement(435676..436875)
                     /locus_tag="PSPA7_0426"
                     /db_xref="GeneID:5353657"
     CDS             complement(435676..436875)
                     /locus_tag="PSPA7_0426"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="YP_001345822.1"
                     /db_xref="GI:152989143"
                     /db_xref="GeneID:5353657"
                     /translation="MIVALVTALCLAGDSMLYIALPIYWREVGLEALWQVGVLLSINR
                     LIRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFLAWVLLRGLWGIGWS
                     FFRIGGLSAVVYCAADHQRGRAMGLYNGLYRLGSLVGMLLGGLLVPVLGLPALALSFA
                     ILALLGLPLLAKGFVLPENPAGHARPPAATASTSVARLPPPRGLVILSGFGTALLIQG
                     VLAATLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPWLAGRFGAWSDGPRG
                     RQGYYVAALLAGALGFGLLSTALPILAWLALALLVMLVATALTTLTDALAADVARAGD
                     VVGFMTRYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAFLLLALLWLRRTNPQ
                     TGLLTIR"
     misc_feature    complement(<436480..436872)
                     /locus_tag="PSPA7_0426"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(435814..436869)
                     /locus_tag="PSPA7_0426"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            complement(436967..437620)
                     /locus_tag="PSPA7_0428"
                     /db_xref="GeneID:5356202"
     CDS             complement(436967..437620)
                     /locus_tag="PSPA7_0428"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345823.1"
                     /db_xref="GI:152988986"
                     /db_xref="GeneID:5356202"
                     /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFY
                     ADYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMREVIEPIVLAKGEALLAEHRA
                     AGDRLVIITATNRFVTGPIAERLGVDTLIATECEMRDGRYTGQTFDVPCFQGGKVVRL
                     QRWLDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR"
     misc_feature    complement(436979..437620)
                     /locus_tag="PSPA7_0428"
                     /note="Phosphoserine phosphatase [Amino acid transport and
                     metabolism]; Region: SerB; COG0560"
                     /db_xref="CDD:223634"
     misc_feature    complement(<437222..437620)
                     /locus_tag="PSPA7_0428"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase; pfam00702"
                     /db_xref="CDD:250068"
     gene            437824..438303
                     /locus_tag="PSPA7_0429"
                     /db_xref="GeneID:5357021"
     CDS             437824..438303
                     /locus_tag="PSPA7_0429"
                     /note="hydrolyzes diadenosine polyphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="dinucleoside polyphosphate hydrolase"
                     /protein_id="YP_001345824.1"
                     /db_xref="GI:152988563"
                     /db_xref="GeneID:5357021"
                     /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRE
                     TPEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLL
                     RLMSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
     misc_feature    437839..438276
                     /locus_tag="PSPA7_0429"
                     /note="Diadenosine tetraphosphate (Ap4A) hydrolase is a
                     member of the Nudix hydrolase superfamily. Members of this
                     family are well represented in a variety of prokaryotic
                     and eukaryotic organisms. Phylogenetic analysis reveals
                     two distinct subgroups where plant...; Region:
                     Ap4A_hydrolase_plant_like; cd03671"
                     /db_xref="CDD:239643"
     misc_feature    order(437851..437853,437902..437904,437911..437913,
                     437923..437925,437932..437937,437980..437982,
                     437989..437994,438052..438054,438058..438060,
                     438070..438072,438079..438084,438106..438108,
                     438232..438234,438238..438243)
                     /locus_tag="PSPA7_0429"
                     /note="putative active site [active]"
                     /db_xref="CDD:239643"
     misc_feature    order(437851..437853,437902..437904,437911..437913,
                     437923..437925,437932..437937,438052..438054,
                     438058..438060,438070..438072,438079..438084,
                     438106..438108,438232..438234,438238..438243)
                     /locus_tag="PSPA7_0429"
                     /note="Ap4A binding site [chemical binding]; other site"
                     /db_xref="CDD:239643"
     misc_feature    437935..438003
                     /locus_tag="PSPA7_0429"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239643"
     misc_feature    order(437980..437982,437989..437994)
                     /locus_tag="PSPA7_0429"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239643"
     gene            438327..440606
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /db_xref="GeneID:5356904"
     CDS             438327..440606
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00391; match to protein family HMM PF01590; match to
                     protein family HMM PF02896; match to protein family HMM
                     PF05524; match to protein family HMM TIGR01417"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase
                     PtsP"
                     /protein_id="YP_001345825.1"
                     /db_xref="GI:152984743"
                     /db_xref="GeneID:5356904"
                     /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLD
                     TETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAET
                     GEERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEAT
                     GSIRGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIAL
                     FKQALEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQ
                     GALRQVVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVS
                     EELSPAMLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDL
                     IVDGYHGEVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTG
                     LLADVARAQERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTL
                     DIGGDKALSYFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPM
                     ISGTHELEEALHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSV
                     GSNDLTQYLLAVDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDP
                     AAAVLLMAMGFDSLSMNATNLPKVKWLLRQISLDKARDLLGQLLTFDNPQVIHSSLHL
                     ALRNLGLGRVINPAATVQS"
     misc_feature    438327..440591
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /note="Signal transduction protein containing GAF and PtsI
                     domains [Signal transduction mechanisms]; Region: PtsP;
                     COG3605"
                     /db_xref="CDD:226133"
     misc_feature    438375..438818
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    438912..439232
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    439305..439520
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    439596..440465
                     /gene="ptsP"
                     /locus_tag="PSPA7_0430"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            440724..441761
                     /locus_tag="PSPA7_0431"
                     /db_xref="GeneID:5354832"
     CDS             440724..441761
                     /locus_tag="PSPA7_0431"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345826.1"
                     /db_xref="GI:152987947"
                     /db_xref="GeneID:5354832"
                     /translation="MDERASKPPGLLPLSREDLEKTLRYALEIVSDGIWDWNIATNQV
                     SRSAGWYLMLGYPPNSLPESVDTWKGIIHPEDYPGVMASFQAYLDGESPEYCEEYRCR
                     TYSGDYLWISDRGRFVEFDERGEPRRMIGAHHEIHQRKLVELELQQRNEELFDWNLRL
                     EELVAERTEALHRVNQALALKMAEAQRLSEIDPLTGLYNRRKFEQCLHQEWMRRQRHG
                     RSTALVMIDIDHFKRINDLFGHSIGDSVLVDFGHLIAGELREVDVLARWGGEEFILLL
                     PETALEAAAALAERLRQRVRGQPFEVCGRLTASFGVGVLDDGETLDLLLCRVDDALYR
                     AKQRRDCVTCC"
     misc_feature    440814..441131
                     /locus_tag="PSPA7_0431"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    440850..441122
                     /locus_tag="PSPA7_0431"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(440853..440855,440865..440867,440889..440891,
                     440934..440945,441024..441026,441039..441041)
                     /locus_tag="PSPA7_0431"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(440925..440927,440937..440939,440961..440963,
                     440970..440975,441063..441065,441069..441071)
                     /locus_tag="PSPA7_0431"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    441294..441749
                     /locus_tag="PSPA7_0431"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(441402..441404,441531..441533)
                     /locus_tag="PSPA7_0431"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(441417..441419,441426..441431,441441..441443,
                     441453..441455,441519..441521,441525..441536)
                     /locus_tag="PSPA7_0431"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(441507..441509,441591..441593)
                     /locus_tag="PSPA7_0431"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(441766..442521)
                     /locus_tag="PSPA7_0432"
                     /db_xref="GeneID:5357390"
     CDS             complement(441766..442521)
                     /locus_tag="PSPA7_0432"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345827.1"
                     /db_xref="GI:152987011"
                     /db_xref="GeneID:5357390"
                     /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFA
                     GRDLEAGGTWLGLGPAGRFAALTNVRDPSQPLGKRSRGELVADFLRDGGNPADYLARV
                     AERAADYSGFNLLVGDRHQLWHYNPRVGPPLLLPAGVYGLSNAALDSPWPKLLKARAA
                     LAERLAEPHPHALLELLADPQPATDGQLPDTGVGLATERLLSSVFIASPSYGTRASTA
                     LRVHADGSREIVERSFGPSGARLGEVSLVLPPD"
     misc_feature    complement(441769..442521)
                     /locus_tag="PSPA7_0432"
                     /note="NRDE protein; Region: NRDE; cl01315"
                     /db_xref="CDD:260880"
     gene            442643..443425
                     /locus_tag="PSPA7_0433"
                     /db_xref="GeneID:5354415"
     CDS             442643..443425
                     /locus_tag="PSPA7_0433"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01925"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345828.1"
                     /db_xref="GI:152985930"
                     /db_xref="GeneID:5354415"
                     /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGD
                     VLTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIK
                     GPLLQKIIGVFAILVALQMTLDLKPRGRHEVPGKGGLTVAGAVIGWASAIFGIGGGSL
                     TVPFLSWRGVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALV
                     GIAATSMLFARFGARLAHRLSPRGLKRLFALLLFSVGVSFLI"
     misc_feature    442658..443416
                     /locus_tag="PSPA7_0433"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            443449..444249
                     /gene="lgt"
                     /locus_tag="PSPA7_0434"
                     /db_xref="GeneID:5359479"
     CDS             443449..444249
                     /gene="lgt"
                     /locus_tag="PSPA7_0434"
                     /EC_number="2.4.99.-"
                     /note="transfers the N-acyl diglyceride moiety to the
                     prospective N-terminal cysteine in prolipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="YP_001345829.1"
                     /db_xref="GI:152986842"
                     /db_xref="GeneID:5359479"
                     /translation="MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRF
                     DPSWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGL
                     LGVMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMV
                     FPNGGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEF
                     VRVPDAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA"
     misc_feature    443449..444246
                     /gene="lgt"
                     /locus_tag="PSPA7_0434"
                     /note="prolipoprotein diacylglyceryl transferase;
                     Reviewed; Region: PRK00052"
                     /db_xref="CDD:234599"
     gene            444263..444382
                     /locus_tag="PSPA7_0435"
                     /db_xref="GeneID:5359753"
     CDS             444263..444382
                     /locus_tag="PSPA7_0435"
                     /note="Annotation was generated automatically without
                     manual curation; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345830.1"
                     /db_xref="GI:152984773"
                     /db_xref="GeneID:5359753"
                     /translation="MVGADNVAGVIRSGRPAFPARARMACAGRGELAMQPPPP"
     gene            444458..445252
                     /gene="thyA"
                     /locus_tag="PSPA7_0436"
                     /db_xref="GeneID:5358021"
     CDS             444458..445252
                     /gene="thyA"
                     /locus_tag="PSPA7_0436"
                     /EC_number="2.1.1.45"
                     /note="ThyA; catalyzes formation of dTMP and
                     7,8-dihydrofolate from 5,10-methylenetetrahydrofolate and
                     dUMP; involved in deoxyribonucleotide biosynthesis; there
                     are 2 copies in some Bacilli, one of which appears to be
                     phage-derived"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="YP_001345831.1"
                     /db_xref="GI:152988193"
                     /db_xref="GeneID:5358021"
                     /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFDLAAGFPL
                     VTTKKCHLKSIVHELLWFLQGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWP
                     APDGRHIDQIANLMTMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLS
                     CQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLRPGEFIWTGGDCHLYANHLEQADL
                     QLTREPLPLPSMKLNPEVKDLFDFRFEDFELVGYQAHPHIKAPVAV"
     misc_feature    444464..445105
                     /gene="thyA"
                     /locus_tag="PSPA7_0436"
                     /note="Thymidylate synthase and pyrimidine
                     hydroxymethylase: Thymidylate synthase (TS) and
                     deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs
                     that catalyze analogous alkylation of C5 of pyrimidine
                     nucleotides. Both enzymes are involved in the...; Region:
                     TS_Pyrimidine_HMase; cd00351"
                     /db_xref="CDD:238211"
     misc_feature    order(444503..444505,444515..444517,444539..444541,
                     444545..444547,444833..444838,444857..444862,
                     444902..444904,444908..444910,444920..444922,
                     444947..444949,444953..444958,445067..445072)
                     /gene="thyA"
                     /locus_tag="PSPA7_0436"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238211"
     misc_feature    order(444518..444520,444629..444631,444695..444697,
                     444704..444706,444737..444739,444893..444898,
                     444950..444958,444962..444964,444983..444988,
                     445076..445078,445082..445084)
                     /gene="thyA"
                     /locus_tag="PSPA7_0436"
                     /note="active site"
                     /db_xref="CDD:238211"
     gene            complement(445289..446665)
                     /locus_tag="PSPA7_0437"
                     /db_xref="GeneID:5357332"
     CDS             complement(445289..446665)
                     /locus_tag="PSPA7_0437"
                     /note="Annotation was generated automatically without
                     manual curation; identified by match to protein family HMM
                     PF01926"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345832.1"
                     /db_xref="GI:152989187"
                     /db_xref="GeneID:5357332"
                     /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVE
                     GARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGR
                     FEQESKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPRHR
                     EEEWRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHEAQA
                     AARLRAGQRLIAELLVDVAACRRLVASAESAVQEATRDLHQQVRKREQACVEALLRLY
                     AFARDDARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVT
                     LGAAAALGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQT
                     RGHAALEAIRLETPEDRQWREGKLPEALRKARAHPEWSSLNGRRAGGGDRQEQIDALA
                     EHLADSGE"
     misc_feature    complement(446075..446644)
                     /locus_tag="PSPA7_0437"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cd00882"
                     /db_xref="CDD:206648"
     misc_feature    complement(446612..446635)
                     /locus_tag="PSPA7_0437"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(order(446114..446122,446201..446203,
                     446207..446212,446477..446479,446609..446629))
                     /locus_tag="PSPA7_0437"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    complement(446546..446548)
                     /locus_tag="PSPA7_0437"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(446528..446536)
                     /locus_tag="PSPA7_0437"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(446477..446488)
                     /locus_tag="PSPA7_0437"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(order(446312..446317,446477..446482))
                     /locus_tag="PSPA7_0437"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(446201..446212)
                     /locus_tag="PSPA7_0437"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(445307..446173)
                     /locus_tag="PSPA7_0437"
                     /note="Domain of unknown function (DUF3482); Region:
                     DUF3482; pfam11981"
                     /db_xref="CDD:256774"
     misc_feature    complement(446114..446122)
                     /locus_tag="PSPA7_0437"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     gene            complement(446658..448037)
                     /locus_tag="PSPA7_0438"
                     /db_xref="GeneID:5358837"
     CDS             complement(446658..448037)
                     /locus_tag="PSPA7_0438"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345833.1"
                     /db_xref="GI:152989401"
                     /db_xref="GeneID:5358837"
                     /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEAVRQALAQGGSL
                     PRRILTRAHWLGRREGLLEAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPV
                     NVFWALASLLGLHLLTLLGWAIGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPAL
                     LVLLGRRRLARWGLGALVHGLWLLGLLAALALLLGLLATRRYGFVWETTILGSDTFVG
                     LTQALGALPALLGFPLPDAELIRASGDAALAGETARHAWAGWLVGVLLVYGVLPRLLL
                     GLFCLWRWKRGLAGLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSAQ
                     EAAGAVLVAVDDRRPWPPKLAEGIADAGILDDGQQRRRLLEQLTRYPPARLAIACDPR
                     RSPDRGSLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHAALERLQLPHGETSP
                     LAWLETGHD"
     misc_feature    complement(446706..447626)
                     /locus_tag="PSPA7_0438"
                     /note="Protein of unknown function (DUF2868); Region:
                     DUF2868; pfam11067"
                     /db_xref="CDD:256273"
     gene            448225..448587
                     /locus_tag="PSPA7_0439"
                     /db_xref="GeneID:5356318"
     CDS             448225..448587
                     /locus_tag="PSPA7_0439"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345834.1"
                     /db_xref="GI:152983781"
                     /db_xref="GeneID:5356318"
                     /translation="MKVVRRWPLALWLAMTGTLADELPDGSLLQRYGVAADQLPALTA
                     EPQPRKEKVEAPARFRLAPEQPLVTFGVKEPQDAEPTGNPSIDAMHERDRRLCRRIRQ
                     EALEKGKASPFDSYIGCP"
     gene            complement(448624..449781)
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /db_xref="GeneID:5359310"
     CDS             complement(448624..449781)
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF03009"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="YP_001345835.1"
                     /db_xref="GI:152986769"
                     /db_xref="GeneID:5359310"
                     /translation="MQSAFLRRQLGAACLLLAAGLASAASASADTGNVQRAIDWAQGQ
                     ASARHPAGQERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYIEPDLVMTRDGKMVA
                     RHDNELGLTTDVARHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIR
                     PGNARLDGTFEIPTLQEIIDLVKSLQISQQRSIGLYPEIKHGTHFQRLGLAMERPLVK
                     TLHRNGYLGPSAPVFIQSFEVNNLKELKRLTGIRLIQLYGSGQPYDQQATGGSLTYAE
                     MATAKGLRQVARYAYGVGPDKSYVIPRDANDNLGQPTRFVGDAHAAGLKVHPYTFRAE
                     NSFLPAEFRSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
     misc_feature    complement(448645..449649)
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /note="glycerophosphodiester phosphodiesterase;
                     Provisional; Region: glpQ; PRK11143"
                     /db_xref="CDD:236859"
     misc_feature    complement(448657..449613)
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /note="Glycerophosphodiester phosphodiesterase domain of
                     Streptomycin coelicolor (GlpQ1) and similar proteins;
                     Region: GDPD_ScGlpQ1_like; cd08602"
                     /db_xref="CDD:176544"
     misc_feature    complement(order(448795..448797,449077..449079,
                     449188..449190,449470..449472,449509..449511,
                     449515..449517,449596..449598))
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /note="putative active site [active]"
                     /db_xref="CDD:176544"
     misc_feature    complement(order(449470..449472,449596..449598))
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176544"
     misc_feature    complement(order(449188..449190,449509..449511,
                     449515..449517))
                     /gene="glpQ"
                     /locus_tag="PSPA7_0440"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176544"
     gene            449992..451086
                     /locus_tag="PSPA7_0441"
                     /db_xref="GeneID:5359256"
     CDS             449992..451086
                     /locus_tag="PSPA7_0441"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345836.1"
                     /db_xref="GI:152989007"
                     /db_xref="GeneID:5359256"
                     /translation="MASPQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARAE
                     ARVPTAATDDWGRQPDSLMSGVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGF
                     FIRRMLIRMEPSRPGTPLLLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVR
                     NLRMSTRKDGQEVRGELLRKGRWRPLRMLTEIEPSGPLEVTLIPRRIFVDGVEVTSSL
                     AAASIEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGLQLALGD
                     PLDSLQWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPERPLLFNLYDYRRQL
                     QNGVIRLREDGMVQIAVSPVKAPAPLEARL"
     gene            451083..452126
                     /locus_tag="PSPA7_0442"
                     /db_xref="GeneID:5357753"
     CDS             451083..452126
                     /locus_tag="PSPA7_0442"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345837.1"
                     /db_xref="GI:152989512"
                     /db_xref="GeneID:5357753"
                     /translation="MSRRPWGVPLLGCCLLAAGAAQAESAIDRQQRELALLREGWYRQ
                     VPPAPLPLPMRAAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPV
                     DFDRPQDMHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRV
                     RPFGVGPWLPLRLGGGVEVDAGSGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLD
                     RPGASLVGSAMRLDYRKVFPLLGIDGQVQEAWLDDQGLHLRFSQAPGRPSPVFSPPAV
                     AGPSFLWLQSGDLKIFEILITYAQVLLKTEKPEQVLTFNLRDYRKVLATGTTQVNEDG
                     TFFMQVPPYANPL"
     gene            452209..452715
                     /gene="folA"
                     /locus_tag="PSPA7_0443"
                     /db_xref="GeneID:5356833"
     CDS             452209..452715
                     /gene="folA"
                     /locus_tag="PSPA7_0443"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00186"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="YP_001345838.1"
                     /db_xref="GI:152984387"
                     /db_xref="GeneID:5356833"
                     /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVI
                     MGRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALVRAEEWAQAEDADELM
                     LIGGAQLYAEALPRAERLYLTRVGLAPEGDAFFPEIDDAGWRLASSIEHAAADDAPAY
                     AFEVWERR"
     misc_feature    452221..452661
                     /gene="folA"
                     /locus_tag="PSPA7_0443"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cd00209"
                     /db_xref="CDD:238127"
     misc_feature    order(452230..452232,452281..452283,452296..452298,
                     452386..452388,452518..452520,452536..452538,
                     452575..452577)
                     /gene="folA"
                     /locus_tag="PSPA7_0443"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    order(452236..452238,452257..452259,452347..452355,
                     452407..452409,452521..452532)
                     /gene="folA"
                     /locus_tag="PSPA7_0443"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     gene            complement(452731..453204)
                     /locus_tag="PSPA7_0444"
                     /db_xref="GeneID:5359174"
     CDS             complement(452731..453204)
                     /locus_tag="PSPA7_0444"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00149; match to protein family HMM TIGR00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345839.1"
                     /db_xref="GI:152988065"
                     /db_xref="GeneID:5359174"
                     /translation="MPQSRRPLRIGLIADTHGLLRPEALERLRGCDQLIHAGDIGKPE
                     ILAELERLAPLSVVRGNNDTQDWAADIPERLLLKIGRLTLYVLHDLKRLDLDPAAEGI
                     DVVVAGHSHKPLKEERDGVLYLNPGSAGPRRFSLPIGIGVLEVAGKKVEAQLITL"
     misc_feature    complement(452740..453180)
                     /locus_tag="PSPA7_0444"
                     /note="Escherichia coli YfcE and related proteins,
                     metallophosphatase domain; Region: MPP_YfcE; cd00841"
                     /db_xref="CDD:163617"
     misc_feature    complement(order(452872..452874,452878..452880,
                     452941..452943,453019..453024,453088..453090,
                     453154..453156,453160..453162))
                     /locus_tag="PSPA7_0444"
                     /note="active site"
                     /db_xref="CDD:163617"
     misc_feature    complement(order(452872..452874,452878..452880,
                     452941..452943,453022..453024,453088..453090,
                     453154..453156,453160..453162))
                     /locus_tag="PSPA7_0444"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163617"
     misc_feature    complement(order(452956..452991,453016..453030,
                     453037..453039,453106..453111))
                     /locus_tag="PSPA7_0444"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163617"
     gene            complement(453342..454727)
                     /locus_tag="PSPA7_0445"
                     /db_xref="GeneID:5355696"
     CDS             complement(453342..454727)
                     /locus_tag="PSPA7_0445"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF00860; match to protein family HMM TIGR00801; match to
                     protein family HMM TIGR03173"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="YP_001345840.1"
                     /db_xref="GI:152987871"
                     /db_xref="GeneID:5355696"
                     /translation="MSSLQSPSDASPRNDLVYGLDDRPSAPIALLAALQHLLAIIVPI
                     VTPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFV
                     GPLIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVV
                     LMIGLTLIKVGLISMGGGFSAMSDGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCA
                     IVIALAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSL
                     EAIGDVTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVI
                     QLTGVASRYIGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINIL
                     AGIQLDRRALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWF
                     LPESPAQRAEQ"
     misc_feature    complement(453345..454691)
                     /locus_tag="PSPA7_0445"
                     /note="Xanthine/uracil permeases [Nucleotide transport and
                     metabolism]; Region: UraA; COG2233"
                     /db_xref="CDD:225142"
     misc_feature    complement(453474..454442)
                     /locus_tag="PSPA7_0445"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     gene            complement(454951..456789)
                     /gene="ilvD"
                     /locus_tag="PSPA7_0446"
                     /db_xref="GeneID:5357048"
     CDS             complement(454951..456789)
                     /gene="ilvD"
                     /locus_tag="PSPA7_0446"
                     /EC_number="4.2.1.9"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_001345841.1"
                     /db_xref="GI:152989486"
                     /db_xref="GeneID:5357048"
                     /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFT
                     QFVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIAD
                     SVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLASHGL
                     DLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGS
                     TLATHADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIANFKAFENAMTLDIAMGGS
                     TNTILHLLAAAQEAEVPFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSIL
                     GELARGGLLHTDVATVHSPSMADAIARWDITQTRDEAVHTFFKAGPAGIPTQTAFSQN
                     TRWPSLDDDRAEGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGRA
                     KIFESQDAAVKGILGDEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCAL
                     LTDGRFSGGTSGLSIGHASPEAAAGGAIGLVQDGDKVLIDIPNRSINLLVSDEELAAR
                     RAEQDRKGWKPAAPRARRVSTALKAYALLATSADKGAVRNKALLDG"
     misc_feature    complement(454954..456786)
                     /gene="ilvD"
                     /locus_tag="PSPA7_0446"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK12448"
                     /db_xref="CDD:237104"
     gene            complement(457117..458313)
                     /locus_tag="PSPA7_0447"
                     /db_xref="GeneID:5356807"
     CDS             complement(457117..458313)
                     /locus_tag="PSPA7_0447"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF02475; match to protein family HMM PF03602; match to
                     protein family HMM PF05175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345842.1"
                     /db_xref="GI:152988111"
                     /db_xref="GeneID:5356807"
                     /translation="MTLPSLRLKANAERRLRAGHLWVYSNEVDVAATPLNAFAAGDQA
                     VLEMANGKPLGVVALSPNNLICGRLISRDTKHVLDKSLLVHRINIALSLRERLFDKPF
                     YRLVYGDSDLLPGLVVDRFGDVLVVQLASAAMELRKDEVLAALLQVLKPAAVLWKNDS
                     SARDAEGLERYVANAYGEVPEWVALEENGVRFEAPVLAGQKTGWFYDHRMNRARLAPY
                     VQGKRVLDLFSYIGGWGIQAAAFGASEVMCVDASAFALDGVERNAALNGVAEKVACVE
                     GDVFEALRELKAADERFDVVIADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLSKDGIL
                     VSASCSMHLPENDLQDILIGSARHLDRNIQLLERGGQGPDHPVHLAIPETRYIKSLTC
                     RLLPNG"
     misc_feature    complement(457129..458298)
                     /locus_tag="PSPA7_0447"
                     /note="Predicted SAM-dependent methyltransferases [General
                     function prediction only]; Region: COG1092"
                     /db_xref="CDD:224017"
     misc_feature    complement(457783..458073)
                     /locus_tag="PSPA7_0447"
                     /note="Middle domain of the SAM-dependent
                     methyltransferase RlmI and related proteins; Region:
                     RlmI_M_like; cd11572"
                     /db_xref="CDD:211413"
     misc_feature    complement(order(457930..457932,458002..458004))
                     /locus_tag="PSPA7_0447"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:211413"
     misc_feature    complement(457309..457647)
                     /locus_tag="PSPA7_0447"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(457417..457419,457477..457485,
                     457561..457566,457615..457635))
                     /locus_tag="PSPA7_0447"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(458386..458925)
                     /gene="pfpI"
                     /locus_tag="PSPA7_0448"
                     /db_xref="GeneID:5353686"
     CDS             complement(458386..458925)
                     /gene="pfpI"
                     /locus_tag="PSPA7_0448"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by match to protein family HMM
                     PF01965; match to protein family HMM TIGR01382"
                     /codon_start=1
                     /transl_table=11
                     /product="protease PfpI"
                     /protein_id="YP_001345843.1"
                     /db_xref="GI:152988859"
                     /db_xref="GeneID:5353686"
                     /translation="MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSDKS
                     GEVRGWNHHQPADAFRVDGTFEDASLDDYDALLLPGGVVNSDQIRSLAKAQELVIRAE
                     QASKPVAVFCHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSS
                     RKPDDIPAFSRRFIDILAG"
     misc_feature    complement(458395..458901)
                     /gene="pfpI"
                     /locus_tag="PSPA7_0448"
                     /note="intracellular protease, PfpI family; Region: PfpI;
                     TIGR01382"
                     /db_xref="CDD:233389"
     misc_feature    complement(458401..458898)
                     /gene="pfpI"
                     /locus_tag="PSPA7_0448"
                     /note="A type 1 glutamine amidotransferase (GATase1)-like
                     domain found in PfpI from Pyrococcus furiosus; Region:
                     GATase1_PfpI_like; cd03134"
                     /db_xref="CDD:153228"
     misc_feature    complement(458587..458592)
                     /gene="pfpI"
                     /locus_tag="PSPA7_0448"
                     /note="proposed catalytic triad [active]"
                     /db_xref="CDD:153228"
     misc_feature    complement(458590..458592)
                     /gene="pfpI"
                     /locus_tag="PSPA7_0448"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153228"
     gene            459088..459966
                     /locus_tag="PSPA7_0449"
                     /db_xref="GeneID:5357159"
     CDS             459088..459966
                     /locus_tag="PSPA7_0449"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345844.1"
                     /db_xref="GI:152984532"
                     /db_xref="GeneID:5357159"
                     /translation="MVQELTAEQIRQALQGISVPPQPQIMVDLQMEQVMPNPDLKNIA
                     RLISQDPGLSGALLKLVNSPFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSD
                     DTIVTLNRFWDTAQDVAMSCLSLAKRIGYESVDEAYALGLFHNCGIPLMLKRFPHYMA
                     VLEEAYAAASDERRVVDTENRVLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIF
                     GDESARDTQLKNLLAILKMAEHICGSHRILGNQPEDHEWNSIGALVLDYVGLTDYDFE
                     NLKSSILELGVGQGSY"
     misc_feature    459088..459963
                     /locus_tag="PSPA7_0449"
                     /note="Predicted signal transduction protein [Signal
                     transduction mechanisms]; Region: COG1639"
                     /db_xref="CDD:224554"
     misc_feature    459145..459726
                     /locus_tag="PSPA7_0449"
                     /note="HDOD domain; Region: HDOD; pfam08668"
                     /db_xref="CDD:254961"
     gene            460025..460837
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /db_xref="GeneID:5357834"
     CDS             460025..460837
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /EC_number="3.2.2.23"
                     /note="Involved in base excision repair of DNA damaged by
                     oxidation or by mutagenic agents. Acts as DNA glycosylase
                     that recognizes and removes damaged bases"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="YP_001345845.1"
                     /db_xref="GI:152986116"
                     /db_xref="GeneID:5357834"
                     /translation="MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVR
                     LSGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGM
                     SLRYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIM
                     DNAVVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTL
                     RDFVGGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR"
     misc_feature    460025..460834
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="formamidopyrimidine/5-formyluracil/
                     5-hydroxymethyluracil DNA glycosylase; Validated; Region:
                     PRK01103"
                     /db_xref="CDD:234899"
     misc_feature    460028..460375
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="N-terminal domain of Escherichia coli Fpg1/MutM and
                     related bacterial DNA glycosylases; Region: EcFpg-like_N;
                     cd08966"
                     /db_xref="CDD:176800"
     misc_feature    order(460028..460033,460196..460198,460238..460240,
                     460244..460252,460292..460297,460349..460360)
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176800"
     misc_feature    460028..460030
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:176800"
     misc_feature    order(460031..460042,460046..460051,460058..460060,
                     460187..460198,460250..460252)
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="H2TH interface [polypeptide binding]; other site"
                     /db_xref="CDD:176800"
     misc_feature    order(460031..460033,460196..460198)
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:176800"
     misc_feature    460238..460240
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="turnover-facilitating residue; other site"
                     /db_xref="CDD:176800"
     misc_feature    order(460247..460249,460352..460354,460358..460360)
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="intercalation triad [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    460250..460252
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="8OG recognition residue [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    order(460295..460297,460355..460357)
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="putative reading head residues; other site"
                     /db_xref="CDD:176800"
     misc_feature    460412..460690
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="Formamidopyrimidine-DNA glycosylase H2TH domain;
                     Region: H2TH; pfam06831"
                     /db_xref="CDD:115485"
     misc_feature    460748..460831
                     /gene="mutM"
                     /locus_tag="PSPA7_0450"
                     /note="Zinc finger found in FPG and IleRS; Region:
                     zf-FPG_IleRS; pfam06827"
                     /db_xref="CDD:253933"
     gene            460914..461492
                     /locus_tag="PSPA7_0451"
                     /db_xref="GeneID:5359101"
     CDS             460914..461492
                     /locus_tag="PSPA7_0451"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345846.1"
                     /db_xref="GI:152988173"
                     /db_xref="GeneID:5359101"
                     /translation="MSGNYLPRNTLVESLGHAMLKLSGWKIEGQLPALDKFVVIGAHH
                     TSNWDFVAFLAAKFVLRLNARWFGKHTLFNGPLGGLMRRWGGIPIQRHLKLNTVDQAI
                     QAFGEHREFMLIIAPEGTRKKVDRWRMGFYHIARGAGVPVVPAALDYENRRIVIGEPF
                     WPTGNEDADLRGLIGFYRPFIPKKPHYAFLGD"
     misc_feature    460959..461447
                     /locus_tag="PSPA7_0451"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: Unknown ABO13168;
                     Region: LPLAT_ABO13168-like; cd07988"
                     /db_xref="CDD:153250"
     misc_feature    order(461043..461045,461052..461054,461058..461060,
                     461115..461126,461268..461276)
                     /locus_tag="PSPA7_0451"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153250"
     gene            461576..461920
                     /locus_tag="PSPA7_0452"
                     /db_xref="GeneID:5357312"
     CDS             461576..461920
                     /locus_tag="PSPA7_0452"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001345847.1"
                     /db_xref="GI:152984224"
                     /db_xref="GeneID:5357312"
                     /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTADAPPA
                     YAMIGDLLIARPFLIAATAIGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCL
                     GCTTSGYNHDES"
     gene            462190..463179
                     /locus_tag="PSPA7_0453"
                     /db_xref="GeneID:5356527"
     CDS             462190..463179
                     /locus_tag="PSPA7_0453"
                     /note="Annotation generated by automatically transferring
                     the annotation from the manually curated GenBank accession
                     AE004091; identified by Glimmer2; putative"
                     /codon_start=1
                     /tran