GenomeNet

Database: RefSeq
Entry: NC_009656
LinkDB: NC_009656
Original site: NC_009656 
LOCUS       NC_009656            6588339 bp    DNA     circular CON 30-JUL-2015
DEFINITION  Pseudomonas aeruginosa PA7, complete genome.
ACCESSION   NC_009656 NZ_AAQE01000000-NZ_AAQE01000147
VERSION     NC_009656.1  GI:152983466
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603435
            Assembly: GCF_000017205.1
KEYWORDS    RefSeq.
SOURCE      Pseudomonas aeruginosa PA7
  ORGANISM  Pseudomonas aeruginosa PA7
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 6588339)
  AUTHORS   Roy,P.H., Tetu,S.G., Larouche,A., Elbourne,L., Tremblay,S., Ren,Q.,
            Dodson,R., Harkins,D., Shay,R., Watkins,K., Mahamoud,Y. and
            Paulsen,I.T.
  TITLE     Complete genome sequence of the multiresistant taxonomic outlier
            Pseudomonas aeruginosa PA7
  JOURNAL   PLoS ONE 5 (1), E8842 (2010)
   PUBMED   20107499
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 6588339)
  AUTHORS   Dodson,R.J., Harkins,D. and Paulsen,I.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2007) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP000744.
            Bacterial strain PA7 was obtained from Paul Roy, University of
            Laval, Quebec, Canada.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 20:20:40
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 6,070
            CDS                                       5,932
            Pseudo Genes                           :: 61
            CRISPR Arrays                          :: 2
            rRNAs                                  :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                         :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                                  :: 64
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 33
            Frameshifted Genes On Monomer Runs     :: 2
            Frameshifted Genes Not On Monomer Runs :: 1
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..6588339
                     /organism="Pseudomonas aeruginosa PA7"
                     /mol_type="genomic DNA"
                     /strain="PA7"
                     /db_xref="taxon:381754"
     gene            482..2026
                     /locus_tag="PSPA7_RS00005"
                     /old_locus_tag="PSPA7_0001"
     CDS             482..2026
                     /locus_tag="PSPA7_RS00005"
                     /old_locus_tag="PSPA7_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_034080764.1"
                     /db_xref="GI:730720724"
                     /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPN
                     RFVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQSHVAPPPP
                     VAPPPAPVQPVSAAPVVVPREELPPVAAVSSVTADSYEAEEPSIDPLAVAMPAGAAPA
                     IRTERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLY
                     GGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSV
                     DALLIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFG
                     WGLTVAVEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIA
                     HSHFMGRPITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSV
                     ARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNL
                     LRTLTT"
     gene            2055..3158
                     /locus_tag="PSPA7_RS00010"
                     /old_locus_tag="PSPA7_0002"
     CDS             2055..3158
                     /locus_tag="PSPA7_RS00010"
                     /old_locus_tag="PSPA7_0002"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009614446.1"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_011979038.1"
                     /db_xref="GI:500712601"
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSL
                     TGTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPSDVLIDIRVEEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLL
                     EVNGGALRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVIGDRQQLREAFSRTAILSN
                     EKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGT
                     EQVRFILSDSNSSALVHEADNDDSAYVVMPMRL"
     gene            3168..4277
                     /locus_tag="PSPA7_RS00015"
                     /old_locus_tag="PSPA7_0003"
     CDS             3168..4277
                     /locus_tag="PSPA7_RS00015"
                     /old_locus_tag="PSPA7_0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B7V0N8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RecF"
                     /protein_id="WP_003150814.1"
                     /db_xref="GI:489242607"
                     /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIH
                     LLGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQN
                     ARSAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALR
                     QRNSWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDL
                     TLSYYRGWDKDRDLQDVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQ
                     KLVVCALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCV
                     DPQLLKDGWRTDTPVAMFHVEHGKVSQTTTIGSEA"
     gene            4274..6694
                     /gene="gyrB"
                     /locus_tag="PSPA7_RS00020"
                     /old_locus_tag="PSPA7_0004"
     CDS             4274..6694
                     /gene="gyrB"
                     /locus_tag="PSPA7_RS00020"
                     /old_locus_tag="PSPA7_0004"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015474774.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_011979039.1"
                     /db_xref="GI:500712602"
                     /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
                     VVDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHA
                     GGKFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVG
                     ETDGSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFK
                     YEGGLKAFVEYLNTNKSAVNQVFHFNVQREEDGVGVEVALQWNDSFNENILCFTNNIP
                     QRDGGTHLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQMPELIERGYVYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDA
                     SLHVNEHAPGLAGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLAN
                     ESVMQGWLEKFQARLSAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRD
                     FFASNDYRSVSLLGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQR
                     YKGLGEMNPEQLWETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LAVSNLDV"
     gene            complement(7025..7798)
                     /locus_tag="PSPA7_RS00025"
                     /old_locus_tag="PSPA7_0005"
     CDS             complement(7025..7798)
                     /locus_tag="PSPA7_RS00025"
                     /old_locus_tag="PSPA7_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003097269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol acyltransferase"
                     /protein_id="WP_003150817.1"
                     /db_xref="GI:489242610"
                     /translation="MSTVQAIRTVLFYLLLSSSAFVWGTLSFFIAPFLPFRARYRFVV
                     RSWCRFAIWLTRVVAGIRYEVRGLENVPEQPCVILSKHQSTWETFFLSGFFEPLSQVL
                     KRELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIP
                     VGQMGKFSRGGTALAVNAGLPVLPIAHNAGQFWPKAGWAKYPGTIQVVIGPAMHAEGE
                     GPRAIAELNQRAEAWVSETMAEISPTQQRVSHPEPSVVS"
     gene            complement(7810..8346)
                     /locus_tag="PSPA7_RS00030"
                     /old_locus_tag="PSPA7_0006"
     CDS             complement(7810..8346)
                     /locus_tag="PSPA7_RS00030"
                     /old_locus_tag="PSPA7_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003136533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol phosphatase"
                     /protein_id="WP_033997735.1"
                     /db_xref="GI:730358357"
                     /translation="MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSKA
                     GWTVAVATNQSGIARGYYELAVLEAMHARLRELVAKQGGELGLIVYCPHGPDDGCDCR
                     KPKPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLP
                     EGTLIFDDLAAVASALLQ"
     gene            complement(8691..10745)
                     /locus_tag="PSPA7_RS00035"
                     /old_locus_tag="PSPA7_0008"
     CDS             complement(8691..10745)
                     /locus_tag="PSPA7_RS00035"
                     /old_locus_tag="PSPA7_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009316071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine-tRNA synthetase subunit beta"
                     /protein_id="WP_033997702.1"
                     /db_xref="GI:730358251"
                     /translation="MSAKDFLVELGTEELPPKALNSLGEAFLNGIEKGLKAAGLSYSA
                     ARFYAAPRRLAVLIEQLAVQQPDRTVNLDGPPLQAAFDASGKPTQAALGFAKKCGVDL
                     EQIDKSGPKLRFSQTIAGQPAAGLLPGIVETSLNELPIPKRMRWAARRDEFVRPTQWL
                     VMLFGDEVVDCEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAERR
                     ELIAKRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTM
                     QDNQKYFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDKK
                     QPLESFNERLQNVVFQAQLGTVFDKARRVSGLAAYIAERIGGDAQNAARAGILSKCDL
                     ATEMVGEFPEMQGIAGYYYATHGGEPEDVALALNEQYMPRGAGAELPSTLTGAAVAVA
                     DKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVHAAVEQYGD
                     KVKAAGLAEQVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAFR
                     QLPEAEALAAANKRVSNILAKSEDEVPASVDASLLVEAAEKALGSAVANAESEVAPLA
                     AARDYRAALARLAALREPVDAFFADVMVNVDDSSVRANRYALLAKLRGLFLGVADISL
                     LG"
     gene            complement(10745..11692)
                     /locus_tag="PSPA7_RS00040"
                     /old_locus_tag="PSPA7_0009"
     CDS             complement(10745..11692)
                     /locus_tag="PSPA7_RS00040"
                     /old_locus_tag="PSPA7_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I7B7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="WP_011979042.1"
                     /db_xref="GI:500712605"
                     /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHT
                     ATFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLG
                     SLKAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYLQGVDSVYDLIWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANV
                     PKLFELFDFYESEANRLIELELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARAVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
     gene            11797..12348
                     /locus_tag="PSPA7_RS00045"
                     /old_locus_tag="PSPA7_0010"
     CDS             11797..12348
                     /locus_tag="PSPA7_RS00045"
                     /old_locus_tag="PSPA7_0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_003150821.1"
                     /db_xref="GI:489242614"
                     /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGL
                     SWITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRSKLNAARQNAQAW
                     LELDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYA
                     FMQASGMVMDHTRDCDRYAQLAG"
     gene            12625..13512
                     /locus_tag="PSPA7_RS00050"
                     /old_locus_tag="PSPA7_0011"
     CDS             12625..13512
                     /locus_tag="PSPA7_RS00050"
                     /old_locus_tag="PSPA7_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016561453.1"
                     /note="Acylates the intermediate (KDO)2-lipid IVA to form
                     (KDO)2-(lauroyl)-lipid IVA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="WP_003150822.1"
                     /db_xref="GI:489242615"
                     /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSRE
                     VVRINLSKCFPELSEAELEKLVGQSLMDIGKTLTESACAWIWPPEKSLKYIREVEGME
                     VLEEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQL
                     GNRVAPSTPEGILSVIKEVKRGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLL
                     SRGKARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLDVSVAAMSRELAKYVRAYPSQ
                     YMWSMKRFKNRPDGEKKWY"
     gene            13589..13855
                     /locus_tag="PSPA7_RS00055"
                     /old_locus_tag="PSPA7_0012"
     CDS             13589..13855
                     /locus_tag="PSPA7_RS00055"
                     /old_locus_tag="PSPA7_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilZ"
                     /protein_id="WP_011979043.1"
                     /db_xref="GI:500712606"
                     /translation="MDNQRQHPRTPIKCRIRISHPQLGELMAQTRDLSDTGVYVKHPD
                     LLRLDVGSIVTGQVQDLPIEAPVLRMEVVRIDAEGVGLRFLADQ"
     gene            13999..14655
                     /locus_tag="PSPA7_RS00060"
                     /old_locus_tag="PSPA7_0013"
     CDS             13999..14655
                     /locus_tag="PSPA7_RS00060"
                     /old_locus_tag="PSPA7_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011979044.1"
                     /db_xref="GI:500712607"
                     /translation="MSASSPTAWRGTLAGLIVFHIFIIIASNYLVQLPVTLFGWHTTW
                     GAFSFPFIFLATDLTVRLMGKGPARLVIARVMLPALIASYLVSVLFQEAAFRGLSALL
                     EFNTFVARISLASFLAYVLGQVLDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFF
                     VAFWRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPRTDDA
                     "
     gene            complement(14713..14982)
                     /locus_tag="PSPA7_RS00065"
                     /old_locus_tag="PSPA7_0014"
     CDS             complement(14713..14982)
                     /locus_tag="PSPA7_RS00065"
                     /old_locus_tag="PSPA7_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979045.1"
                     /db_xref="GI:500712608"
                     /translation="MSKHTRYAPPQLHFEPDQALLYIYRNASSDALFETAQERLKGLV
                     GLLQALERFRTRTGGDLSIGRATDILHTLASDALTLHMAARNVAP"
     gene            complement(15288..15602)
                     /locus_tag="PSPA7_RS00070"
                     /old_locus_tag="PSPA7_0015"
     CDS             complement(15288..15602)
                     /locus_tag="PSPA7_RS00070"
                     /old_locus_tag="PSPA7_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003150831.1"
                     /db_xref="GI:489242624"
                     /translation="MIEGLEKMLAKGVDNALLRFGLGKGYLDAGNAERAAEHLQSCVE
                     QDPGYSAGWKLLGKARQAGGDLDGARRAWEQGLKAATAHGDKQAEKEMAVFLRKLDKA
                     KP"
     gene            complement(15657..17108)
                     /locus_tag="PSPA7_RS00075"
                     /old_locus_tag="PSPA7_0016"
     CDS             complement(15657..17108)
                     /locus_tag="PSPA7_RS00075"
                     /old_locus_tag="PSPA7_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_011979046.1"
                     /db_xref="GI:500712609"
                     /translation="MHYASIFRILGVLLMLFSSAQIPPLLVALFYAEPVWQPFLLAFV
                     ITLATGACIWWPVRGVQEELRIREGYLITALFWVVLGSFGAIPFMFSETPHMSLTDAL
                     FEAISGISTTGATVLTGLDRLPRAILYYRQQLQWFGGMGIVVLAVAIMPMLGIGGMQL
                     YRAEMPGPLKEQKLSPRIADTAKTLWLIYCGLTLACALAYWAAGMSLFDAVGHSFSTI
                     AIGGFSTHDASIGYFDSPLIEAICMFFLVVSGINFGLHFLAWRRRSLAHYLRDPECRA
                     YLSILLAVFLVTALALVAQRHYEQPLQAIRYAAFMVVSIGTTTGFGLADFATWPTFLP
                     HLLLYTTFIGACAGSTGGGMKVMRILLVYRQGMREFMRLLHPSGVFLVKLGRRPIPDR
                     VVESVWGFCSIYLVTFVVLMLVLLALGVDLLTAFSSLSSCLNNLGPALGEAAAHYGGL
                     PDSAKLVLAFAMMLGRLEVFSLLILFTPAFWRY"
     gene            complement(17245..18618)
                     /gene="trkA"
                     /locus_tag="PSPA7_RS00080"
                     /old_locus_tag="PSPA7_0017"
                     /gene_synonym="sapG"
     CDS             complement(17245..18618)
                     /gene="trkA"
                     /locus_tag="PSPA7_RS00080"
                     /old_locus_tag="PSPA7_0017"
                     /gene_synonym="sapG"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015474828.1"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="WP_011979047.1"
                     /db_xref="GI:500712610"
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREP
                     AYLTRTGLFDNDAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAY
                     YGGPLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIR
                     AVMGEMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDST
                     IVLNGSASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAY
                     VDLVQGGEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSK
                     VIGRSINEIKLPPGTTIGALVRDEEVLIAHGDTRIESDDHVLLFLVDKKYIRDVERLF
                     QAGLTFF"
     gene            complement(18646..19950)
                     /locus_tag="PSPA7_RS00085"
                     /old_locus_tag="PSPA7_0018"
     CDS             complement(18646..19950)
                     /locus_tag="PSPA7_RS00085"
                     /old_locus_tag="PSPA7_0018"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I7A9.1"
                     /note="catalyzes the methylation of cytosine at position
                     967 (m5C967) of 16S rRNA; SAM-dependent methyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011979048.1"
                     /db_xref="GI:500712611"
                     /translation="MNPRLAACQALAAVLAGRASLSGALPAQLDKVAPRDRGLTQELA
                     FGAARWQPRLQALAARLLQKPFKAADNDIHALLLIGLYQLLYTRVPPHAAIGETVGCA
                     DKLKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALQQAWPEQLEA
                     LCAANNAHPPMTLRVNRRHGERDTYLAELAEAGIEARACDYSRDGIQLAAPRDVRELP
                     GFAEGRVSVQDEAAQLAAELLESAPGQRVLDACCAPGGKTCHLLEIQPELGEVVAVDL
                     EQSRLLRVRENLQRLGLEARLVAADARATGEWWDGQPFQRILLDAPCSATGVIRRHPD
                     IKLARKPDDIAALAQLQGELLDALWPTLEVGGVLVYATCSVMPSENSDGIAAFLARTP
                     GARELDLPGPWGMKQAHGRQLLPQVDGHDGFYYAKLIKISAR"
     gene            complement(19947..20891)
                     /gene="fmt"
                     /locus_tag="PSPA7_RS00090"
                     /old_locus_tag="PSPA7_0019"
     CDS             complement(19947..20891)
                     /gene="fmt"
                     /locus_tag="PSPA7_RS00090"
                     /old_locus_tag="PSPA7_0019"
                     /EC_number="2.1.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UX80.1"
                     /note="modifies the free amino group of the aminoacyl
                     moiety of methionyl-tRNA(fMet) which is important in
                     translation initiation; inactivation of this gene in
                     Escherichia coli severely impairs growth; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_041025264.1"
                     /db_xref="GI:751334166"
                     /translation="MSQALRIVFAGTPEFAAEHLKALLDTPHQLVAVYTQPDRPAGRG
                     QKLMPSAVKSLALEHGLPVIQPPSLRSADAQAELAALRPDLMVVVAYGLILPQAVLDI
                     PRLGCINSHASLLPRWRGAAPIQRAVEAGDAQSGVTVMQMEAGLDTGPMLLKVATPIA
                     ADDSGGSLHDRLAALGPKAVVEAIAGLAAGTLRGEVQDDALATYAHKLNKDEARLDWS
                     RPAVELERQVRAFTPWPVCHSSLAGASLKVLGASLGHGSGTPGSILEASRDGLLVACG
                     EGALRLTRLQLPGGKPLAFADLYNSRREQFAAGQVLGQ"
     gene            complement(20944..21450)
                     /locus_tag="PSPA7_RS00095"
                     /old_locus_tag="PSPA7_0020"
     CDS             complement(20944..21450)
                     /locus_tag="PSPA7_RS00095"
                     /old_locus_tag="PSPA7_0020"
                     /EC_number="3.5.1.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003458057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_011979050.1"
                     /db_xref="GI:500712613"
                     /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPG
                     IGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENV
                     DRPQKVRIKALDRDGKPFEEVAEGLLAVCIQHECDHLNGRLFVDYLSTLKRDRIRKKL
                     EKQHRQQA"
     gene            21589..22614
                     /locus_tag="PSPA7_RS00100"
                     /old_locus_tag="PSPA7_0021"
     CDS             21589..22614
                     /locus_tag="PSPA7_RS00100"
                     /old_locus_tag="PSPA7_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein"
                     /protein_id="WP_011979051.1"
                     /db_xref="GI:500712614"
                     /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISG
                     KFLRQPWKWPQLWHANPQIQNPHLIYPGDTLSLVYIDGQPRLVLNRGESRGTIKLSPK
                     IRSTPIAEAIPTIPLDKINSFLLANRIVDDEKTFTAAPYIVAGNAERIVSGTGDRVYA
                     RGKFADGQPAYGIFRQGKVYVDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQ
                     EVRLGDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGLRDG
                     LAEGNVLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYQKLSYALVLMASRPLSV
                     TDRVQNP"
     gene            22749..23837
                     /locus_tag="PSPA7_RS00105"
                     /old_locus_tag="PSPA7_0022"
     CDS             22749..23837
                     /locus_tag="PSPA7_RS00105"
                     /old_locus_tag="PSPA7_0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_011979052.1"
                     /db_xref="GI:500712615"
                     /translation="MNNLSHAELDARLRLHGLPELGPIRFLRLIEAFGSASSALAAPA
                     GAWHTLGLPAEAAAARRSAEVRERAADALRWLEAPRRHLLMWDDPAYPALLGEVSDAP
                     PLLFVEGAPTALERPQLAMVGSRRASPAGLGCARSFARSLARGGFAITSGLALGIDGA
                     AHEGALEVGGVTLAVLGTGLRTLYPRRHAALARRIVEGGGALVSELPLDSPPLPANFP
                     RRNRIISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
                     DGALLVESVEHVLEALRGWTQAGPAEAPVASLDHPLLELLRVAPYSSEGLAAASGWAL
                     PEVLAALTELELDGRVACEAGTWVHRSG"
     gene            23877..24434
                     /locus_tag="PSPA7_RS00110"
                     /old_locus_tag="PSPA7_0023"
     CDS             23877..24434
                     /locus_tag="PSPA7_RS00110"
                     /old_locus_tag="PSPA7_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I7A5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_011979053.1"
                     /db_xref="GI:500712616"
                     /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKARPVEKGLIVVAAHIHQLDFLLEDLPDVWLERLAGTWPGPNTWLVPHQDRLPEWV
                     TGVHDSVAVRVTDHPLVQELCYLTGPLISTSANPAGRPAARTRLRVEQYFHDELDGVL
                     GGALGGRRNPSLIRDLVTGQVIRPA"
     gene            complement(24445..25422)
                     /locus_tag="PSPA7_RS00115"
                     /old_locus_tag="PSPA7_0024"
     CDS             complement(24445..25422)
                     /locus_tag="PSPA7_RS00115"
                     /old_locus_tag="PSPA7_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P43903.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_011979054.1"
                     /db_xref="GI:500712617"
                     /translation="MAKRVQFAAYGSPEVLEYRDYQPAEPGPREVRVRNRAIGLNFID
                     TYYRSGLYPAPGLPSGLGSEGAGEVEAVGSAVTRFQVGDRVAYATGPLGAYSELHVLA
                     EDNLVRLPEAIDFEQAAAMMLKGLTTQYLLRQTYELQSGETILFHAAAGGVGLFACQW
                     AKALGVKLIGTVSSPEKARLARQHGAWETIDYSHENVAKRVLELTDGKKCPVVYDSVG
                     KDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGVLSQKGSLYVTRPTLGSYANTPEKL
                     QAMADELFGLVERGAIRIEINQRFALVDAAQAHTELAARRTTGSTVLLP"
     gene            25614..26531
                     /locus_tag="PSPA7_RS00120"
                     /old_locus_tag="PSPA7_0025"
     CDS             25614..26531
                     /locus_tag="PSPA7_RS00120"
                     /old_locus_tag="PSPA7_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118481.1"
                     /note="catalyzes the conversion of the propionic acid
                     groups of rings I and III to vinyl groups during heme
                     synthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_011979055.1"
                     /db_xref="GI:500712618"
                     /translation="MTDRIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGG
                     GRTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPH
                     VPTSHANVRFFCAEKAGEEPVWWFGGGFDLTPYYASEEDCVHWHRVARDACAPFGADV
                     YPRYKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIV
                     QRRKHTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKPEPGSEEARLTEYFLTDRDWLAGQP"
     gene            26589..27413
                     /gene="aroE"
                     /locus_tag="PSPA7_RS00125"
                     /old_locus_tag="PSPA7_0026"
     CDS             26589..27413
                     /gene="aroE"
                     /locus_tag="PSPA7_RS00125"
                     /old_locus_tag="PSPA7_0026"
                     /EC_number="1.1.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UX87.1"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase (NADP+)"
                     /protein_id="WP_003156232.1"
                     /db_xref="GI:489248084"
                     /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGQALAYEAQLAPLDDFA
                     GFARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLVRLDGGRLRGDNTDG
                     AGLLRDLTVNAGVQLRDRRVLLLGAGGAVRGVLAPFLGERPAQLLVANRTAEKAVALA
                     GEFADLGAVRGCGFADVEGPFDLIVNGTSASLAGDVPPLAESVIERGRTVCYDMMYAK
                     EATAFNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATG"
     gene            27525..28511
                     /locus_tag="PSPA7_RS00130"
                     /old_locus_tag="PSPA7_0027"
     CDS             27525..28511
                     /locus_tag="PSPA7_RS00130"
                     /old_locus_tag="PSPA7_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003097316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_011979056.1"
                     /db_xref="GI:500712619"
                     /translation="MKTLTRLAAGLCICAIAGQANAWSQPTHKNIVKDALAFMNSSYA
                     TEEMRQAYQFYVSAAGGEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASG
                     IVNYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKRED
                     FDTTEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLASYWFDQFRAAPSLQTIGYALHAT
                     GDVAQPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQ
                     TGQVAYAHPEPLYDTSYETRLRVAKELIPESIALTVTVLTKGANSFNAQTAL"
     gene            28492..29778
                     /locus_tag="PSPA7_RS00135"
                     /old_locus_tag="PSPA7_0028"
     CDS             28492..29778
                     /locus_tag="PSPA7_RS00135"
                     /old_locus_tag="PSPA7_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_011979057.1"
                     /db_xref="GI:500712620"
                     /translation="MRKPLSDRRPGWRRAICGVALALLACAAQAVPGEVPRDLTIDGE
                     VLPGKSIDLLERALSRVKFNTDPRQLRRGLVENRLLAREVEGQLTAQNRADLDASVEI
                     EAGNLLEQLYGKRYREDLGPFLRQPQPLSAERLRQVLAPASRGLVENSLVLGEAQRRE
                     AAGVELIGWQFPGQPARTLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRLRRDYLW
                     YRLARDGFGPAEQRGLKTLVRDRLVRQRYLHQIGLYSDFHHESDVLRQLAAKVSDQDA
                     EAYYRRNLERYRNVAQVQAVHIRLADQASADRVYAELQKGLAFDEAVRRHSLADDRDR
                     DPPGDLGLIRPQDGQLDLLRKTALIQKADTLSQPMRIDGAFEIVRVRSREDRQLPLSD
                     RSVRFEVNQAVARERLAAQFETQLRGLLAGARVEGL"
     gene            29775..30377
                     /locus_tag="PSPA7_RS00140"
                     /old_locus_tag="PSPA7_0029"
     CDS             29775..30377
                     /locus_tag="PSPA7_RS00140"
                     /old_locus_tag="PSPA7_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979058.1"
                     /db_xref="GI:500712621"
                     /translation="MKRWLGVALGCSGLAMALACAGVLWMPSAETVASPSAPPTAGTA
                     MAAAAVEDPPPVERARTPAAVRHVVGQPSAPGLDREQAILFMQMLRDEGDPRSPPLGG
                     LQPRQGASAEALADPKRYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSA
                     EDIDEARAALGQLEMMRDKLQRESPQLLPGDSAPPAPAVP"
     gene            complement(30381..31934)
                     /locus_tag="PSPA7_RS00145"
                     /old_locus_tag="PSPA7_0030"
     CDS             complement(30381..31934)
                     /locus_tag="PSPA7_RS00145"
                     /old_locus_tag="PSPA7_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_011979059.1"
                     /db_xref="GI:500712622"
                     /translation="MRSRLLPFLAWLPGLRRGDLGREAWVGLNGAVLALPQSMAYALI
                     AGLPAAYGLYAAMLPVAIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPVGSAEYIQA
                     VLLLTFLAGAFQCLLGLLRIGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLFGLPANG
                     EGAVPGNGWRLLRRVAEIDGPSLLVGGFSFALSLLVRRLRPRWPALPLGLLGGATLVW
                     ALPATFASVAHVQALSSALPAWSPPVFEARAILDLLPAAVACGMLGLVTSLSIARALA
                     ARQGDAFDANQEVRAQGLSNLFGPWLSASLSAGSFTRSGLNLEAGARSPLAGVFSALW
                     VALLAVLGARLIEHLPLPAMAAGILLIAWGLVDRPALRALYRSGRGECLVAGLTSLAT
                     LLLPLQNAIYAGVLASLFFYLRRTSTPRVLRQRNDEEEVLRIEGSIFFGACDYLQRLM
                     RQSDKPRLVLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQAD
                     EDSRLHYEG"
     gene            complement(31939..32862)
                     /locus_tag="PSPA7_RS00150"
                     /old_locus_tag="PSPA7_0031"
     CDS             complement(31939..32862)
                     /locus_tag="PSPA7_RS00150"
                     /old_locus_tag="PSPA7_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_011979060.1"
                     /db_xref="GI:500712623"
                     /translation="MNRLPTRLLAATLLLGSTPLHAEDAACAHVRLADPGWSDIAVTN
                     ASAAFLLESLGYRVKIETLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHERFVASGQVE
                     RLGRNLDGTRFTLAVPRYVWDAGIHRFEDLARQAQRFDRKLYGIGSGAPANQSIQKMI
                     DANRFGLGDWKLVASSEQAMLAELARAEKRQRWLVFLGWTPHPMNLRHELRYLDGGEQ
                     YFGERGQVYTLARKGYAAQCPNPARLLANLRFALDMENQMMSDALQGSATPATAARAW
                     LKAHPQVLDAWLRGVTARDGGDALAAVRDRL"
     gene            complement(32880..34391)
                     /locus_tag="PSPA7_RS00155"
                     /old_locus_tag="PSPA7_0032"
     CDS             complement(32880..34391)
                     /locus_tag="PSPA7_RS00155"
                     /old_locus_tag="PSPA7_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline-sulfatase"
                     /protein_id="WP_003157288.1"
                     /db_xref="GI:489249159"
                     /translation="MKTPPNILFIMADQMAAPLLPFHDPRSVLRMPNLSRLAERAVVF
                     DSAYCNSPLCAPSRFTLVSGRLPSRIGAWDNAADFAADTPTYAHYLRRLGYRTALSGK
                     MHFCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQ
                     LDFDEEAVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYCIPASYWNLYRDEDIPLP
                     RQSFAQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQVGALLATLE
                     ECGLADDTILVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPGRFAARRIGASVS
                     TVDLLPTLVELAGGQVDARLPLDGRSLLPHLRDGSGHDEVIGEYTAEGTLGPLMMIRR
                     GDYKFIYSEQDPCLLYDLRNDPQERENLAASPAHRGAFEAFLDEARRRWDIPALTRAV
                     LDSQRRRRLVAEALTRGRLTSWDHQPWVDASQQYMRNHIDLDDLERRARFPQP"
     gene            34520..35419
                     /locus_tag="PSPA7_RS00160"
                     /old_locus_tag="PSPA7_0033"
     CDS             34520..35419
                     /locus_tag="PSPA7_RS00160"
                     /old_locus_tag="PSPA7_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011979061.1"
                     /db_xref="GI:500712624"
                     /translation="MPLSLDLLRVFESAARQLSFTAAAEELGSTQPAVSQQIKRLEQE
                     LQTELFQRVHRGILLTDAGLLLLRHVAPALESVEAGIAALGARQRHEVLQVATDYAFA
                     AYWLMPRLPRFHLAHPHLDVSLVTSERGLAGPRGDIDVAILFGDGRSKHGETHRLFRE
                     EVFPVCSPRLLEGLPLPLAKEHLARLPMLHLKPAQHSRWFDWPALFEALAIDRQPIPA
                     VLSFDNYTLLIQAAIAGQGVAIGWRHLVDDLLEQGLLCRPISESCLSRYGYYALLPER
                     KRRQRLVDAFVGWLRAELQAGGA"
     gene            35430..35807
                     /locus_tag="PSPA7_RS00165"
                     /old_locus_tag="PSPA7_0035"
     CDS             35430..35807
                     /locus_tag="PSPA7_RS00165"
                     /old_locus_tag="PSPA7_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_011979062.1"
                     /db_xref="GI:500712625"
                     /translation="MNEFSTPRIQGFHAHVYFDAQSIERARALCEEAARRFPLKMGRV
                     HQRPVGPHPDWSCQLAFTPELFGELIPWLAIHRQDLVVFVHPVTGNDLVDHRDRAMWM
                     GAIRPLDLSILDEGAESYDFRAP"
     gene            complement(35786..36151)
                     /locus_tag="PSPA7_RS00170"
                     /old_locus_tag="PSPA7_0034"
     CDS             complement(35786..36151)
                     /locus_tag="PSPA7_RS00170"
                     /old_locus_tag="PSPA7_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979063.1"
                     /db_xref="GI:500712626"
                     /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNSEDTRKLRRAQER
                     EQIQELNELAHRLAGMASLIHAHAVERACHHLEIACGETSVSNLADAVDELVTALGDL
                     QCELHDWMTLTEPQGARKS"
     gene            complement(36159..36782)
                     /locus_tag="PSPA7_RS00175"
                     /old_locus_tag="PSPA7_0036"
     CDS             complement(36159..36782)
                     /locus_tag="PSPA7_RS00175"
                     /old_locus_tag="PSPA7_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P24908.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003111192.1"
                     /db_xref="GI:489202031"
                     /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARK
                     KSPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVS
                     KRENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLAN
                     GNTNKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
     gene            complement(36967..37773)
                     /gene="trpA"
                     /locus_tag="PSPA7_RS00180"
                     /old_locus_tag="PSPA7_0037"
     CDS             complement(36967..37773)
                     /gene="trpA"
                     /locus_tag="PSPA7_RS00180"
                     /old_locus_tag="PSPA7_0037"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P07344.3"
                     /note="catalyzes the formation of indole and
                     glyceraldehyde 3-phosphate from indoleglycerol phosphate
                     in tryptophan biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase alpha chain"
                     /protein_id="WP_003157285.1"
                     /db_xref="GI:489249156"
                     /translation="MSRLQTRFAQLKQDNRAALVTFVTAGDPDYDASLEILKGLPAAG
                     ADVIELGMPFTDPMADGPAIQLANIRALQGGQTLAKTLRMVREFRAGDSDTPLVLMGY
                     FNPIHHYGVERFVTEAKEAGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGD
                     ERLPTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAE
                     HAAAVARLADGVVVGSALIERIAKAGDTARAVKDVLALCGELAEGVRNAR"
     gene            complement(37770..38978)
                     /locus_tag="PSPA7_RS00185"
                     /old_locus_tag="PSPA7_0038"
     CDS             complement(37770..38978)
                     /locus_tag="PSPA7_RS00185"
                     /old_locus_tag="PSPA7_0038"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979064.1"
                     /note="catalyzes the formation of L-tryptophan from
                     L-serine and 1-(indol-3-yl)glycerol 3-phosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_011979064.1"
                     /db_xref="GI:500712627"
                     /translation="MTAYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDP
                     AFQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQIL
                     LARRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGA
                     EVIPVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKET
                     REQLAEKEGRLPDSLVACIGGGSNAMGLFHPFLDDAGVRIVGVEAAGHGIDTGKHAAS
                     LNGGVPGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDVGRVEYTSIT
                     DDEALDAFHTCCRLEGIIPALESSHALAEAFKRAPGLPGDHIMVVNLSGRGDKDMQTV
                     MHHMQQEHKA"
     gene            39076..39969
                     /locus_tag="PSPA7_RS00190"
                     /old_locus_tag="PSPA7_0039"
     CDS             39076..39969
                     /locus_tag="PSPA7_RS00190"
                     /old_locus_tag="PSPA7_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011979065.1"
                     /db_xref="GI:500712628"
                     /translation="MAMSRELPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVR
                     LLEEALGVPLFGKEGRGIKLTDAGLRLRDACGDAFERLRGVCAELRRQTAEAPFVLGV
                     PGSLLARWFIPRLDRLNRALPDLRLQLSTSEGELDPQRPGLDALLWFAAPPWPADMQV
                     FELAPERMGPVLSPRLARETGLAEAPAARLLEEPLLHTASRPQAWPAWAVSQGLAPEA
                     LRYGQGFEHLYYLLEAAVAGLGVAIAPEALVRDDLAAGRLVAPWGFIETDARLALWVP
                     ARLHDPRAERLAQWLRECLAD"
     gene            40071..40286
                     /locus_tag="PSPA7_RS00195"
                     /old_locus_tag="PSPA7_0040"
     CDS             40071..40286
                     /locus_tag="PSPA7_RS00195"
                     /old_locus_tag="PSPA7_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009614515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157334.1"
                     /db_xref="GI:489249207"
                     /translation="MSNHHTYKKIELVGSSRTSIEDAINNALAEAAKSIQHLEWFEVV
                     DTRGHIENGAVGHYQVTLKVGFRIADS"
     gene            40404..40625
                     /locus_tag="PSPA7_RS00200"
                     /old_locus_tag="PSPA7_0041"
     CDS             40404..40625
                     /locus_tag="PSPA7_RS00200"
                     /old_locus_tag="PSPA7_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003108017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157335.1"
                     /db_xref="GI:489249208"
                     /translation="MKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAYTL
                     EIVDKGSVTDKKVVGSCDGGTKEIVYQRG"
     repeat_region   40872..51429
     gene            40963..42606
                     /locus_tag="PSPA7_RS00205"
                     /old_locus_tag="PSPA7_0042"
     CDS             40963..42606
                     /locus_tag="PSPA7_RS00205"
                     /old_locus_tag="PSPA7_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ShlB family hemolysin secretion/activation
                     protein"
                     /protein_id="WP_049792062.1"
                     /db_xref="GI:908648048"
                     /translation="MASAAPFTSPGDRDLIRERQQRLLDEQRKRLEELQQLPGNEAPS
                     TPGGSAGDGRCFDIRRIELEGAEHLAQGARDELLAPYQGKCLGVGQLNALLKAVTDHY
                     LDRGYVTTRAYLPQQDLASGTLRVIVVEGRLEGLDSSALASPRELAMSFPGKTGELLD
                     LRELEQLVDQLGRLPSRQAQLELVPGSQVGGSRVRLKGERDKPWRVSATRNNDGDVST
                     GEQQMGLGLDWDSPLGLADQLSLRANQDAVSDRWRHSDSQSLFYSLPWGWWTFTYGYS
                     QSDYRTRNETSGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQRTNNYIEDT
                     RLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQGRGQPRGGDAHARYD
                     KYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGFKDQTLTG
                     DSGGYWRNQLRWRRAVQWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRMSGNAIE
                     LDARGRYFAASVGFARSLERPSVIERREHPIYFRVDAFF"
     gene            42719..>52959
                     /locus_tag="PSPA7_RS00210"
                     /pseudo
     CDS             42719..>52959
                     /locus_tag="PSPA7_RS00210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003147038.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin"
     repeat_region   51851..53956
     repeat_region   55486..56287
     gene            55569..56261
                     /locus_tag="PSPA7_RS00215"
     CDS             55569..56261
                     /locus_tag="PSPA7_RS00215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004347049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041025265.1"
                     /db_xref="GI:751334167"
                     /translation="MPRQGRVVLPNYPLHVVQRGHNRQVVFAEDEDYQRYLSDLRDLK
                     DAFGIKVYAFCLMTNHVHLLLAPGDSLSGLAQLMKTLAARTTRYRNRLEGRSGTLWES
                     RYKSSVVQSDAYLLACCRYIELNPVRARMVDDVAAYPWSSYGLRANWLKEPNWLDMDP
                     CFIGLGQTAEERYRRYVTFVKEAIPAEELKLIREAVQRGQLTGNQRFVDEIERVAGVR
                     IERRGQGRPRLE"
     repeat_region   56752..57003
     gene            complement(57148..58401)
                     /locus_tag="PSPA7_RS00220"
                     /old_locus_tag="PSPA7_0047"
     CDS             complement(57148..58401)
                     /locus_tag="PSPA7_RS00220"
                     /old_locus_tag="PSPA7_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003154008.1"
                     /db_xref="GI:489245837"
                     /translation="MTLSLELLLSLCTALAIGLLIGAERGWQARDREDTRQIAGIRTF
                     SLVGLLGGFATLLAGELGSAVWVALLLALAALVVAGYVSDVRRGGDQGMTTEIALLTT
                     FLLGSLALTEQRLMAAAGGIVLTLLLSLKDKLHAVLKRLTAEELSGTLKLLFISVVLL
                     PVLPDRGYGPWAFFNPYLTWWMVVLIAALGFSAYLAIRLVGSRKGLLLTAVLGGLVSS
                     TVMTLTLARLRQRMPDALLACGLLATSALMFPRILVEIGALHPALLKELALPFAATTL
                     VYLGGTLFHALRGGRASQEAPDEPGLRNPFELLPALRFAALLSAILLLVEAGRRLFGD
                     AGIYAVALLSGLADVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLVVLVG
                     GKRLALLTLPFSLAGLLVGALLILL"
     gene            58884..59570
                     /locus_tag="PSPA7_RS00225"
                     /old_locus_tag="PSPA7_0048"
     CDS             58884..59570
                     /locus_tag="PSPA7_RS00225"
                     /old_locus_tag="PSPA7_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003111706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="curli production assembly protein CsgG"
                     /protein_id="WP_011979072.1"
                     /db_xref="GI:500712635"
                     /translation="MSHRAKKALLPLLAAATLAGLAGCATETSTALPVQQVESVNRPY
                     SGVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSE
                     IQQEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNI
                     VNISTSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAV
                     DSGAWKPQNQ"
     gene            59601..59954
                     /locus_tag="PSPA7_RS00230"
                     /old_locus_tag="PSPA7_0049"
     CDS             59601..59954
                     /locus_tag="PSPA7_RS00230"
                     /old_locus_tag="PSPA7_0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979073.1"
                     /db_xref="GI:500712636"
                     /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGES
                     KEAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSLGKDDQMVREFKTEKALFPESA
                     TYMDFLLNNARGGAR"
     gene            59951..60616
                     /locus_tag="PSPA7_RS00235"
                     /old_locus_tag="PSPA7_0050"
     CDS             59951..60616
                     /locus_tag="PSPA7_RS00235"
                     /old_locus_tag="PSPA7_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003154014.1"
                     /db_xref="GI:489245843"
                     /translation="MKLARLSGLVAGFTLLALLGGCAPTKSVDYSAFKQAKPRSILVL
                     PPLNESPDVKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQVSPAK
                     LREIYGADAALYVTVSDYGTRYMVISSATIVTASARLVDLRSGTTLWTGTATASSEEN
                     NGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRSPKY
                     GSD"
     gene            complement(60631..61047)
                     /locus_tag="PSPA7_RS00240"
                     /old_locus_tag="PSPA7_0051"
     CDS             complement(60631..61047)
                     /locus_tag="PSPA7_RS00240"
                     /old_locus_tag="PSPA7_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_003154016.1"
                     /db_xref="GI:489245845"
                     /translation="MSFSQNVLRLRRQNALTQRQMAERLGVTLSQFRHFETKGGQPSL
                     AVLKTFAGRFGVSLDWLICDRGERRALQADLQLQFEAIGRLRLDERRAIRALLDELIR
                     QYMAKRNLPAKPRPAPGAPPPPVRPANRAEATDAPP"
     gene            complement(61423..63084)
                     /locus_tag="PSPA7_RS00245"
                     /old_locus_tag="PSPA7_0052"
     CDS             complement(61423..63084)
                     /locus_tag="PSPA7_RS00245"
                     /old_locus_tag="PSPA7_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979074.1"
                     /db_xref="GI:500712637"
                     /translation="MRYARFASRHSLLALAVAAALLPGASWAASGERAAARKPPSAAC
                     AWNRDVPLSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFARRLCAD
                     NGRTPVTSYAKALKLVTEEGRALWRAAVDRVQGRRAIPAGALPASDDRMLYWTRTYMT
                     RTLRQWAPSFRLSQAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVF
                     TLGAPGTPNTGLRNGNPSGATALALDGREIRLSDGSLLRIEAYLLPVSYDPFNRGMQE
                     DTLGPWFRPGPRRVDASITISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADKALPN
                     YVLPLGSVTNPGSAPISLPGSGCNINPPRRWLGYDSASHWRRNLPAQFSRASLPVRQL
                     LAADTWRGIERPPGATSQAAEGFDVTWHTNYAFFPDCAKPQTESVPSNGVMNAMPDPA
                     LVLPPNRRICARNGGGGDYLSNESAYRNTVLRDTFGLDIPAGHIHVPVMNNYYTGSPA
                     SGGSARNDNAISDARYEAYRSAIVAQTRALLVGVGNALAQGAKAD"
     gene            complement(63619..64047)
                     /locus_tag="PSPA7_RS00250"
                     /old_locus_tag="PSPA7_0053"
     CDS             complement(63619..64047)
                     /locus_tag="PSPA7_RS00250"
                     /old_locus_tag="PSPA7_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979075.1"
                     /db_xref="GI:500712638"
                     /translation="MDLRPSHVHVFPPSRDLPAETHPHRETLLRSGCAWNGSLYLGYP
                     LGQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGC
                     LMNIIHRLVAGAEPVEALLFHAGVEGMPVGLGDRGETPAG"
     gene            complement(64300..64848)
                     /locus_tag="PSPA7_RS00255"
                     /old_locus_tag="PSPA7_0054"
     CDS             complement(64300..64848)
                     /locus_tag="PSPA7_RS00255"
                     /old_locus_tag="PSPA7_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003128172.1"
                     /note="in yeast cells this enzyme removes the 2'-phosphate
                     from RNA via an intermediate in which the phosphate is
                     ADP-ribosylated by NAD followed by a presumed
                     transesterification to release the RNA and generate
                     ADP-ribose 1''-2''-cyclic phosphate; functions in tRNA
                     splicing; the function and substrate of bacterial enzymes
                     in organisms that do not perform splicing is unknown;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 2'-phosphotransferase"
                     /protein_id="WP_011979076.1"
                     /db_xref="GI:500712639"
                     /translation="MDRKTLDDTSRFLSHVLRHQPEAIGLTLDGEGWADIDALIAGAA
                     RDGRALDRALLGAVLRSNDKQRFAFSADGQRIRAVQGHSHAAVAIAYAPAVPPAVLYH
                     GTARRFLDSIREHGLVPGSRHHVHLSARRATALEVGRRYGSPVLLEVDARDMHLAGHL
                     FHQAENGVWLAGQVPVRFIREA"
     gene            complement(64887..65393)
                     /locus_tag="PSPA7_RS00260"
                     /old_locus_tag="PSPA7_0055"
     CDS             complement(64887..65393)
                     /locus_tag="PSPA7_RS00260"
                     /old_locus_tag="PSPA7_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979077.1"
                     /db_xref="GI:500712640"
                     /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDA
                     RLAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEG
                     IREEQLDGAEERNVTLKVRGQEISFNGRDYLFGFALPNFFFHVTTAYAILRHNGVELG
                     KMDFLGGA"
     gene            complement(65459..66379)
                     /locus_tag="PSPA7_RS00265"
                     /old_locus_tag="PSPA7_0056"
     CDS             complement(65459..66379)
                     /locus_tag="PSPA7_RS00265"
                     /old_locus_tag="PSPA7_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011979078.1"
                     /db_xref="GI:500712641"
                     /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWV
                     GARLLHRSTRRLSLTDAGAELLPQCREMLAVADSMQATGQTRRDSPRGTLRITSSLSF
                     AQAWLTRAAAAFVERFPGTAIDLQVNSQVINLVEERIDLALRITNQLDPNLIARRLGE
                     CRSVICAAPDYLRRHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLS
                     ANESTVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQM
                     PPALRALLDFLVERMAADPHWDEAGPLALA"
     gene            66487..67374
                     /locus_tag="PSPA7_RS00270"
                     /old_locus_tag="PSPA7_0057"
     CDS             66487..67374
                     /locus_tag="PSPA7_RS00270"
                     /old_locus_tag="PSPA7_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_011979079.1"
                     /db_xref="GI:500712642"
                     /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFA
                     VSSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKPLSTIYISHGDPDFYFGLDVLK
                     AAFPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHA
                     LKVVDLKGPSPNRTVLWIPSLKTVVGGVLVESGSHVWTADTQTKASRQAWVAMLERIE
                     ALQPRRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLP
                     GEEGLELSAKVLKGEMQWP"
     gene            67437..68138
                     /locus_tag="PSPA7_RS00275"
                     /old_locus_tag="PSPA7_0058"
     CDS             67437..68138
                     /locus_tag="PSPA7_RS00275"
                     /old_locus_tag="PSPA7_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide isomerase"
                     /protein_id="WP_011979080.1"
                     /db_xref="GI:500712643"
                     /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMT
                     DANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTGAVFDSAPPTAAVLAA
                     EALGGLGAAMLARIQRAHYVEGRRIAERPVLFGLAAELGLGQGFAEAFDACSGEPLRV
                     HFADSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDEWRAFLETQKDIANSTL
                     TSGVPAPFCGIDGCP"
     gene            68252..68677
                     /locus_tag="PSPA7_RS00280"
                     /old_locus_tag="PSPA7_0059"
     CDS             68252..68677
                     /locus_tag="PSPA7_RS00280"
                     /old_locus_tag="PSPA7_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_003083605.1"
                     /db_xref="GI:489174068"
                     /translation="MKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFNTRFEGAPGT
                     NPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAITAVHLVLRA
                     RVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
     gene            68788..69021
                     /locus_tag="PSPA7_RS00285"
                     /old_locus_tag="PSPA7_0060"
     CDS             68788..69021
                     /locus_tag="PSPA7_RS00285"
                     /old_locus_tag="PSPA7_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157864.1"
                     /db_xref="GI:489249751"
                     /translation="MKTIGLGIAALLFSATALAAPKPCEELKAEIETKIQSAGVISYT
                     LEIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
     gene            complement(69034..69471)
                     /locus_tag="PSPA7_RS00290"
                     /old_locus_tag="PSPA7_0061"
     CDS             complement(69034..69471)
                     /locus_tag="PSPA7_RS00290"
                     /old_locus_tag="PSPA7_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016263990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157863.1"
                     /db_xref="GI:489249750"
                     /translation="MRPFTRLVPLALLLLAGCAGPLPQPDPKMAWVELRSAPANTLLA
                     ERLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDG
                     FEAGRRYRLEVRPQLRRALALLSDERGAVVARSNFQTSRCPPY"
     gene            complement(69528..69944)
                     /locus_tag="PSPA7_RS00295"
                     /old_locus_tag="PSPA7_0062"
     CDS             complement(69528..69944)
                     /locus_tag="PSPA7_RS00295"
                     /old_locus_tag="PSPA7_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011666524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157862.1"
                     /db_xref="GI:489249749"
                     /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLATQPDADLAAVE
                     VDDKTWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQ
                     RYRLEAGHIGFRPWAKLYDQDNRELARGREGRCAKV"
     gene            70036..71163
                     /locus_tag="PSPA7_RS00300"
                     /old_locus_tag="PSPA7_0063"
     CDS             70036..71163
                     /locus_tag="PSPA7_RS00300"
                     /old_locus_tag="PSPA7_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004351955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_049792063.1"
                     /db_xref="GI:908648049"
                     /translation="MLVGRRAVRVLCYVPPMPRRLRHPLADLRLPRWVPCLALLALSG
                     CSTVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRERLARAEKARQFASERLDLP
                     DNRSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYSEAAARAEAAR
                     QRALGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLATLIFHELAHQKFYLRDDTA
                     FNESFATFVEQEGTRQWREYRGLPPADGREEKRREQFTALVLASRARLEALYAGPLDD
                     AAKRAGKAAEFQRLRREYAALSQREWGGESPFKAWIDSPFNNAKLLPFGLYDQWVPAF
                     AVLFRQVGSNWPAFYARVRALGQLPLAERQAALQRLAAAAP"
     gene            complement(71173..72159)
                     /locus_tag="PSPA7_RS00305"
                     /old_locus_tag="PSPA7_0064"
     CDS             complement(71173..72159)
                     /locus_tag="PSPA7_RS00305"
                     /old_locus_tag="PSPA7_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979082.1"
                     /db_xref="GI:500712645"
                     /translation="MTDNPFATPSAPVQPPTREVPATTQPYAFIAVLALVTCLSFALS
                     LGIQWYNDIGEVRQRFSEHLQLTAPHWFTGLVFYAAANLLALHAYREQRRLVEFRPLA
                     LLLIGYGLLNLVCGMLAGIGLTPLTLPFYQWATVQASYTAWLLAFNEAMSWVYLLLGS
                     LLPLGLVLLGSRVNSPRLAEGEEAGVGAWQVALAAALCFATLCFKLLQFLPYALLRYD
                     EPWLYGLYLSGVALPAALLFGAICTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVG
                     GGLALLMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLAARWCYADQLATA"
     gene            complement(72192..72857)
                     /locus_tag="PSPA7_RS00310"
                     /old_locus_tag="PSPA7_0065"
     CDS             complement(72192..72857)
                     /locus_tag="PSPA7_RS00310"
                     /old_locus_tag="PSPA7_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_011979083.1"
                     /db_xref="GI:500712646"
                     /translation="MRDAALRYPHILFDLDGTLTDPREGITRSVQFALARLGIDEPDL
                     ARLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRVTGLYENRVFDGIPELLEAL
                     VGRGHTLYVATSKPGVFAREIARHFAFDRHFKAIYGSELDGTRTHKDELIRHLLDSEG
                     LAAEQCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVL
                     ESH"
     gene            complement(72850..73392)
                     /locus_tag="PSPA7_RS00315"
                     /old_locus_tag="PSPA7_0066"
     CDS             complement(72850..73392)
                     /locus_tag="PSPA7_RS00315"
                     /old_locus_tag="PSPA7_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anhydrase"
                     /protein_id="WP_011979084.1"
                     /db_xref="GI:500712647"
                     /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGADSSVWPLVVIR
                     GDMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNQV
                     LVGMGSIVMDGAVIEDEVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFA
                     YTAGNYVKLKDQHIAEGYHA"
     gene            73470..75515
                     /locus_tag="PSPA7_RS00320"
                     /old_locus_tag="PSPA7_0067"
     CDS             73470..75515
                     /locus_tag="PSPA7_RS00320"
                     /old_locus_tag="PSPA7_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="WP_011979085.1"
                     /db_xref="GI:500712648"
                     /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLET
                     QREQPTWKGLVLAMDELNERLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTEL
                     GQNRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSR
                     LSELGSRFSNQLLDATQAWTKQVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEF
                     PSYYAVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLG
                     FANYAELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCAELQSWD
                     AGYYAEKLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADV
                     RLFEILENGEHVGRFYFDLYARANKRGGAWMDGARDRRRDARGRLIDPVAYLVCNFTP
                     AVNGKPALLTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENW
                     CWEPEGLALISAHYETGEALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHG
                     DGRSVLQVLEGIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFS
                     RFEEDGVFNPDTGRAFREAILARGGSQEPMLLFVDFRGREPSIDALLRHSGLVGEAA"
     gene            75512..75787
                     /locus_tag="PSPA7_RS00325"
                     /old_locus_tag="PSPA7_0068"
     CDS             75512..75787
                     /locus_tag="PSPA7_RS00325"
                     /old_locus_tag="PSPA7_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014833847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011979086.1"
                     /db_xref="GI:500712649"
                     /translation="MSPVVTRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYA
                     DTLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
     gene            75876..76139
                     /locus_tag="PSPA7_RS00330"
                     /old_locus_tag="PSPA7_0069"
     CDS             75876..76139
                     /locus_tag="PSPA7_RS00330"
                     /old_locus_tag="PSPA7_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_003152715.1"
                     /db_xref="GI:489244530"
                     /translation="MSAPLPPRGRGTASNPLNRFAPTHSEAFDDGWEQDVPPIQLTEV
                     REEIARTVISRNQSPDLPFDRSINPYRGCEHVIVDKEMYGQSV"
     gene            78537..80639
                     /locus_tag="PSPA7_RS00335"
                     /old_locus_tag="PSPA7_0071"
     CDS             78537..80639
                     /locus_tag="PSPA7_RS00335"
                     /old_locus_tag="PSPA7_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase phage integrase"
                     /protein_id="WP_003152713.1"
                     /db_xref="GI:489244528"
                     /translation="MTTPTRDQIKAVLEEIRNGLGCHEEESEPIATEEDDEILSGDSS
                     LGIICDSINLLNLSRIDKNEWSYIRVSPRSSFGDPVWDFGDYPSPNGFPIRINFDYVN
                     MYGVNVCGVGHEHWVNIARALLFYRVPHFGIHGRINAYTSLESDKTKVLRLVGLFQAE
                     GLYLGSENSPDFRTVNDLAKSSVEHYIESLPTSGIKWEFCYLMSFWQGVSSMGMLPSE
                     YSLYDSYVTKELVAKYRREYDESSRPFEPIPLDDYAEIFRYCVGFVENYSDDVLWLYK
                     NFAPTIVGAFENPGKLAAMNIGVSTASVEGVKRFRAYKPKLLDSGIPWWGIEIKERTH
                     ENDEGEYINQTAVISVVVSLIDACIVLLLCLTGMRRSEVIGLKVDCLSFKSEGYWLTY
                     TVFKTSISSQGDIKTIPIPKIAADAIEVIIEIGRDARAYGNHDYLFVKIPKLSFGNTP
                     QSTVVERACNRVANNLGIDYRVHPHRFRKSLALYIIHQDSRNLEIIKRLFSHRSLKMT
                     LRYILSLPGMNDEVKATLIEENTEILVEVLQGVISGQIGGIGGKRLAKTANSSPILRA
                     KLQNAGKESLSQYVASLLDEGVKLLHRTNLAICMRTPGLSSESPCDAKNDSPGSRLHP
                     NLFACDPYNCRYAAFVEANAPSLKNEIIFHDNMIKHRYCGATQKEYSQRRIAEAFKRL
                     HEVVGDEAHNFLKQVAHG"
     gene            82403..83269
                     /locus_tag="PSPA7_RS00340"
                     /old_locus_tag="PSPA7_0074"
     CDS             82403..83269
                     /locus_tag="PSPA7_RS00340"
                     /old_locus_tag="PSPA7_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family site specific
                     recombinase"
                     /protein_id="WP_003152712.1"
                     /db_xref="GI:489244527"
                     /translation="MLKDQKLLAHINPVVKVTTLGFNLPSGRPAMHQREMQKFVRQTD
                     YEIALSVLNDPVYQIIAAIIRITGLRPIDLFQLPYRGRNENYGFIPYDEGEYPEGLDN
                     GAIYYYFRSKGKWRSIDFPGKLWRVICEYYLPLRRQRAKLYEAKHGIPPRNSDLFLSA
                     RGDVVTHGMLGYNFSKVVSAAKNSESATDFKAIRFNARMLRHTCATYFVYEALKAQNR
                     LGRSFVYDAALDEDLRKMLGHTDVRTTLEYYVHLVNRYVHDNLLTDLHRSRVDAGLSA
                     ILDRHNYSEIVV"
     gene            83497..85473
                     /locus_tag="PSPA7_RS00345"
                     /old_locus_tag="PSPA7_0075"
     CDS             83497..85473
                     /locus_tag="PSPA7_RS00345"
                     /old_locus_tag="PSPA7_0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_011979090.1"
                     /db_xref="GI:500712653"
                     /translation="MNTENHSQTAAFLWSIADLLRGDFKQSQYGRIILPFTLLRRMEC
                     VLEPTREAVIRESYAQEGRPDLVRERLLLRAAGQQFFNASKLTLGTLSDTQTAADLMS
                     YVQSFSKDAREIFEHFHFEDFVQQLSAANLLYQVVQRFAATDLSPERISNFGMGIIFE
                     ELIRKFAESSNETAGEHFTPRDIVHLTTSLVITGQDDKLKPNSIVTIYDPTAGTGGFL
                     SEGDEYIQSISQQVTVSLHGQELNPESYAICKADMLIKGQDVTSIKLGNTLSDDQLAD
                     SRFDFMLSNPPFGVEWKKVQKQITDEHSEKGFNGRFGPGLPRVSDGSLLFLLHLVSKM
                     RDPREGGSRIGIILNGSPLFTGGAGSGESEIRRYLLQNDLVEAIIALPTDMFYNTGIA
                     TYVWVLSNHKAAARQGKVQLIDGSQHFAKMRKSLGSKRQYLTEEQIDALVRLYGRFEE
                     TAQSKIFPVEAFGYRRITVERPLRLNFQVSSQRIEKVLEEKAIEKLEAPARQRLIEAL
                     QAMDASVVHRNREQFSKLLKKTLSAHDVSPSTPELKAILSGLSERDSEADICMVKGQP
                     EADAGLRDNENVPLGESVYDYFEREVKPHVADAWIDESKRDEQDGEVGIVGFEIPFNR
                     HFYVFQPPRPLEEIDRDLKGCTDRIKQMIEGLSA"
     gene            85944..86864
                     /locus_tag="PSPA7_RS00350"
     CDS             85944..86864
                     /locus_tag="PSPA7_RS00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049791963.1"
                     /db_xref="GI:908647949"
                     /translation="MQRISRGLLGNIRVVTPSLEEQTQIARFLDHETARIDALIEEQQ
                     RLIELLKEKRQAVISHAVTKGLDPTVPMKDSGVEWLGEVPAHWEVRSISSISKKITNG
                     YVGPTRDILVDEPGVRYLQSLHIKSNKIKFEVPYFVSEQWSAEHAKSILASGDVLIVQ
                     TGDIGQVAVVTEEHAGCNCHALIIVSPVREVVLGEWVSWVLNSTYGYHSLLSIQTGAM
                     HPHLNCGNVKFLNLPIPPLEEQARIVSFIESGELEMDSLMSETKRSLLLLQERRTALI
                     SAAVTGKIDVRGWQPPASTQAPEPAVAEAD"
     gene            86865..90068
                     /locus_tag="PSPA7_RS00355"
                     /old_locus_tag="PSPA7_0077"
     CDS             86865..90068
                     /locus_tag="PSPA7_RS00355"
                     /old_locus_tag="PSPA7_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019396228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system subunit
                     R"
                     /protein_id="WP_011979092.1"
                     /db_xref="GI:500712661"
                     /translation="MADSKEAQFQQDIITAMVAQGWLTGPASGYDRRTALYTEDFLGY
                     FKDAWPERWDKFAKANPNNPESVLVQKLVRELEQDGTLDVLRHGFKLPGVKIEACSFK
                     PDHGMNPDTLKRYQCNRLRVVQEVSYSPHCREGEYNPRLDLVLFVNGIPVATLELKSE
                     FKQSVENAKRQYRYDRPVKDPLTRKPEPLLTFKRGALVHFAVSQDEVAMTTQLAGKET
                     FFLPFNLGSLDGGAGNPPAPDDSQYATGYLWQRLFQPDAWLKVLGRFLHLQKSVKEDA
                     DGKRVTKETLIFPRYHQWEVVNRLIETTRNEGPGKRYLIQHSAGSGKSNSIAWTAHQL
                     ASLYDAEGQRLFNSVIVITDRTVLDKQLQDTIYQFEHAQGVVKCITRDIGSQSKSEQL
                     AEALAEQTRIIIVTIQTFPALFDALDKYPKLASGHYAVIADEAHSSQTGSSASKLKQI
                     LGSDAVLGKEGDAEEISAEELLDAAVAARAPNERISYYAFTATPKAKTLELFGRVPDP
                     TLPASADNKPEAFHLYSMRQAIEEGFILDVLQNYTTYSTAWKIAHPDGDDEEVDSKKA
                     RMKLARWVRLHPYNINQKVEVIVGHFRANIRHLLGGQAKAMVVTSSRQEAVRYQLAVQ
                     AYVKQMGYTDVHPLVAFSGSVLPDGVIPEEVTESSSLLNPGLNGRDLAEAFDTQDFNV
                     MIAANKYQTGFDQPKLCAMYVDKKLQGVDCVQTLSRLNRTFGDSKPTFILDFFNDPQD
                     ILDAFLPYYTKAELTDVTDPQLIYDLQKKLDAEGIYHWEEVAAFALAFFDPKAAASKL
                     SYYCAPAKERFAKRYKLAQESRQHALDFKRTAEQNGDSAGVKKAEAAVKEAGEQVDQL
                     DLFKKNLQSFVRLYEFLSQIIPYEDRELEQLCVYAKHLHPLLRVDRLDQEDVDVGELQ
                     LTHYRLTKRAEHQLRLSEEQGDYGLKPPTGLGSGKPHDPEKKRLSEIIEALNDIFGAE
                     VSDEDQLQFLTGIANRISRQEDVMAQVNNHSVEQVMHGLFPKRVLDTVLDAMTDNEKM
                     SLEVLDNETKSRAFALVILKMLTAAGGLGQGISGAAV"
     gene            complement(90100..90321)
                     /locus_tag="PSPA7_RS00360"
                     /old_locus_tag="PSPA7_0078"
     CDS             complement(90100..90321)
                     /locus_tag="PSPA7_RS00360"
                     /old_locus_tag="PSPA7_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011979093.1"
                     /db_xref="GI:500712666"
                     /translation="MDKLAKALGERIRMQRKACRISQDALALACSLDRSYVGRIERGE
                     VNITVEKLYRIAGELACDPSSLLPKPSEI"
     gene            90423..91013
                     /locus_tag="PSPA7_RS00365"
     CDS             90423..91013
                     /locus_tag="PSPA7_RS00365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015648372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_034065828.1"
                     /db_xref="GI:730660218"
                     /translation="MKSASYIFDRRLYELLQEPGRTSFTTRELRDAYAARLSGTQFRI
                     ADVRRYVYEQIRRLVRAGWVSPDEDRRVRGQVYHLQPIPTHLQLELIDNGFENSLMAA
                     GMPEPGTAVRDAEALPLESSANTDLQLEALHKEIRLDFLTSMGEAERFKLLLDEMPHL
                     RDKLEGDYLEARDRSSRLLGHLRAIEKTLKTLAAPR"
     gene            91010..92410
                     /locus_tag="PSPA7_RS00370"
                     /old_locus_tag="PSPA7_0080"
     CDS             91010..92410
                     /locus_tag="PSPA7_RS00370"
                     /old_locus_tag="PSPA7_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019396231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_011979095.1"
                     /db_xref="GI:500712674"
                     /translation="MSSSLRSWQNSCITRALEHFTVTPHFFCQATPGAGKTRMAAELA
                     IRLLEQDRIDLVLCFAPSCQVVEGFRSTFAAVLGRRLDGQIGAVGAAYTYQAMEYRDE
                     GFWQLLDDYRVFVVFDEIHHCAGHDPLLSNAWGQQILHRIQDRAAFTLALSGTPWRSD
                     DKAIALARYSSPEGHLICDYRYGLKDAIADDVCRSPRIVLLDNQKVKLTEELGADSSV
                     RLFPSIAKLLGESPVTYEELLRHDEVINPILDLGCSKLNELRQIKPDAAGLVVATDIE
                     HAQQVVLALEAMGEECRIVTNKTPDAQQVINAFRSSACRWIVAVGMISEGTDIPRLQV
                     CCYLSRIRTELHYRQVLGRVLRRTGESDDQAWLFMLAEPTLQSFAERIADDLPDDLAV
                     LNEVQMPASTSGSKAGLIGAAGNIDGLDDSMKIGVEQVIGADTANIVSLGGGAAGPSY
                     QVSFSQHYRQQLLACF"
     gene            93260..93445
                     /locus_tag="PSPA7_RS30400"
                     /old_locus_tag="PSPA7_0082"
     CDS             93260..93445
                     /locus_tag="PSPA7_RS30400"
                     /old_locus_tag="PSPA7_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003152703.1"
                     /db_xref="GI:489244518"
                     /translation="MVMQQAGTEVGMAISALFYLGKDGSTPECIAAIKKVLRPEDLTT
                     LMACKMPKWMRMALELT"
     gene            93900..94133
                     /locus_tag="PSPA7_RS00385"
     CDS             93900..94133
                     /locus_tag="PSPA7_RS00385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003152701.1"
                     /db_xref="GI:489244516"
                     /translation="MGISYYLACLETRQYVWVGRLDPQGEVPVTDVEGSIAMFALVNR
                     NKPLIVVSESHPILEEGMEWSPPATQETCSGQP"
     gene            complement(95398..96480)
                     /locus_tag="PSPA7_RS00390"
                     /old_locus_tag="PSPA7_0086"
     CDS             complement(95398..96480)
                     /locus_tag="PSPA7_RS00390"
                     /old_locus_tag="PSPA7_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="WP_011979100.1"
                     /db_xref="GI:500712694"
                     /translation="MRSSKGEHGPVLIDFLLHINGDVSARVVRVLRELAPRLEVYSID
                     ESFLDLAGLGRPLAGYGRHIRAEVQRLTGMPVGVGISTTKTLAKLANWAAKRRSQSGV
                     VVATRPEQQAALLKDAPLGEVWGVGRKLQAHLGALGVKTAWDLAQQDAWTMRKQFSVV
                     LEKTIRELRGEACFALDEGPEPKQMITCSRSFSRRVTELAPLREAVASYACRAAEKLR
                     AQGDVCQLLQVYIRTGVFNPDEPRYARTASVPLHTPSNDSRDLVQAALAGLEGIYRPG
                     YRYQKAGVMLMNLASPGQVQADLFAPAPRPRSAALMATVDRINTNMGRGTVRLARVPA
                     LGGWSMKQELRSPGYTCRWDELPRVL"
     gene            97316..97879
                     /locus_tag="PSPA7_RS00395"
     CDS             97316..97879
                     /locus_tag="PSPA7_RS00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001097412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chlorite dismutase"
                     /protein_id="WP_026084028.1"
                     /db_xref="GI:648384269"
                     /translation="MNTRVFTFAGGETGVWRVVAMNAVAGAPLPGIPRLNVAAGSVSP
                     QPPGTKWLLRGITSNERYVVREEKDRLVAKQPSLGRAEATCAALIPIRKNPSWWGLSQ
                     DERRKIFEEQSRHIHIGLQYLPAVARRLHHCRDLGENEPFDFLTWFEYSPSDETAFNR
                     LLAELRASVEWQYVDREIDIRLVHEPA"
     gene            complement(98024..100189)
                     /locus_tag="PSPA7_RS00400"
                     /old_locus_tag="PSPA7_0087"
     CDS             complement(98024..100189)
                     /locus_tag="PSPA7_RS00400"
                     /old_locus_tag="PSPA7_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011914409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011914409.1"
                     /db_xref="GI:500263525"
                     /translation="MSTPSVTPYVPFDASKYVRQSDLSKIELSILSNRSHRSDWGYLQ
                     SEIPELMRPLADIAAHSGVSQRLAISSVAVILWNVSKTGKPYWCWSESQWLTLLSNRA
                     GSRPYLASVAYHLGDFRTPQRIAKFRQPAIYASFIFGHAVFRHEHVRLSQALRSLGYA
                     ARHLEQFLSNVLGALMLENGDPRLETFTEELLLKGQQHRSEGVARSVGKVSHGLAAMG
                     ILAKPLRMRGYTCWRAKSIEGIDPTWAMWCRRWRDTSTLRPRTRESNYSFILRTGVWL
                     AREQSGMAAPTDWSMSTCAAFIAAVDRMTVGEWALESAKGTQLKGLGQPIAANSKRGF
                     LHALRRFFTDFELWGWGRLKFSPRHHLATPRSVTFNSGINPRVIDDSTWLKLIWASLN
                     LERSDLLSEIHYPLSMVQAIAVVWTHAGLRSNEIMRLDKRCAHPQTNDVVHEDGTIVP
                     AKTLCYLDIPASKTFKAFVKPVAVVVKERIDAWLEDRPANQAALLDERTGEKVSYLFQ
                     FRGKRIGSSVINGTIIPMLCAKAGVPLEDSRGRITSHRGRASAVTALASVPQGMSLIE
                     LMQWSGHSSPNSTLHYIRIRPTKLAASFVKADQMAHMVSVLIDHDVIVRHSDAPYTFY
                     DLGDSYCSNPFWSSCPHRMACAGCDFNLPKASARAQALESKSSIGRYLEAVPLTPDER
                     AIAEGDLEKLESLIRKLDNVPALDGRMPRRSMRERGGYK"
     gene            complement(101758..102174)
                     /locus_tag="PSPA7_RS00405"
     CDS             complement(101758..102174)
                     /locus_tag="PSPA7_RS00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008567175.1"
                     /db_xref="GI:495842596"
                     /translation="MNIKTNELGRGDSLRQTWQVISFWGLPAVVATLTILLADRHPTL
                     FLAASAALAVMGGACLVNAARCRRLHCYLTAPYFLLLALGGLLAYGFDPHGEQFSRLW
                     LLLALGAAPLLIWLPERLAGRKYLGAPGCGEGRECR"
     gene            complement(102193..103875)
                     /locus_tag="PSPA7_RS00410"
                     /old_locus_tag="PSPA7_0090"
     CDS             complement(102193..103875)
                     /locus_tag="PSPA7_RS00410"
                     /old_locus_tag="PSPA7_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric reductase"
                     /protein_id="WP_008567178.1"
                     /db_xref="GI:495842599"
                     /translation="MTELKIIGMTCASCVVHVKEALEKIPGVHRADVSYASGRAELKV
                     DEAVSREQMQAAVEALGYRAAFEDITLPTRPGLLDKARGWLSGGTDAGKEGDRLHVAV
                     IGSGGAAMAAALKAVERGARVTLIERGIIGGTCVNVGCVPSKIMIRAAHVAHLRRESP
                     FDGGLPATPPLVLRERLLAQQQGRVDELRHAKYEGILESTPAITVLRGSARFQDSHTL
                     SVELVEGGERIVTFDRCLIATGASAAVPPIPGLQDTPFWNSEKALASSSIPQRLAVIG
                     SSVVALELAQAFARLGSRVTILARNSLFFREDPAIGAALTAAFRLEGIEVLEQTQASQ
                     VAHANGEFVLTTKHGEVRVDQLLVATGRTPNTHGLNLEAAGVQLDERGAIQIDQGMRS
                     SKADIYAAGDCTNQPQFVYVAAAAGNRAAINMTGGEAMLNLDTMPAVVFTDPQVATVG
                     FSEAEAHQAGLETDSRTLTLDNVPRALANFDTRGFIKLVAETGSGRLLGVQAVTPEAG
                     ELIQTAALAIRARMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSCCAG"
     gene            complement(103908..104342)
                     /locus_tag="PSPA7_RS00415"
                     /old_locus_tag="PSPA7_0091"
     CDS             complement(103908..104342)
                     /locus_tag="PSPA7_RS00415"
                     /old_locus_tag="PSPA7_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter MerC"
                     /protein_id="WP_008567179.1"
                     /db_xref="GI:495842600"
                     /translation="MANSFNLFTRIGDKAGSVGVLVSAIGCASCFPALASLGATIGLG
                     FLSQWEGLFITTLLPLFAGVALLVNALGWFSHRQWRRAAPGLIGPALVLVAVFLMLAH
                     GWRSGWLLYIGLAVMFGVSIWDFVSPAHRRCSPASCPTPPNQ"
     gene            complement(104355..104630)
                     /locus_tag="PSPA7_RS00420"
                     /old_locus_tag="PSPA7_0092"
     CDS             complement(104355..104630)
                     /locus_tag="PSPA7_RS00420"
                     /old_locus_tag="PSPA7_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter"
                     /protein_id="WP_008567180.1"
                     /db_xref="GI:495842601"
                     /translation="MKKLLAALALIAVVSPVWAASQIITLSVPGMTCAACPITVKKAL
                     TKVEGVTKAEVSYEKREAIVTFDDAKTSAQALTKATEDAGYPSSVKQ"
     gene            complement(104644..104994)
                     /locus_tag="PSPA7_RS00425"
                     /old_locus_tag="PSPA7_0093"
     CDS             complement(104644..104994)
                     /locus_tag="PSPA7_RS00425"
                     /old_locus_tag="PSPA7_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter"
                     /protein_id="WP_008567181.1"
                     /db_xref="GI:495842602"
                     /translation="MSESRNGRGALLTGGLAAILASTCCLGPLVLIALGFSGAWIGSL
                     TVLEPYRPFFIGAALVALFFAYRRIFRPAQVCIPGEVCADPQVSTIYKLVFWVVTALV
                     LVALAFPYILPLFY"
     gene            105066..105476
                     /locus_tag="PSPA7_RS00430"
                     /old_locus_tag="PSPA7_0094"
     CDS             105066..105476
                     /locus_tag="PSPA7_RS00430"
                     /old_locus_tag="PSPA7_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_008567182.1"
                     /db_xref="GI:495842603"
                     /translation="MHNAVESLTIGAFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIR
                     RYGEADVARVRFVKSAQRLGFSLDEVAGLLRLDDGAHCDEARVLAEQKLEDVREKLAD
                     LQRIESVLAQLVDDCCASQGTVSCPLIVSLQASK"
     gene            complement(105619..105993)
                     /locus_tag="PSPA7_RS00435"
     CDS             complement(105619..105993)
                     /locus_tag="PSPA7_RS00435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017362252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_017362252.1"
                     /db_xref="GI:515931669"
                     /translation="MWYSLGRAFPDTSPVRSHRHPAQAERASTPLGIDPIHHLHDLLR
                     GDGLYGGDHDVTRATEQIVSMRDKADAILVAETVKKIEQLGATAAGRGEAKRSPAVRL
                     QGRYVLLDQMQRGPAPLMHKGK"
     gene            complement(106040..106393)
                     /locus_tag="PSPA7_RS00440"
     CDS             complement(106040..106393)
                     /locus_tag="PSPA7_RS00440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008567186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_008567186.1"
                     /db_xref="GI:495842607"
                     /translation="MLDKVIDGILSTNGKLSISGVAKAAGVTPGLIHNTYPAVAERIR
                     GLMGKSVRAQRDSKHQALLKERELNRALRAENAQLSQDLARLASVNQTLILELAQLKG
                     VATGKVVLLSSKPAS"
     gene            complement(106465..107547)
                     /locus_tag="PSPA7_RS00445"
     CDS             complement(106465..107547)
                     /locus_tag="PSPA7_RS00445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017516609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019486123.1"
                     /db_xref="GI:518315916"
                     /translation="MIRCRDAVLYIASITSGMRNEEVIGIEVGAWRKEVVDGVTYCWV
                     TTTEHKTGKGRVDYLVPELTLDALNLFAMCSTPMRRELEAELSDLELSCNSVDSADLL
                     LRLEKARKDSKRLFLCLNGYGNKAERVGHIEVLSAAGSNEAFKRVAKAAGSDWPLRTH
                     QCRRTYARCFVESRMGRTSLVFLKWQFKHSSMSMTQLYASNPLQDLTLFDEILQQMTE
                     FKIDLIESWLDDQPLAGGAGERIMELRAIPIKDRSALLAQTAPHANIRATGHGWCIAT
                     ERGCGGAGLYEATRCPGCKHSVIDETFATTWQGIYSHQLELMEIDDAGPAVRQRAKRD
                     MQVAFDVISSLGLSPLDARDSDPTRT"
     gene            complement(108299..109885)
                     /locus_tag="PSPA7_RS00450"
                     /old_locus_tag="PSPA7_0098"
     CDS             complement(108299..109885)
                     /locus_tag="PSPA7_RS00450"
                     /old_locus_tag="PSPA7_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017362250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041025267.1"
                     /db_xref="GI:751334169"
                     /translation="MQSVTKGFETVENELRIDLPKNPRNVTKIDHSQYIGFGFDAWAI
                     QSIHVIRALVNGGNFSLATLVGYSSNGLRYFMAFLKSGTIDSPPSTPNSLTKRHLERY
                     VSWLKLKYPNGSTAKNYYTSLKSLIISLIEYGFVEADKDDLLPAVPFPHTAKSTNDAK
                     PLSLSEMQGLITALKSDLVAIHKGLFSGNDAEAMTVLLLITAARSGINTTPLLEMSRD
                     ALQPHPFIPNLWLLNTVKRRGKGAQSKTIRKTELHDGYNPIPLDGVAVVNKALAISEP
                     LVGFAPEKLKSHVWLYRAGQNGHGHRVVALASSTLFQSTKSICARHALKDDQGQPLIV
                     NLSRLRKTMESRLWKLSGGDLLEVSAVMGHSPSVADNHYLKINDEIKVEGATFVGEAF
                     TDQLRGINVTPTPPGGCKDSLYGSLAPKDGVTHCSEFIHCLTCPSYAIVGTLGDLYRL
                     FSYQQFLHAEMEYFLTDEWAAWRKRQGDFIRLIDEFTSRKFKIELIEAAKAKAKASPH
                     PFWGCKIEFMRKVRGDALVG"
     gene            complement(109926..111083)
                     /locus_tag="PSPA7_RS00455"
     CDS             complement(109926..111083)
                     /locus_tag="PSPA7_RS00455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010794485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010794485.1"
                     /db_xref="GI:498493741"
                     /translation="MRLVFATKDLAVAGRSFEGFPLLVGADGWPVEPAQSFLWHTLVE
                     SGEALSALTWEAYGRRLFDYFAFLEANGLAWNEESQADGLSVLSRYRDWSSGELELDP
                     STLNKRLNLIVRFYQWAKQRDLIAALPFGERRVRATPHSGFLSHVARPNAESTKPSVM
                     VRERKRLTKFLTKDQAKVCLALDADPSHRILFHLMVRTGLRSCEARTFPFKYVFNPRL
                     KKGLRPGQMISVALEPSDMHLKYGRPRTIDVPWSLMEEMWSYTLHEREVRKAAGNGRA
                     TALVLTREGRQYTKDSIVDVMKAYERKCGFYVRAHMLRHTYGTYTLLALRKSRDFKGE
                     PLLYVRDRMGHSDVQTTMVYLHLINQLEAQSVLAHEDEIDMMFMAVSTPSI"
     gene            complement(111181..111309)
                     /locus_tag="PSPA7_RS00460"
                     /old_locus_tag="PSPA7_0099"
     CDS             complement(111181..111309)
                     /locus_tag="PSPA7_RS00460"
                     /old_locus_tag="PSPA7_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ultraviolet light resistance protein B"
                     /protein_id="WP_011979105.1"
                     /db_xref="GI:500712730"
                     /translation="MPTYALVDCNNFYVSCERLFRPDLRAVPMVVLSNNDLRDCFR"
     gene            complement(111309..111740)
                     /locus_tag="PSPA7_RS00465"
                     /old_locus_tag="PSPA7_0100"
     CDS             complement(111309..111740)
                     /locus_tag="PSPA7_RS00465"
                     /old_locus_tag="PSPA7_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V"
                     /protein_id="WP_034065824.1"
                     /db_xref="GI:730660202"
                     /translation="MALTVIGRPSRPGLRLPLFLSRVAAGFPSPAEDHIEASLSLDEL
                     CVVHPAATFFLRVVGDSMTGLGIFDGDILVVDRSITPRAGMVVVAVVNGEFTCKQLAY
                     EHGAPVLRAANKAYPDIRLRDGEDLEVFGVVTRCIHKLPGF"
     gene            complement(111876..112310)
                     /locus_tag="PSPA7_RS00470"
                     /old_locus_tag="PSPA7_0101"
     CDS             complement(111876..112310)
                     /locus_tag="PSPA7_RS00470"
                     /old_locus_tag="PSPA7_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012824083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric resistance operon regulatory protein"
                     /protein_id="WP_003131969.1"
                     /db_xref="GI:489223549"
                     /translation="MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLLEPDKPYGSIR
                     RYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASSLAEHKLKDVREKMAD
                     LARMEAVLSELVCACHARRGNVSCPLIASLQGGASLAGSAMP"
     gene            112382..112732
                     /locus_tag="PSPA7_RS00475"
                     /old_locus_tag="PSPA7_0102"
     CDS             112382..112732
                     /locus_tag="PSPA7_RS00475"
                     /old_locus_tag="PSPA7_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001294665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transporter"
                     /protein_id="WP_003131974.1"
                     /db_xref="GI:489223554"
                     /translation="MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNL
                     AVLEPYRPIFIGVALVALFFAWRRIYRQAAACKPGEVCAIPQVRATYKLIFWIVAALV
                     LVALGFPYVMPFFY"
     gene            112745..113020
                     /locus_tag="PSPA7_RS00480"
                     /old_locus_tag="PSPA7_0103"
     CDS             112745..113020
                     /locus_tag="PSPA7_RS00480"
                     /old_locus_tag="PSPA7_0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004099005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter"
                     /protein_id="WP_003131987.1"
                     /db_xref="GI:489223567"
                     /translation="MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAI
                     SKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ"
     gene            113092..114777
                     /locus_tag="PSPA7_RS00485"
                     /old_locus_tag="PSPA7_0104"
     CDS             113092..114777
                     /locus_tag="PSPA7_RS00485"
                     /old_locus_tag="PSPA7_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013974868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric reductase"
                     /protein_id="WP_003158917.1"
                     /db_xref="GI:489250848"
                     /translation="MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAI
                     VPGTSPDALTAAVAGLGYKATLADAPLADNRVGLLDKVRGWMAAAEKHSGNEPPVQVA
                     VIGSGGAAMAAALKAVEQGAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRES
                     PFDGGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQS
                     LTVRLNEGGERVVMFDRCLVATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVI
                     GSSVVALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAFRAEGIEVLEHTQAS
                     QVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIAIDQGMR
                     TSNPNIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATV
                     GYSEAEAHHDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEA
                     GELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
     gene            114795..115160
                     /locus_tag="PSPA7_RS00490"
                     /old_locus_tag="PSPA7_0105"
     CDS             114795..115160
                     /locus_tag="PSPA7_RS00490"
                     /old_locus_tag="PSPA7_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000995360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_000995360.1"
                     /db_xref="GI:446918104"
                     /translation="MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDD
                     AALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLALLRQFVERRREALADL
                     EVQLATLPTEPAQHAESLP"
     gene            115157..115393
                     /locus_tag="PSPA7_RS00495"
                     /old_locus_tag="PSPA7_0106"
     CDS             115157..115393
                     /locus_tag="PSPA7_RS00495"
                     /old_locus_tag="PSPA7_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P06690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance protein"
                     /protein_id="WP_003132004.1"
                     /db_xref="GI:489223584"
                     /translation="MNNPERLPSETHKPITGYLWGGLAVLTCPCHLPILAVVLAGTTA
                     GAFLGEHWVIAALGLTGLFLLSLSRALRAFRERE"
     gene            115390..116391
                     /locus_tag="PSPA7_RS00500"
                     /old_locus_tag="PSPA7_0107"
     CDS             115390..116391
                     /locus_tag="PSPA7_RS00500"
                     /old_locus_tag="PSPA7_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979107.1"
                     /db_xref="GI:500712832"
                     /translation="MSAFRPDGWTTPELAQAVERGQLELHYQPVVDLRSGGIVGAEAL
                     LRWRHPTLGLLPPGQFLPVVESSGLMPEIGAWVLGEACRQMRDWRMLAWRPFRLAVNV
                     SASQVGPDFDGWVKGVLADAELPAEYLEIELTESVAFGDPAIFPALDALRQIGVRFAA
                     DDFGTGYSCLQHLKCCPISTLKIDQSFVAGLANDRRDQTIVHTVIQLAHGLGMDVVAE
                     GVETSASLDLLRQADCDTGQGFLFAKPMPAAAFAVFVSQWRGATMNASDSTTTSCCVC
                     CKEIPLDAAFTPEGAEYVEHFCGLECYQRFEARAKTGNETDADPNAGFGEQWNQKPT"
     gene            complement(116395..117324)
                     /locus_tag="PSPA7_RS00505"
                     /old_locus_tag="PSPA7_0108"
     CDS             complement(116395..117324)
                     /locus_tag="PSPA7_RS00505"
                     /old_locus_tag="PSPA7_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="WP_003150544.1"
                     /db_xref="GI:489242334"
                     /translation="MKIGYARVSTRDQKADLQVDALKQAGCERIYQDIASGAKSARPE
                     LDKLLANVRPGDAVVIWKLDRLGRSLKHLVELVGELAERKVGLQSLNDPIDTTHAQGR
                     LVFNLFASLAEFERELIRERTQAGLSAARARGRIGGRPKGLPAKAEATAMAAETLYRE
                     GRLSVSAIGEKLHISKSTLYSYLRHRGVEIGAYQKSARSRDQQPSAASPAEPPAAERV
                     ATVTLRLAVVNNSKFVRGRKRATENIERYCLEPYGMKRLDAGHYELTIPYRSDDELDK
                     SVHDLLTEISQEADMRNCFVEMGAWEEDTEKRW"
     gene            117526..117765
                     /locus_tag="PSPA7_RS00510"
                     /old_locus_tag="PSPA7_0109"
     CDS             117526..117765
                     /locus_tag="PSPA7_RS00510"
                     /old_locus_tag="PSPA7_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017335987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003089107.1"
                     /db_xref="GI:489179616"
                     /translation="MNTIRWNVAVSADTDQSLRMFLASQGGGRKGDLSRFIEEAVRAH
                     ILELSAEQAKAANAHLSEAELTNAVDEALDWARKR"
     gene            117765..118175
                     /locus_tag="PSPA7_RS00515"
                     /old_locus_tag="PSPA7_0110"
     CDS             117765..118175
                     /locus_tag="PSPA7_RS00515"
                     /old_locus_tag="PSPA7_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_003150546.1"
                     /db_xref="GI:489242336"
                     /translation="MRVVLDTNILFSALISPHGAPDAIYRAWRAARFEVVTSRMQLDE
                     IRRASRYPKLQAILQPAKVGAMINNLQRAVVLERLTIEVEADDPDDSFLLAMALAGDA
                     DYLVTGDRRAGLLQRGHIERTRIVTPAVFCVEVL"
     gene            118179..121172
                     /locus_tag="PSPA7_RS00520"
                     /old_locus_tag="PSPA7_0111"
     CDS             118179..121172
                     /locus_tag="PSPA7_RS00520"
                     /old_locus_tag="PSPA7_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003089110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_003299771.1"
                     /db_xref="GI:489393244"
                     /translation="MPVGFLTQEQRDGFGRYVDSPSREELERYFHLSDEDREAIQVLR
                     GNHNRLGYAVLLTTVRFVGVLPDKPAAVPVEVLQVLCRQLAIPDPDCLQRYSDHRRWI
                     HATDIQNRFGYRHFTDPGIGFRLSRWLYALCWTGTDRPGVLFERATSWLFTQKVLLPG
                     VSQLERFIAQLRSRVEERLWFTLGRSVTEEQRLQLQDLLTVAEGNRSSRLDQLRSGPV
                     MVSGPALIRALRRLDDVRGIGITLPAAAHIPPSRIAALARFANTAKVTAINRLPASRR
                     MATLVAFALCLEATAHDDALEVLEALLRDLFSNAEKADKKARMRSLKDLDRSAATLAA
                     ACKVVLDSSISDDNVRARLFNDLPRTTLEKALEEVNALIRPVDDVYFLALEARYRSVR
                     RFLPDLLKHIRFGFSPAGKGVAASLEWLQLNLPRRKPEDDAPQEIVAKAWQKHITRED
                     GSLDMGAYVFCTLDALRTALRRRDVFVSPSWRYADPRLGLLDGAEWLAARPIICRSLG
                     LTIDAKTTLDALSVELDATWLAVAARLPDNPAIQLSENTEGKTELSLGALDKLDEPCS
                     LLQLRAAVSDLMPRVDLPEILLEIAARTGFSEAFTHVSERNARADNLVTSLCAVLLGG
                     ACNTGLEPLIRTDNPALRRDRLSWVSQNYIRDDTLSAANAILVGAQSQLELAQVWGGG
                     EVASADGMRFVVPVRTVHAGPNPKYFGTGRGVTWYNLISDQFSGLNAITVPGTLRDSL
                     VLLAVVLEQQTELQPTQIMTDTGAYSDVVFGLFRLLGYHFSPRLADVGGTRFWRTRPD
                     ADYGKLNGLARQSVKLDLIAEHWDDLLRLAGSLKLGRVPATGIMRTLQTGDRPTRLAQ
                     ALAEFGRIEKTLHTLTYIDDESKRRATLTQLNRGEGRHSLARAVFHGKRGELRQRYRE
                     GQEDQLGALGLVVNIIVLWNTLYMTAAVERLKQHGYPVLEEDLARLSPLIYEHINMLG
                     RYSFAVPEEVARGELRPLRNPDDDL"
     gene            complement(121405..121680)
                     /locus_tag="PSPA7_RS00525"
                     /old_locus_tag="PSPA7_0113"
     CDS             complement(121405..121680)
                     /locus_tag="PSPA7_RS00525"
                     /old_locus_tag="PSPA7_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter"
                     /protein_id="WP_003150552.1"
                     /db_xref="GI:489242342"
                     /translation="MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSL
                     EKVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEATANAGYPSTVQK"
     gene            complement(121693..122043)
                     /locus_tag="PSPA7_RS00530"
                     /old_locus_tag="PSPA7_0114"
     CDS             complement(121693..122043)
                     /locus_tag="PSPA7_RS00530"
                     /old_locus_tag="PSPA7_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009682418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter MerT"
                     /protein_id="WP_003089115.1"
                     /db_xref="GI:489179624"
                     /translation="MGMQLTGKGSLVASSLTAIGASVCCVGPLVLLALGVGGTWVGAL
                     TMMEPLRPLFIGLTLLFLGLAFRKLYLVPQVCTPGTPCADPRTLVRQRLVFWIVSVLL
                     LGLLAVPWLAPLFY"
     gene            122118..122516
                     /locus_tag="PSPA7_RS00535"
                     /old_locus_tag="PSPA7_0115"
     CDS             122118..122516
                     /locus_tag="PSPA7_RS00535"
                     /old_locus_tag="PSPA7_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003089120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_003089120.1"
                     /db_xref="GI:489179629"
                     /translation="MATELTIGKLADAAGVNVETIRYYQRRGLLDEPAKPLGGHRRYP
                     VDMVKRLRFIKRAQALGFTLSEVGGLLTLDESCACAETRARAARKLALIEQKMADLVV
                     MQQLLGELVQQCDAGDGGTICPIIEALIRE"
     gene            122819..123664
                     /locus_tag="PSPA7_RS00540"
                     /old_locus_tag="PSPA7_0117"
     CDS             122819..123664
                     /locus_tag="PSPA7_RS00540"
                     /old_locus_tag="PSPA7_0117"
                     /function="AraC-type DNA-binding domain-containing
                     proteins"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012080657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_003464995.1"
                     /db_xref="GI:489560460"
                     /translation="MDRLSNLLSRFGVRANLFYDGDLCGSASYDGAERRGYIHLLQAG
                     SVTLLGPDRKDLQLTRPSLIFMPRPAKHQLFAGESDGAKLLCASMEFEGGIDNPLSAS
                     LPDCLVLALDDLPMLADTLEWMFAEAANVHCGREAALERLFELLIILLLRYLLDHHQL
                     RTGMMAGLADMRLARSLLQMHNSPEHAWSIAELASESNMSRAAYAVHFKSVIGQTPAD
                     YLLSWRVSLAQKLMREGRSITLIAAQVGYESPSALSRAFRRKTGLSPRDWLKDLAGEN
                     DGKKA"
     gene            complement(123694..124212)
                     /locus_tag="PSPA7_RS00545"
                     /old_locus_tag="PSPA7_0118"
     CDS             complement(123694..124212)
                     /locus_tag="PSPA7_RS00545"
                     /old_locus_tag="PSPA7_0118"
                     /function="Predicted membrane protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003464991.1"
                     /db_xref="GI:489560456"
                     /translation="MKTIGIENSKSSVQAHLTLGTKTMGLGIYGAYLALAIIYFWFGG
                     MKFTHYEAEGLVPLVSNSPLLGWVYSIFSVDMFSSLLGILEISIGTLIAGRMLSPKLS
                     VVGGALSAGLFFTTLSFMFSTPGVIEPSLGFPAISVAPGQFLLKDLGLLAVSIFVAGH
                     SLVELEKRKINA"
     gene            complement(124955..125842)
                     /locus_tag="PSPA7_RS00550"
     CDS             complement(124955..125842)
                     /locus_tag="PSPA7_RS00550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016487063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016487063.1"
                     /db_xref="GI:512729136"
                     /translation="MATFFGSHSGFPMARLSTLYEVADGQTLHSLIVPLTVGERDCAH
                     LHLEHLPADSLTLFDRGYPGHWLFALFAQQQRHFLMRLPCGYNAQVKAFLHSGQVEDT
                     QLFVANHPEARLFCSEAGVDPASQIELRLIRVELANGESEVLLTSLLDREAFPAEVFA
                     ELYHRRWGIETDFRRLKQTLTLDNFSGRSVTAVKQDFHAAQLLKNLALLMQHLLQPVI
                     EQRHKGRKLRWKVNFTQGVSRLKNTLVELLVRHCAQGLSNVLALMAKSLSAVRSGRSF
                     ARQRKRAASRGCEGYKPTR"
     gene            125861..126265
                     /locus_tag="PSPA7_RS00555"
     CDS             125861..126265
                     /locus_tag="PSPA7_RS00555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016487064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003291491.1"
                     /db_xref="GI:489384854"
                     /translation="MHGRAIHREHPQPTPLLTQPEAVNLLLQEAIETFKYLGVELFAR
                     FAEGLRSDHLRLSRRLIEYAIELIEFGLQGRARLIEQEQDEVLEGELASAGKVLRILA
                     VGGDEGGTIERAGYFLYNFQARVWLAVSSDAV"
     gene            complement(127823..128089)
                     /locus_tag="PSPA7_RS00560"
     CDS             complement(127823..128089)
                     /locus_tag="PSPA7_RS00560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003464988.1"
                     /db_xref="GI:489560453"
                     /translation="MEHSEFDAAFAKLAEGYREGTYEGRRFSLIVRRSGDGRRNSLFA
                     RELDGTDIVSFNLFRVTSDRTLLKPCEMSAEKVVAFVLEFRPDT"
     gene            complement(128259..128540)
                     /locus_tag="PSPA7_RS00565"
     CDS             complement(128259..128540)
                     /locus_tag="PSPA7_RS00565"
                     /function="Uncharacterized protein conserved in bacteria"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003464986.1"
                     /db_xref="GI:489560451"
                     /translation="MVSAIWKDTTIATSDETVIVEGNHYFPPSGVDLSLLEMSPHTSV
                     CPIKGAARFFHVRAGDALNVNAAWTYPAPTPDAEGIRDYIAFWKGVDVA"
     gene            complement(128608..128880)
                     /locus_tag="PSPA7_RS00570"
                     /old_locus_tag="PSPA7_0120"
     CDS             complement(128608..128880)
                     /locus_tag="PSPA7_RS00570"
                     /old_locus_tag="PSPA7_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005005995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_005005995.1"
                     /db_xref="GI:491147597"
                     /translation="MTTDVLLYTTNWCPFCRRAKALLKEKGVRWKELDIEADPAHRQA
                     MAEASGRSSVPQIFINGTLIGGSDELFALDVRGELDKLLGRNPPAT"
     gene            complement(129334..130080)
                     /locus_tag="PSPA7_RS00575"
                     /old_locus_tag="PSPA7_0121"
     CDS             complement(129334..130080)
                     /locus_tag="PSPA7_RS00575"
                     /old_locus_tag="PSPA7_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002118292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002118292.1"
                     /db_xref="GI:488046895"
                     /translation="MTENEAQVRSWQSCVIDDIIQQTPSIKSFFLRLSKPFAHTAGQH
                     VDIRLTAPDGYSAMRSYSIASSAVSTPIVEIAIERMPDAEVSPFFHDIAAIGDEIEVR
                     GPLGGHFLWPEPAIDPVLLIGGGSGLVPLMAMIRQRRALAQAVPTALLLSARTAEDVL
                     FSEELHCIEISDPAFVLALAITREKPVRASDFARRIDGMMVQEILTRLQGKPTQVFVC
                     GSNGFVNIATDSALLAGLDASIIKTERYGG"
     gene            complement(130073..130675)
                     /locus_tag="PSPA7_RS00580"
                     /old_locus_tag="PSPA7_0122"
     CDS             complement(130073..130675)
                     /locus_tag="PSPA7_RS00580"
                     /old_locus_tag="PSPA7_0122"
                     /function="Sulfite oxidase and related enzymes"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-binding protein"
                     /protein_id="WP_003464980.1"
                     /db_xref="GI:489560445"
                     /translation="MVTRGFTGRGSGDQSDRIPPGQHLVEDFPVLSAGPTPRVEPSDW
                     KFTVKIGPKPVKTWNWGEFNTLPKTQVTKDIHCVTSWSKLDTVWEGVLIEDILADAEL
                     DRPTDFVLAHCYDNYSTNVPLTDLLSGKAMVALSYAGKPLSRDHGGPARLLVPHLYFW
                     KSAKWVNALQFTTRDEAGFWELHGYHIYGDPWREQRYTHD"
     gene            131143..131613
                     /locus_tag="PSPA7_RS00585"
     CDS             131143..131613
                     /locus_tag="PSPA7_RS00585"
                     /function="Thiol-disulfide isomerase and thioredoxins"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase"
                     /protein_id="WP_003464979.1"
                     /db_xref="GI:489560444"
                     /translation="MNEIERQAPELRVQKWIGKDGESIAPFKLSDIGPGPKILFAFQH
                     WCQGCHLHGFPTLQKLHAALSSKDVGFAVIQTVFEGTHENTFEKLRVNQLKYELPIVF
                     GHDEQPTGSPFPTFMEDYRTRGTPWFTVIDAGGSIVFSDFHLDAERLVKQLEQG"
     gene            complement(131939..132229)
                     /locus_tag="PSPA7_RS00590"
     CDS             complement(131939..132229)
                     /locus_tag="PSPA7_RS00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023109439.1"
                     /db_xref="GI:553777674"
                     /translation="MEAFVVFTREETSDPHALATYSAGVGPSFDGHDVTFLAAYGAIQ
                     HLEGPPIEGAVILRFPTMQAARDWYDSPAYQTIAAHRFAGSRYRAFIIEGRR"
     gene            complement(132291..132722)
                     /locus_tag="PSPA7_RS00595"
                     /old_locus_tag="PSPA7_0124"
     CDS             complement(132291..132722)
                     /locus_tag="PSPA7_RS00595"
                     /old_locus_tag="PSPA7_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005006001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005006001.1"
                     /db_xref="GI:491147603"
                     /translation="MTKSIATASINRETAVALIDAALAAARAIGIPAAVAVVDATGNL
                     RAFERTDDAPFLTVDVAIDKAWSSASFGFPTHVWNDYVTNDPKVAPLAYRPRMVAVGG
                     GYPILEDGKLIGGIGISGGNYQQDQDACVEALMKIGFQLPA"
     gene            complement(132795..133808)
                     /locus_tag="PSPA7_RS00600"
                     /old_locus_tag="PSPA7_0125"
     CDS             complement(132795..133808)
                     /locus_tag="PSPA7_RS00600"
                     /old_locus_tag="PSPA7_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003044989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="WP_002118279.1"
                     /db_xref="GI:488046882"
                     /translation="MKAIGYKVPGPIAADAALVDINLPRPVAAGYDILVEVKAVSVNP
                     VDYKVRNSTPPADGDWKVLGWDAAGIVREVGPDVTQFELGDEVYYAGSITRPGTNAEF
                     HLVDARIVGHKPASLSWAEAAALPLTTLTAWEAMFDRLDVAKPVPGAAEAILIIGGAG
                     GVGSIAVQIARQRTDLTVIATASRPETQEWVRGLGAHHVIDHSRPLAPQIAELGIGAP
                     AFVFSTTHTEQHVADIAELIAPQGRFGLIDDPKAFDIMVFKRKAVSIHHELMFTRSIY
                     GTPDMNEQGEILDAMAALVDDGKIRTTLTRRLSPINAANLKTVHALIESGAAKGKIVL
                     EGF"
     gene            complement(134256..135224)
                     /locus_tag="PSPA7_RS00605"
                     /old_locus_tag="PSPA7_0126"
     CDS             complement(134256..135224)
                     /locus_tag="PSPA7_RS00605"
                     /old_locus_tag="PSPA7_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_011979111.1"
                     /db_xref="GI:500712874"
                     /translation="MSIIAAYYYNEGKRVREIALDEHVKLGESRSGFCWIALSEPTPE
                     ELLAIQRTYNLHPLAIDNAMHPLCPPKLEVYNDELYVVAQTAELVGDRISYGKMAIFT
                     GHNHLITVRHGNAGALGKLREQLEASPTQFGKGVDYVLHAILHRVVDQYLPIFEMIED
                     DVLAMERRSLHDFLGPEEVARIFELRSELTRFQRTLRAMAELVRKLVRGHFPCISAEM
                     TPYFHDVADHVHRVQSMVDGLLLVLSTVFEASSLLEAQRIGVVTRQLAAWAAILAVPT
                     AIAGIYGMNFKHMPELDTAYGYFVVLGVIAISCVFLFVRFKKAKWL"
     gene            complement(135221..135925)
                     /locus_tag="PSPA7_RS00610"
                     /old_locus_tag="PSPA7_0127"
     CDS             complement(135221..135925)
                     /locus_tag="PSPA7_RS00610"
                     /old_locus_tag="PSPA7_0127"
                     /function="Glutathione S-transferase"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005006007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_003464969.1"
                     /db_xref="GI:489560434"
                     /translation="MPDLSSFPITQRWPASHPDRLQLYAAPTPNGVKVSIMLEETGLA
                     YEPHLIDISNNESKDPAFVSLNPNGRIPAIIDPAGPDGRPIALWESGAILLYLADKTG
                     QFISTEPGQRYETLAWVFFQMSAIGPMFGQLGFFLRFGGKDYEDKRPQQRFIDESTRL
                     LGILDRRLEGRDWIVDDYSIADIATLGWVNALVEFYAAGDILGLSSFSNVRAWLGRGL
                     ARPAVQRGLHIPARPA"
     gene            complement(136066..136605)
                     /locus_tag="PSPA7_RS00615"
                     /old_locus_tag="PSPA7_0128"
     CDS             complement(136066..136605)
                     /locus_tag="PSPA7_RS00615"
                     /old_locus_tag="PSPA7_0128"
                     /function="Peptide methionine sulfoxide reductase"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003464967.1"
                     /note="this stereospecific enzymes reduces the S isomer of
                     methionine sulfoxide while MsrB reduces the R form;
                     provides protection against oxidative stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="WP_003464967.1"
                     /db_xref="GI:489560432"
                     /translation="MHQRAVLAGGCFWGMQDLIRKRPGIISTRVGYTGGDIPNATYRN
                     HGTHAEGIEIVFDPTVTSYRNILEFFFQIHDPTTLNRQGNDRGLSYRSGIYYVDEEQK
                     RVAEDTIADVDASGLWDGKVVTEVQPVGEFWEAEPDHQDYLEKRPGGYTCHFVRPGWV
                     LPKRQKVDDVQPAAGTAAE"
     gene            complement(136607..137050)
                     /locus_tag="PSPA7_RS00620"
     CDS             complement(136607..137050)
                     /locus_tag="PSPA7_RS00620"
                     /function="Conserved domain frequently associated with
                     peptide methionine sulfoxide reductase"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002118272.1"
                     /note="this stereospecific enzymes reduces the R isomer of
                     methionine sulfoxide while MsrA reduces the S form;
                     provides protection against oxidative stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase B"
                     /protein_id="WP_003464965.1"
                     /db_xref="GI:489560430"
                     /translation="MKFEKSQTAIDHLTPEQHRITQEAGTERPFTGEYNDNKEPGIYV
                     DIVSGEPLFASTDKFDSGTGWPSFTKPIVSANVNEVRDSAHGMVRTEVRSVHADSHLG
                     HVFPDGPSDRGGLRYCINSASLRFIPRDEMESEGYGEYLDQVEEA"
     gene            complement(137571..138374)
                     /locus_tag="PSPA7_RS00625"
                     /old_locus_tag="PSPA7_0129"
     CDS             complement(137571..138374)
                     /locus_tag="PSPA7_RS00625"
                     /old_locus_tag="PSPA7_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011911830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011911830.1"
                     /db_xref="GI:500251488"
                     /translation="MRDLMAELKELRLHGMATAWAELTAQGESNTASSKWLLEHLLEQ
                     EHTDRAMRSVSHQMNMAKLPMHRDLASFDFNASSADARLISELASLAFTDTAQNVVLI
                     GGPGTGKTHLATALAVSGITRHGKRVRFYSTVDLVNLLEREKHDGKAGRIAQALLRMD
                     LVILDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSSVFGDAKMTTALL
                     DRLTHHCHIVETGNESYRLQHSSLAAQAKIKSRERKRKGGQEPEDDEPF"
     gene            complement(138367..139875)
                     /locus_tag="PSPA7_RS00630"
                     /old_locus_tag="PSPA7_0130"
     CDS             complement(138367..139875)
                     /locus_tag="PSPA7_RS00630"
                     /old_locus_tag="PSPA7_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011979112.1"
                     /db_xref="GI:500712885"
                     /translation="MISMEMMGKIRRMYFRDKLSLHEIAKRTGLARNTIRKWVRAPEA
                     KPPVYQRRAIFNKLSPFHATLEQALKADSLRPKQQRRSAKALLAQIKAEGYDGGYSQL
                     TAFIRAWRGGQGKASQAFVPLTFALGEAFQFDWSEEGLLVGGIYRRMQVAHLKLCASR
                     AFWLVAYPSQGHEMLFDAHTRSFGSLGGVPRRGIYDNMKTAVDKVNKGKGRAVNARFA
                     VMCAHYLFDPDFCNVAAGWEKGIVEKNVQDSRRRIWLDAQDCQFHSFEELNAWLGQRC
                     RALWNELTHPQYSGLSVAEVLELERAELMPMPAAFDGYVERPARVSSTCLVSVGRNRY
                     SVPCEYAGKWVSSRLYPTRIEVVADDALIASHARLLDREQVSYDWQHYIPLIERKPGA
                     LRNGAPFTDLPAPLRQLKHGLGRHAGGDRIMAQVLAAVPVAGLDAVLVAVELVLESGS
                     LSAEHILNVVARLTASEPPPSVETHLSLKEAPVANTARYDRLRGQTKEIGHA"
     gene            140428..140811
                     /locus_tag="PSPA7_RS00635"
     CDS             140428..140811
                     /locus_tag="PSPA7_RS00635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017516606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_034037815.1"
                     /db_xref="GI:730529082"
                     /translation="MTGSKKLRSAGDFPNKSVVEYATVRVEIPHRLIPSNLSNPHYRD
                     EDIVAGLYASPTGRLSYKTLYLDSVELAERFVAYLRQLFQNRPYANDFSLKIEVITTT
                     QKVTATKGRAKHSAAVAETLQKTQF"
     gene            complement(140943..>141185)
                     /locus_tag="PSPA7_RS00640"
                     /old_locus_tag="PSPA7_0133"
                     /pseudo
     CDS             complement(140943..>141185)
                     /locus_tag="PSPA7_RS00640"
                     /old_locus_tag="PSPA7_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003302596.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            141407..141955
                     /locus_tag="PSPA7_RS00645"
     CDS             141407..141955
                     /locus_tag="PSPA7_RS00645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015854033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease"
                     /protein_id="WP_031314431.1"
                     /db_xref="GI:665948386"
                     /translation="MMSDELYVSVDVETSGPVPGIYSLLSIGACVVSEPAQSIYLELQ
                     PDGLQHDPEAVAVTGLDLTRLENEGLAPKTAMLKLKQWLNQVCSADQKVVFVGLNAPF
                     DWSFINYYFQKYSGTNPFGFTALDIKAYYMGATGCRWGETKSSQMTARFKPQSAPNHN
                     ALDDARFQGELFALMLEEARNR"
     gene            complement(142440..144224)
                     /locus_tag="PSPA7_RS00650"
                     /old_locus_tag="PSPA7_0134"
     CDS             complement(142440..144224)
                     /locus_tag="PSPA7_RS00650"
                     /old_locus_tag="PSPA7_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein ThiF"
                     /protein_id="WP_011979116.1"
                     /db_xref="GI:500712898"
                     /translation="MGVLVDQTDTSLQRGIAALRGALGEDAAHALLQPAVPRTGEAAS
                     YYFPLPVDYTGTERRLRISFPKNFPRGGLRLTVEPSPWLVWPHAMEVGLCLHGFQERP
                     VMGTPEYVVSDSLARLAKIVNLSRMGSCAATRDAEFRREITSYWSRQQGQSLQNLILL
                     DRPQAASKLYALSDPRQTLPSGQETVWLAPDLASLKRHYRRTIGRSPRMRAPEAPGFY
                     AKLRSYPDLRLPAPELLLTWLLPHLAPNDRTQLVAWFNERGSLPNRWIALELPGDASA
                     PIYCLNVRAYGPRLDRGSRFYLRSARRRPAVVVNHPPVLIRATTLDVLDRTEILSRDL
                     SGVAQKLEGARVVCVGVGSLGSTVALQLARSGVGHLTLIDPDHLVSANLGRHVLGADD
                     LGLPKAEALQERIRKDLPTTDVAAFATFAEVVMYKNPEVFDKADLVVVTTADWQSEVA
                     LWGAKSNGTSWGLLQAWSEPHTQVGHVLLAPSGAFDARGLFTDNGDFKHKFTEWPEGG
                     VVALPACGESFIPGGSLGMVNIASMVSQAALRALNGNIGSPSWVSSINRPDDVVTLGG
                     NYLGPELPAGMQQALLERDWPEISERSK"
     gene            complement(144208..145461)
                     /locus_tag="PSPA7_RS00655"
                     /old_locus_tag="PSPA7_0135"
     CDS             complement(144208..145461)
                     /locus_tag="PSPA7_RS00655"
                     /old_locus_tag="PSPA7_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979117.1"
                     /db_xref="GI:500712902"
                     /translation="MSMSNEQTKRGSWEHFLLRAAKEISLSEAQYEKINDRYSQLEKI
                     LNASDNPLLAEAHIFVQGSMRLKTTIKPVSGAPEDLDTIDADAIIWLPHAQDAGAREV
                     LDAIEERFKAGSRVQEEIKQLRRGIRIVYADENPGFHIDVTPARAINGNSQGNGEGKL
                     EVPDRETGWKASSPIPYSKWLQVASTQTISLAEHMAVAKSQRAFDAATQDPLPQYQDY
                     LDQDPLRATIKLLKRHRDEWAIRTKNTDHRPISAVITTLATHAYLDVAKESQSTPLRP
                     LDAILEIVRRMPDHVKYRGNECQVCNPADSGENFAEKWNRPLDGHRYRRAFQEWHENA
                     SVSVSLGLESFESAEAFAKAVNENFGIGPTFISAVNSEIPPNWTMPGRPDGTTRNATL
                     MGTMFGGASGTASSQEDVKPVGRLG"
     gene            complement(145461..146636)
                     /locus_tag="PSPA7_RS00660"
                     /old_locus_tag="PSPA7_0136"
     CDS             complement(145461..146636)
                     /locus_tag="PSPA7_RS00660"
                     /old_locus_tag="PSPA7_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_034037831.1"
                     /db_xref="GI:730529135"
                     /translation="MGKQEKANAATGRYDTDDVTKRVVWTQAAGHCELCGTDLMYDYR
                     AGKPMKWGEVAHILPASPKGPRGRSDHDEAKAASLTNDPANLMLLCPGCHDKIDRDAE
                     GYPESDLSGLHQAYLERVRLAATTPDGGRAIPVIVQSQHFATNNDIPVRDLLVAMSSE
                     GLTAFDHPIKITFPAPSHRGRDAHYWQSIKDNIQHELEQQLKRRGGAYGDVPALAVVG
                     VADIPALIMLGQSLGDRSKRLLFSFNREHQLRWPDQSAEPPEFVFTPPSDGEGPLALV
                     LSISAQVPTRDVEEALPGARIAELSIPVPSYAMVQNRRVIHAFRDALQTHLSRLEAMT
                     ADTIHVFAAIPAALAIEFGALLTTQHQHAYLIFDRDKDNQNRFTPTLQLGHQAQEVR"
     gene            complement(147202..148725)
                     /locus_tag="PSPA7_RS00665"
                     /old_locus_tag="PSPA7_0137"
     CDS             complement(147202..148725)
                     /locus_tag="PSPA7_RS00665"
                     /old_locus_tag="PSPA7_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979119.1"
                     /db_xref="GI:500712908"
                     /translation="MTKKKKKSRSGKITTPLAGHKRVGKALVPPMLQLEGVSFSSWVN
                     DRLPEMLWASLVITVIPRDQALEAFRDIAALGLRYRKDEREQATGWTLRHTHLPAQPR
                     ELFEALVGRVLRCHAGAQALRPLLLLENLPGITWWKAALGSEPIEDDWQTLGQAVQKT
                     FDHQSQEATDVRWVSILFKIALGEMLFPAGFEEHLLEIVEYPNRGDMRSVRPSIRAME
                     MTFTHLGQSSWSESFWTDMLQQTGCTPAPLLPREKPSNDLQAVRLGLVEVRKALLEHW
                     FTTLSTSGIDPKQDGVFGFGFFALSCFAEMSSGPLNEGIAGRLLLRALTECRISLAFL
                     VRCGDDAMWKKFRSYGAGQAKLALLKHEEMTGERPRFVTLETLERLANEDYFQEYVEI
                     DLGHWCGKDLRKLAEESGTKEDYDRYYGWASGFVHGQWGAMRDSNFTHCLNPLHRFHR
                     VPLPFHRKLEPTLDDGLQLVNSILDDVSTAYPGFNARIKISSDSMERQEDAATVEPT"
     gene            complement(148828..150540)
                     /locus_tag="PSPA7_RS00670"
                     /old_locus_tag="PSPA7_0138"
     CDS             complement(148828..150540)
                     /locus_tag="PSPA7_RS00670"
                     /old_locus_tag="PSPA7_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003150565.1"
                     /db_xref="GI:489242355"
                     /translation="MRRFEAKDLIALATAPMNPDDHWYVDAEQASQYLVANANADEIV
                     IYASAPAVLIVGALVPTVNVTPVDGGALQNTSLCTDAAWKIQKSWNAAEGYRVYLEPP
                     FPNDRVSALSGGETLVTRRYLSGVHKGPAPIEVSQKLVHCLDIHYIPERNAYCRLDGN
                     GDIEDVIRVLTLPIDEQLEGREVVTILRKDLDTYMAVADLALVIKFDFTRTVRGSFSG
                     WNDVSRYHRDGEDLFYHGGSAARASFMHGAMVVRSRTTLAEQEEAWRRDFEGAPDREY
                     AVFKIYDRKNDRNVETSASPLHIVSYFEQSDLPWQISPAFFRPEVLQRFKADPEKYTL
                     EDRSISCRGAWHIKSYDINEAGQVHVYIGDLAKLPIAEQNYWKAFNEWPKSSISARAH
                     RTDIEGQWCTTYDPLNSLRNKVRALDKACPEWWNRRGDALMDSVLAPATDSPKEWGDE
                     ILALDQLLVEGFLDKPLRKIAQEKGREIEPVWRSLKLLHEILLGSTLSEEAAKQLLAP
                     MKKLHELRNEIRGHATHEKKEVAIREARTTHGNFRAHFFHLAEGCDQALIGVLKALEF
                     EMED"
     gene            complement(150790..151068)
                     /locus_tag="PSPA7_RS00675"
     CDS             complement(150790..151068)
                     /locus_tag="PSPA7_RS00675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018388004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019407028.1"
                     /db_xref="GI:518236820"
                     /translation="MSLAFETAAGLDAIEIAVDVDLQQVGRMVSGATCFSRDDALETQ
                     LAKVEFIDENIDHPHRVGVRHVVIQALGKQRALASMLSLDKTLHWRPR"
     gene            <151107..151940
                     /locus_tag="PSPA7_RS00680"
                     /pseudo
     CDS             <151107..151940
                     /locus_tag="PSPA7_RS00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148781.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
     gene            complement(152053..152967)
                     /locus_tag="PSPA7_RS00685"
                     /old_locus_tag="PSPA7_0141"
     CDS             complement(152053..152967)
                     /locus_tag="PSPA7_RS00685"
                     /old_locus_tag="PSPA7_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979121.1"
                     /db_xref="GI:500712916"
                     /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRA
                     EYYPSCYEPVGHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGG
                     ALAGGAAGYYMEKQKQISDDRARIGSYGTDVDRSTVEINRSVAYAKSAQSCYQSQFKA
                     LLDGRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENISNYTQAYEKDLQQV
                     GVPRAEVTKVAEAENRASTTKGGNKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKV
                     ASQGQGMIREVCNSPDMGDWAPPSCAKA"
     gene            complement(153029..154741)
                     /locus_tag="PSPA7_RS00690"
                     /old_locus_tag="PSPA7_0142"
     CDS             complement(153029..154741)
                     /locus_tag="PSPA7_RS00690"
                     /old_locus_tag="PSPA7_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_011979122.1"
                     /db_xref="GI:500712920"
                     /translation="MFEKAILPLALGACLGFAAPAWAEGDPPDNPRPLADDVALPLPC
                     GGEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLA
                     PAWQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDV
                     PSGMAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGGTGFVRLPT
                     EVEWEFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLADWAVYNQVAGGTGQAARLLP
                     VGMKRPNPLGLYDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTG
                     MRREYPLFAADGSEQRNATTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDD
                     AQDPTKQLDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAE
                     TINNYNIRLTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTR
                     YTDAVIQAQFQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLA
                     SSGR"
     gene            complement(154734..155933)
                     /locus_tag="PSPA7_RS00695"
                     /old_locus_tag="PSPA7_0143"
     CDS             complement(154734..155933)
                     /locus_tag="PSPA7_RS00695"
                     /old_locus_tag="PSPA7_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011979123.1"
                     /db_xref="GI:500712922"
                     /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYG
                     LVGTLTERLERAPSVREIIPVGGARYRAEDIAALAARADVAFAVPRTRQIAASADLSG
                     GGETVLSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRM
                     DGQAQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVPAYGWPGKAGGA
                     PRERIYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVA
                     ALAIGGAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSALFGLLLA
                     GLLYAAAAGALNHLFDNQSGEFVCRLLPSHFLAALLATLLCSVLAAASGGWRAARIEA
                     AEGLRDV"
     gene            complement(155933..156649)
                     /locus_tag="PSPA7_RS00700"
                     /old_locus_tag="PSPA7_0144"
     CDS             complement(155933..156649)
                     /locus_tag="PSPA7_RS00700"
                     /old_locus_tag="PSPA7_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041025443.1"
                     /db_xref="GI:751334345"
                     /translation="MLRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGKS
                     TLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLATLRRQHCGYVLQSGGL
                     LEFLDVRRNIGLPCALLGAPSAERVQTLAERLEIGDQLDKKPAALSVGQRQRVAIARA
                     LVHAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEVL
                     AIRWQREADDSVGACLEDAG"
     gene            complement(156649..159747)
                     /locus_tag="PSPA7_RS00705"
                     /old_locus_tag="PSPA7_0145"
     CDS             complement(156649..159747)
                     /locus_tag="PSPA7_RS00705"
                     /old_locus_tag="PSPA7_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016561468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_011979125.1"
                     /db_xref="GI:500712930"
                     /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALA
                     ADPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLD
                     PELGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQF
                     TQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAH
                     LTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLA
                     TPQGSPRATDPPPAGPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPP
                     SPPPPPLPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPNAADPAPLGQT
                     PTDKPPQQTPMADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPA
                     FSVLYVYARKQVGGSPWLRVGASSNGAGDGWLPASAVSDWKQSLVLKFTERSGRAPVM
                     FLNSAEQVERLLGDTRAARDTLTQAVDHEGDPQVVAVEPNDRAIPQDQFYLLPIFDSK
                     ESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSV
                     SMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQP
                     GNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGAL
                     RKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPK
                     IADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIG
                     YAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLI
                     VDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSL
                     NMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLST
                     LP"
     gene            complement(159755..160483)
                     /locus_tag="PSPA7_RS00710"
                     /old_locus_tag="PSPA7_0146"
     CDS             complement(159755..160483)
                     /locus_tag="PSPA7_RS00710"
                     /old_locus_tag="PSPA7_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012613435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoprotein phosphatase"
                     /protein_id="WP_003157819.1"
                     /db_xref="GI:489249704"
                     /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMG
                     GHAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGST
                     LVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNDLISEDEARHHPR
                     ANVVTRAVGVHERLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLGHSDPYAVV
                     RSLVHLGLTRGAPDNITALVVRAF"
     gene            complement(160493..161173)
                     /locus_tag="PSPA7_RS00715"
                     /old_locus_tag="PSPA7_0147"
     CDS             complement(160493..161173)
                     /locus_tag="PSPA7_RS00715"
                     /old_locus_tag="PSPA7_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system protein ImpM"
                     /protein_id="WP_011979126.1"
                     /db_xref="GI:500712934"
                     /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDEL
                     GAAWLDAYLTSPLWRFAIAPGLLGDDAVAGVVMPSIDRVGRYFPLTVACLLPANADLG
                     ALVGGDDGWFEQVEGLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRS
                     EAATPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVI
                     PLFPGIPG"
     gene            complement(161170..164700)
                     /locus_tag="PSPA7_RS00720"
                     /old_locus_tag="PSPA7_0148"
     CDS             complement(161170..164700)
                     /locus_tag="PSPA7_RS00720"
                     /old_locus_tag="PSPA7_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein IcmF"
                     /protein_id="WP_011979127.1"
                     /db_xref="GI:500712938"
                     /translation="MKGFLNFFTRWVVPVLGLLALSLVIWFLGPLLRLGNYEPLASAT
                     SRWVLIALLFLVWIGFRVLRIVQARRNAAKVMQSLAEVSAPDAASVATAEELATLKQR
                     MDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGA
                     IRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPID
                     GAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFME
                     FFDSLNREERAQVWGMTFALDDGKSAEGPLAGFASEFALLEQRLTARLVERLQQERDP
                     ARRDLVYGFPQQFAALRECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLI
                     GSMAQSMNLDRQHLARQTGTGRSYFIERLFREVAFGERGLVGTNPKVERRRKWLTIGA
                     LSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLN
                     AVQNLANDAPGWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGSS
                     DFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLER
                     RPPSARLDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVF
                     ARKSGKPLTDPLSGFFTYRGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLAL
                     DVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADVLRILSGPTSPFRKLLEAVARETD
                     LQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGVREQPQQADSDPISAHFAELN
                     SLVSKGEGGNEPAPIDSLLEDMNTLYVQVSAMAGASGDSLLGDAKNQVAAAASRVALS
                     AERQPPVVQGLVKKVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSS
                     RDATLEDFGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQ
                     RAAAIRDAFFRSGGMQPTVRFELKPVTMDAAISQFILDLDGQQLTYDHGPSRPVAMQW
                     PSANGLGVVRLTVTPAPSSGRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTLRLRIDG
                     SSIACELRASSAFNPFKSRVVSGFSLPERL"
     gene            complement(164697..166046)
                     /locus_tag="PSPA7_RS00725"
                     /old_locus_tag="PSPA7_0149"
     CDS             complement(164697..166046)
                     /locus_tag="PSPA7_RS00725"
                     /old_locus_tag="PSPA7_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_011979128.1"
                     /db_xref="GI:500712942"
                     /translation="MSPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPASGPRAG
                     DPYTPPPMASLAPLASRGDGLNPLEQAAGPLLAMLTRLRSTIAHPAPASLRAQLLGYL
                     RQFEEKARQAGVAADEVMLARYVLCTALDEAVLSTPWGSASDWGKQSLLITLHNEAWG
                     GEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLETLRERTAAVI
                     RSTRGEYERELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAE
                     PVFRRIHAIGEIPVQAIDRPAIQPRVIERPRLARFLAEDIKAQRVAVEDAVDRSVVTI
                     RGDELFASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLS
                     QARAQEVADLLGATTGEAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
     gene            complement(166053..167387)
                     /locus_tag="PSPA7_RS00730"
                     /old_locus_tag="PSPA7_0150"
     CDS             complement(166053..167387)
                     /locus_tag="PSPA7_RS00730"
                     /old_locus_tag="PSPA7_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_011979129.1"
                     /db_xref="GI:500712946"
                     /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWG
                     FSELKLDDALLTQGKLAVLSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGL
                     PLKRVGTRDTAEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGL
                     GEYAALGIARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALA
                     GRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTF
                     TASQRRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAML
                     SDRNLIDNASFILVVRADVPGETLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPV
                     APRQIPYHAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
     gene            complement(167404..167868)
                     /locus_tag="PSPA7_RS00735"
                     /old_locus_tag="PSPA7_0151"
     CDS             complement(167404..167868)
                     /locus_tag="PSPA7_RS00735"
                     /old_locus_tag="PSPA7_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_011979130.1"
                     /db_xref="GI:500712950"
                     /translation="MQKLMIALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAG
                     QAAPLRLRLYELKKDTAFGRADYFALTDNAPSTLGGDLVEQDEFLLRPGEERRIERTL
                     DEQTRQLGFVAAYRDLDRATWRQVLDIPGQRTSHLDVTLGAQAIGIVARPAP"
     gene            complement(167913..169439)
                     /locus_tag="PSPA7_RS00740"
                     /old_locus_tag="PSPA7_0152"
     CDS             complement(167913..169439)
                     /locus_tag="PSPA7_RS00740"
                     /old_locus_tag="PSPA7_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979131.1"
                     /db_xref="GI:500712954"
                     /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPE
                     RLVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDIL
                     VQLGHDIALPGSGNPQTDPFTSFDALMSRQNAATAPAFPEPAATPHPAVAAHFQGGSP
                     LDTRPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPAITPAPAPAGGAPLI
                     PADWDPFAELLGNTPAAGPAPATEPLATPLPTPEPAPLAMPFADPGITQQPPQPQPQP
                     QPQPQPQPQPQPQPQPQPQPASVAPPTPPASAAPTAGADLLQAFLRGAGMTQLKVDPA
                     GAEAQMEAIGRSYRGLVEGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEA
                     MLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAAIRHLLARFEPAALEARFG
                     KPAGLSGLLPGARQAQNWESFTELYAKILREAEDDFQELFGREFSRAYEEHSARLRRS
                     "
     gene            169807..170838
                     /locus_tag="PSPA7_RS00745"
                     /old_locus_tag="PSPA7_0154"
     CDS             169807..170838
                     /locus_tag="PSPA7_RS00745"
                     /old_locus_tag="PSPA7_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein ImpA"
                     /protein_id="WP_011979133.1"
                     /db_xref="GI:500712962"
                     /translation="MLDVPVLLAAVAPDSPCGEDLEYDAAFLELERIAQGQPERQMGD
                     AVLPAEPPEWPRVRALACELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLD
                     QYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALN
                     AAGLQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIEGGVAERVGSAQ
                     GLDLAPLRQLLRQALQVFDLYGPQGAGASVVPGAEAAPAEEPGAAPVAAAVPAARASG
                     EIGNREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGITQF
                     ETLRGPENE"
     gene            170927..171445
                     /locus_tag="PSPA7_RS00750"
                     /old_locus_tag="PSPA7_0155"
     CDS             170927..171445
                     /locus_tag="PSPA7_RS00750"
                     /old_locus_tag="PSPA7_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003123779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979134.1"
                     /db_xref="GI:500712966"
                     /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMA
                     DLAGKPAEPQAAVADRKFLEIDADNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFE
                     SMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEDMIMKAIKDPALLQALA
                     SAPKPKDDEPQA"
     gene            171458..172954
                     /locus_tag="PSPA7_RS00755"
                     /old_locus_tag="PSPA7_0156"
     CDS             171458..172954
                     /locus_tag="PSPA7_RS00755"
                     /old_locus_tag="PSPA7_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003151425.1"
                     /db_xref="GI:489243224"
                     /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETA
                     VRTLAEHALEQTSLISNDAIKSIESIIAAIDAKLTAQVNLIMHHADFQQLESAWRGLH
                     YLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPY
                     GCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTK
                     IFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSK
                     YAWANSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTE
                     IAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDASANANLAARLP
                     YLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPL
                     AAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
     gene            173030..173518
                     /locus_tag="PSPA7_RS00760"
                     /old_locus_tag="PSPA7_0157"
     CDS             173030..173518
                     /locus_tag="PSPA7_RS00760"
                     /old_locus_tag="PSPA7_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein hcp1"
                     /protein_id="WP_003151423.1"
                     /db_xref="GI:489243222"
                     /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGG
                     GGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITL
                     KEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPIKYGWNIRQNV
                     QA"
     gene            173677..174462
                     /locus_tag="PSPA7_RS00765"
                     /old_locus_tag="PSPA7_0158"
     CDS             173677..174462
                     /locus_tag="PSPA7_RS00765"
                     /old_locus_tag="PSPA7_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence protein, SciE type"
                     /protein_id="WP_011979135.1"
                     /db_xref="GI:500712974"
                     /translation="MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMG
                     QWTRALNQLKVVGELDASALPMVQTYSTAIECEALRREVFAGRLTPVILGQPAEWIAP
                     LLQALSLDAEGHGEAAQGLREQAFDAAPAVPGRIGETPFAWLADADTRLGPVLEVIVN
                     GRYAWLPMSNLRSLQVEAPSDLRDLVWLPAELTLANGGATVALLPARYAETVEHGDDA
                     ARLGRKTEWLESGLPLGQRLFVTDAGETALFDLRRLDFEATDA"
     gene            174464..174973
                     /locus_tag="PSPA7_RS00770"
                     /old_locus_tag="PSPA7_0159"
     CDS             174464..174973
                     /locus_tag="PSPA7_RS00770"
                     /old_locus_tag="PSPA7_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003151421.1"
                     /db_xref="GI:489243220"
                     /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASV
                     LRDLAWLFNTTSLFDHDLAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIA
                     TFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVR
                     VAQGERRRA"
     gene            174970..176829
                     /locus_tag="PSPA7_RS00775"
                     /old_locus_tag="PSPA7_0160"
     CDS             174970..176829
                     /locus_tag="PSPA7_RS00775"
                     /old_locus_tag="PSPA7_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019372512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system protein ImpG"
                     /protein_id="WP_011979136.1"
                     /db_xref="GI:500712978"
                     /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADP
                     YVERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEG
                     ALSSGFSVERGASLRGQLGPEDQTACEYRTAHPVTLWPLEVVQADYFGNPAAVLGRLA
                     ASEPRAKAGLRIRLRSGAGIPFHSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVR
                     APDNAWVERLPASSLRPRGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGL
                     NRALRRCAGEELELIVLFGKHDARLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRV
                     NEHHVIVDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRRE
                     PRVLSSKQRRKGPRSTYVGSETFVALVDASQAPYRHDLRQLGIAALCTNRDLPLFMPI
                     GAHRSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGA
                     AALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDEN
                     AFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
     gene            176793..177839
                     /locus_tag="PSPA7_RS00780"
                     /old_locus_tag="PSPA7_0161"
     CDS             176793..177839
                     /locus_tag="PSPA7_RS00780"
                     /old_locus_tag="PSPA7_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_011979137.1"
                     /db_xref="GI:500712982"
                     /translation="MAGEAGQPSEPLSLLAGMAAAPWDYDFFQALRRIECESPQLPRL
                     GHSVRLADDPLRLGQKPDCTFAPSTLASVSQAGADAVPRLDQFFFGLTGPNGPLPLHL
                     TEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAA
                     LSGRGMPSLRAREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQW
                     LELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVEL
                     AAWVAEYLGEELDWDVNLVLQRQEIPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQY
                     ATARPHEHKEKEHE"
     gene            177832..180540
                     /locus_tag="PSPA7_RS00785"
                     /old_locus_tag="PSPA7_0162"
     CDS             177832..180540
                     /locus_tag="PSPA7_RS00785"
                     /old_locus_tag="PSPA7_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_011979138.1"
                     /db_xref="GI:500712985"
                     /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQ
                     ILQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVY
                     GSLMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPEN
                     GLSASDGFNAGAAPGEASGAMAPSAMGRQEALKRFTVDLTEQARSGKLDPIVGRDEEI
                     RQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLL
                     QAGASMKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPAL
                     ARGTLRTVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEQHH
                     QVQILDEALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRI
                     EALETELAIIRRESAIGVATGERQRNAETLLAEERERLAGLERRWAEEKRLVDELLET
                     RARLRAAAEAVDAGGTPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEPLILPTV
                     DYQAVASVVADWTGIPVGRMARNEIETVLNLDSHLKKRIIGQDHALEMIAKRIQTSRA
                     GLDNPSKPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLK
                     GAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGR
                     LIDFKNTLILLTTNAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVT
                     IPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMI
                     DAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFATAD"
     gene            180575..182515
                     /locus_tag="PSPA7_RS00790"
                     /old_locus_tag="PSPA7_0163"
     CDS             180575..182515
                     /locus_tag="PSPA7_RS00790"
                     /old_locus_tag="PSPA7_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein ImpA"
                     /protein_id="WP_011979139.1"
                     /db_xref="GI:500712989"
                     /translation="MGLMQLTRLVQVDCPLGADVLLLQRMEGREELGRLFAYELHLVS
                     ENPNLPLEQLLGKPMSLSLELPGGGRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWL
                     LTRTSDCRIFQNQSVPEIIRQVFRDLGFSDFEDALTRPYREWEYCVQYRESSFDFVSR
                     LMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQM
                     AREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYAR
                     NRIEALQAQHERVRLRGVVRGLGAGHLFRLSGYPREDQNREYLVVGAEYRVVQELYET
                     GSGGAGSQFESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVK
                     VHFHWDRHDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITG
                     RVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQD
                     NLVENDASLIVGHDRNKSVGNDELARIGHNRTRAVKLNDTLLVGGAKSDSVSGTYLIE
                     AGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAN
                     GKGVQGTIDGQVQAMFPPPPKA"
     gene            complement(182778..183311)
                     /locus_tag="PSPA7_RS00800"
                     /old_locus_tag="PSPA7_0166"
     CDS             complement(182778..183311)
                     /locus_tag="PSPA7_RS00800"
                     /old_locus_tag="PSPA7_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979142.1"
                     /db_xref="GI:500713000"
                     /translation="MSMNPDNVLTLALANDELDRFLVGEPFYFLEARSDNEEPQNVSQ
                     AFDQLLMPYWRATRDPDLPFRFVAALLKILATYPDRNRAIYVAQNWIWYYRFCLSKKR
                     ANPQGPYGDLFEVDLGAVAVALKRQLEANKDELIRDTRWAGAAWNSSNGLWGPLLRTS
                     TTVRDKLGGPDFVPDNP"
     gene            complement(183308..184612)
                     /locus_tag="PSPA7_RS00805"
                     /old_locus_tag="PSPA7_0167"
     CDS             complement(183308..184612)
                     /locus_tag="PSPA7_RS00805"
                     /old_locus_tag="PSPA7_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011979143.1"
                     /db_xref="GI:500713004"
                     /translation="MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATG
                     GLAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGD
                     DVSATCSGLPLNHPLWPFPVIIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQDTFI
                     GGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAIGGLMMGGM
                     ALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGRASAAGEVRTPAYKRGRTEAD
                     ILGLAKGKRPPPSEYLKKSYIDKHLKVFKEEGGAFLFTTDDIANPNYTSFNPNKFVMA
                     KSDLNSVVAEYKRTGDVSVLESALGYDPGSLAGKEIYMLNLENPKVLMPTGNEGGVNS
                     LWRPGGLTHPGGMREAVLDNVAIPHGNDVNVLMSTHDIARIQ"
     gene            complement(184628..185062)
                     /locus_tag="PSPA7_RS00810"
                     /old_locus_tag="PSPA7_0168"
     CDS             complement(184628..185062)
                     /locus_tag="PSPA7_RS00810"
                     /old_locus_tag="PSPA7_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979144.1"
                     /db_xref="GI:500713177"
                     /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDA
                     SQGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQ
                     VFIERRPAVLITTLTTTPGDLPHHEPAWKQAMQTLVPRPAGH"
     gene            185315..187540
                     /locus_tag="PSPA7_RS00815"
                     /old_locus_tag="PSPA7_0169"
     CDS             185315..187540
                     /locus_tag="PSPA7_RS00815"
                     /old_locus_tag="PSPA7_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein ImpA"
                     /protein_id="WP_011979145.1"
                     /db_xref="GI:500713178"
                     /translation="MALAQQTRLVRVDSPLGADVLQLQRMEGREELGRPFAYELELIS
                     EDPDLQLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWL
                     LTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSR
                     LMEQEGIYYWFRHEQSRHILVLSDAYGAHRSPPGYASVPYYPPTLEQRERDHFYDWHM
                     AREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYAR
                     TRIEALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYET
                     GGGGVGAQFESELDCIDGGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVK
                     VHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITG
                     RVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQD
                     IEVENDETHWVGHDRSKTIDHDETVHVKHDRTETVDNNETLTIGVDRTEKVGNNEKIS
                     IGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVG
                     NNETISIGADRSESVGANESIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKS
                     FTLNAGDSITLVTGAASIRMKKDGSIVISGKNITIDGSGAINIKADKNVVMKGRKILQ
                     N"
     repeat_region   186416..186958
     gene            187569..188018
                     /locus_tag="PSPA7_RS00820"
                     /old_locus_tag="PSPA7_0170"
     CDS             187569..188018
                     /locus_tag="PSPA7_RS00820"
                     /old_locus_tag="PSPA7_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003155766.1"
                     /db_xref="GI:489247612"
                     /translation="MSVEIHLPGPASALPARLDGVVIGILLDVPDAAAPVVAYPGCPN
                     EHGLAAATTTQLGRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEASAQLDGERLEFS
                     AEREIVLRCGKASITLTRAGKVIIRGAYLSSRSTGVNRIKGGSVQIN"
     gene            188035..189147
                     /locus_tag="PSPA7_RS00825"
                     /old_locus_tag="PSPA7_0171"
     CDS             188035..189147
                     /locus_tag="PSPA7_RS00825"
                     /old_locus_tag="PSPA7_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016254347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979146.1"
                     /db_xref="GI:500713179"
                     /translation="MELLNATPLAAAYNQGLDAAGRESLVVIAKGSFDLPLDGREARL
                     LDEQQALLMMDEFFGEPGLSAPRRECDFVPFKPFCDVLVLGSAQAPGGRPVQQLTAGI
                     RVGRVGKALTVHGPRQWEPGLLGAGAGVAQPFQRQDISYASAFGGSHASPDNPGFMDC
                     YMANPAGRGWFPRSADTAEIVGTPMPATEKPGEPVDSPHGRFTPMALGPLGRHWQARV
                     GFAGRYDETWLAEQFPFLPADFDERYFQSAPSDQWTDYLRGGEEVLLLNLTGEERAAF
                     RVPRREVPVTFFLKKGGHETAQARIDTLLVDCDARRVEITWRIRRPLRRNLFEIAQVL
                     VGTMSSAWWRARELGKDYHPSLAALVRSRQAEEDEA"
     gene            189144..190181
                     /locus_tag="PSPA7_RS00830"
                     /old_locus_tag="PSPA7_0172"
     CDS             189144..190181
                     /locus_tag="PSPA7_RS00830"
                     /old_locus_tag="PSPA7_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003119505.1"
                     /note="catalyzes a condensation reaction in fatty acid
                     biosynthesis: addition of an acyl acceptor of two carbons
                     from malonyl-ACP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_011979147.1"
                     /db_xref="GI:500713180"
                     /translation="MSQPLSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGG
                     EWLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPGLDCAELPLLLCVAEGDRPGRC
                     AGLDESFLRDLENELGRRFHPSSALIARGRVGGAVALLNARKLVQGGCRQVLLAGVDS
                     FLNGPTLAAYEARERLLSSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGLEK
                     ATVESEDLPLRADGLTQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNL
                     RVLKPKFDLWHPADCIGECGAAIGPALLAVALAASRKGYGDGPNVFCHLGNDAGERAA
                     ALLSYRRVRAA"
     gene            190181..191397
                     /locus_tag="PSPA7_RS00835"
                     /old_locus_tag="PSPA7_0173"
                     /pseudo
     CDS             190181..191397
                     /locus_tag="PSPA7_RS00835"
                     /old_locus_tag="PSPA7_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003101201.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            191358..192281
                     /locus_tag="PSPA7_RS00840"
     CDS             191358..192281
                     /locus_tag="PSPA7_RS00840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003176038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033998069.1"
                     /db_xref="GI:730359379"
                     /translation="MDANDRRFSGFSLSTGVLRYSDLAYLLATSDEDIQEGLVGTLLF
                     TIDRGTPGAASLDWLACSGTVCHLPSERYVALGVQGQVRVMGGGSQSDESISNSGRDP
                     RSRGPLREVRGVARGRAYAVGTCRQAYVREDEGVWRCIDQTAQGGDVALTDTSFESID
                     GFSEQEIYTVGWEGEIWSYDGSVFTQASSPTNLALYKVRCAGDGYAYACGQLGTLLRG
                     RGDKWEIIEHESTREDLWGMEYFDGHLYVSSTHFVYRLVDGRLERVDFGDDVPASCYH
                     LSAADGIMWSVGAKDVMEFDGQSWKRILEIQ"
     gene            192293..193540
                     /locus_tag="PSPA7_RS00845"
                     /old_locus_tag="PSPA7_0175"
     CDS             192293..193540
                     /locus_tag="PSPA7_RS00845"
                     /old_locus_tag="PSPA7_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041025444.1"
                     /db_xref="GI:751334346"
                     /translation="MPRMSLPIVSMLDQHAEEAAFLALLRDYAVCAPHYDLEELAELD
                     QRIEAHLDGLSIAGQAGYEALFEQLDAHAQGEAFALAALAMQAGDEAVIGRMRACLAE
                     SREARRGFAAALGWLDWERVQPWVERLLASPEPLFRSLGLAACGMHRQDPGPALLSAL
                     GHADPAVLARAARTAGELRRRDLMADIRAYRAHDDPSLCFWANWATAQMGDEEALGPL
                     RAFAGQPGPFQLPATMVLLAWQPRDTSMAWIRQLMQAAETRRIGIQATGLFGDPVAVP
                     WLIQQMRDESLARVAGEAFSLITGADLALLDLELEVLPDHDPGPNDDPDDENVALDDD
                     ENLTWPEAERVSAWWRDNGARFVAGRAYLLGEPLGEARCREVLRDGQQRQRMAAACLL
                     ARFVPGLPLFPTSAPVRRQLALF"
     gene            193915..194643
                     /locus_tag="PSPA7_RS00850"
                     /old_locus_tag="PSPA7_0176"
     CDS             193915..194643
                     /locus_tag="PSPA7_RS00850"
                     /old_locus_tag="PSPA7_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="WP_011979151.1"
                     /db_xref="GI:500713184"
                     /translation="MPDRMRGVKTDSQEQESADDALKRIVDGFQHFRREVFPEQQELF
                     KKLAKSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAI
                     EYAVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDC
                     GANHDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQ
                     GRFLPLDGEHPVPMATPAPRYLNQ"
     gene            194853..196424
                     /locus_tag="PSPA7_RS00855"
                     /old_locus_tag="PSPA7_0178"
     CDS             194853..196424
                     /locus_tag="PSPA7_RS00855"
                     /old_locus_tag="PSPA7_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_011979152.1"
                     /db_xref="GI:500713185"
                     /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMPPA
                     KGLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQL
                     VAGRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAA
                     FAALGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLA
                     LDVRRVEVPANLGEAIDWLRPADLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLH
                     DGPRSDMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLL
                     AFVLLLGSLLRQIPVASLAGVLVYTGIKLVDFKALGNLGRYGRMPMLVYAATALAIVF
                     TDLLTGVLVGFALTLLKLVLKAARLKIVLRYTGEHEAELRLSGAATFLKVPALSRMLD
                     QVKPGTTLHVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRSN
                     AGLGGARSGGAVSPG"
     gene            complement(196411..197049)
                     /locus_tag="PSPA7_RS00860"
                     /old_locus_tag="PSPA7_0177"
     CDS             complement(196411..197049)
                     /locus_tag="PSPA7_RS00860"
                     /old_locus_tag="PSPA7_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003161047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979153.1"
                     /db_xref="GI:500713186"
                     /translation="MNTAALRELIQQAHLSEARHGYLADLIASRLPHLHRTIRPQGEN
                     TEDILTRFVHAYVEQVPDLLDAANSVAREAGIEDRIKPVLKVAEQFFLTPPALLAGHD
                     GLDALLDEAYLAHRLVEEVNDRYIAHFGQALIPLDTTVANLVAHQLIGEPFANQLDEA
                     VRHALEHMLDADTFDAESARAYRENLKNPRVVAAWQQWPCLSRQLGVELSLG"
     gene            197421..198545
                     /locus_tag="PSPA7_RS00865"
                     /old_locus_tag="PSPA7_0180"
     CDS             197421..198545
                     /locus_tag="PSPA7_RS00865"
                     /old_locus_tag="PSPA7_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="WP_003157689.1"
                     /db_xref="GI:489249571"
                     /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHM
                     TIFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAV
                     PATRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQEQIRNQQAKDE
                     HYLLEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPG
                     IYRGQCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVA
                     RGDKVYHTICAACHQAEGQGMPPMFPALKGSKVVTGPKEHHLEVVFNGVAGTAMAAFG
                     KQLNEVDLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
     gene            198555..200147
                     /locus_tag="PSPA7_RS00870"
                     /old_locus_tag="PSPA7_0181"
     CDS             198555..200147
                     /locus_tag="PSPA7_RS00870"
                     /old_locus_tag="PSPA7_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase subunit I"
                     /protein_id="WP_003157690.1"
                     /db_xref="GI:489249572"
                     /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSF
                     MMFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMI
                     PLMIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHS
                     VTFFIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMP
                     VLAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAII
                     PTFARKPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTG
                     VKVFNWVTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVA
                     HFHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFVGMNLAFFPMHFVGL
                     AGMPRRIPDYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRSGKPAPAKPWDGAE
                     GLEWSIPSPAPYHTFSTPPEVK"
     gene            200158..200712
                     /locus_tag="PSPA7_RS00875"
                     /old_locus_tag="PSPA7_0182"
     CDS             200158..200712
                     /locus_tag="PSPA7_RS00875"
                     /old_locus_tag="PSPA7_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003110652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_003157691.1"
                     /db_xref="GI:489249573"
                     /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPIYDVMCRALGING
                     KTAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARN
                     PSDKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDV
                     RHVTLAYTLFDITARNPPVPVAGR"
     gene            200723..201610
                     /locus_tag="PSPA7_RS00880"
                     /old_locus_tag="PSPA7_0183"
     CDS             200723..201610
                     /locus_tag="PSPA7_RS00880"
                     /old_locus_tag="PSPA7_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_003157692.1"
                     /db_xref="GI:489249574"
                     /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHEES
                     HGPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAA
                     FFGALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWK
                     LPLINTILLVTSSFTVTFAHHALKKNRRGPLKAWLALTVLLGIAFLILQAEEYVHAYN
                     ELGLTLGAGIYGSTFFMLTGFHGAHVTLGALILGIMLIRILRGHFDAEHHFGFEAASW
                     YWHFVDVVWIGLFIFVYVI"
     gene            complement(201626..201835)
                     /locus_tag="PSPA7_RS00885"
                     /old_locus_tag="PSPA7_0184"
     CDS             complement(201626..201835)
                     /locus_tag="PSPA7_RS00885"
                     /old_locus_tag="PSPA7_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979156.1"
                     /db_xref="GI:500713189"
                     /translation="MLKVAIVLLLLATLVSLFSGLFFLVRDQGHGSRVVNSLTVRVVL
                     AAATLALIAWGFYSGELNSHAPWHF"
     gene            201863..202645
                     /locus_tag="PSPA7_RS00890"
                     /old_locus_tag="PSPA7_0185"
     CDS             201863..202645
                     /locus_tag="PSPA7_RS00890"
                     /old_locus_tag="PSPA7_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157694.1"
                     /db_xref="GI:489249576"
                     /translation="MQYSQRLAEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLWLGT
                     WQLQRADEKRALLASYEARRDADPLSPGQLEDLRDPAYVRVRLHGRFDERHTLLLDNR
                     LRNGQAGVEVLQPFYDQASGLWLLVNRGWVPWSDRRSPPTLETPDRVLLLDAWTYLPP
                     PGGLHLADAPAVGWPRLVTQLEIPALWRDFGRAGLPWEIRLEPGDGSFDTDWPLVSMP
                     PERHTGYAAQWFALAAALLALYLYLGVRRAREKNHESRDSDA"
     gene            202620..203198
                     /locus_tag="PSPA7_RS00895"
                     /old_locus_tag="PSPA7_0186"
     CDS             202620..203198
                     /locus_tag="PSPA7_RS00895"
                     /old_locus_tag="PSPA7_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979158.1"
                     /db_xref="GI:500713191"
                     /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWV
                     PQGRSYSGALIGNGQTPADLGVQGRSQGEPWQLLVTAPGTCGEDCQQLVYLARQVNIA
                     LGREASRAGHALAASGELPADFANLVKLDYPRLQRYGLDPALYDKAGGGERPLLWVVD
                     PHGNLVLRYDAKANGKKLLKDVQLLLKLSHIG"
     gene            203263..204336
                     /locus_tag="PSPA7_RS00900"
                     /old_locus_tag="PSPA7_0187"
     CDS             203263..204336
                     /locus_tag="PSPA7_RS00900"
                     /old_locus_tag="PSPA7_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979159.1"
                     /db_xref="GI:500713192"
                     /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPG
                     CYGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVR
                     RGRDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALR
                     LSGRFAARRYPAATRGLAGLALLLVIGQITLGGWVSSNYAAVACIDLPTCHGEWWPRM
                     DFANGFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVW
                     PTALMLLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRA
                     PAPSPQRVRRTLPPAQGSRLKAA"
     gene            204362..205276
                     /locus_tag="PSPA7_RS00905"
                     /old_locus_tag="PSPA7_0188"
     CDS             204362..205276
                     /locus_tag="PSPA7_RS00905"
                     /old_locus_tag="PSPA7_0188"
                     /EC_number="2.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UXP9.1"
                     /note="converts protoheme IX and farnesyl diphosphate to
                     heme O; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase 1"
                     /protein_id="WP_011979160.1"
                     /db_xref="GI:500713193"
                     /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPL
                     DGFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALG
                     FALLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAP
                     PLLGWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERY
                     TKLHILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIR
                     TFKYSIVYLFLLFMALLVDHYLPLKLLL"
     gene            205302..205937
                     /locus_tag="PSPA7_RS00910"
                     /old_locus_tag="PSPA7_0189"
     CDS             205302..205937
                     /locus_tag="PSPA7_RS00910"
                     /old_locus_tag="PSPA7_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding protein"
                     /protein_id="WP_003156077.1"
                     /db_xref="GI:489247927"
                     /translation="MTRVNKTALVLAALVALVLGLTVHKVLTAQRQADPTVLLDAGIV
                     ILPQTRKVPALEFTNQDGQAVGTDSLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKL
                     PQEVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANALSIPYI
                     PADTSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
     gene            complement(205969..206421)
                     /locus_tag="PSPA7_RS00915"
                     /old_locus_tag="PSPA7_0190"
     CDS             complement(205969..206421)
                     /locus_tag="PSPA7_RS00915"
                     /old_locus_tag="PSPA7_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019395695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_003156078.1"
                     /db_xref="GI:489247928"
                     /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLD
                     LVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQ
                     AAERLWLDTPVYLSAQAHLQAYYGRYGFVPVTEVYLEDDIPHIGMRRA"
     gene            206553..207026
                     /locus_tag="PSPA7_RS00920"
                     /old_locus_tag="PSPA7_0191"
     CDS             206553..207026
                     /locus_tag="PSPA7_RS00920"
                     /old_locus_tag="PSPA7_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019395696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_003156080.1"
                     /db_xref="GI:489247930"
                     /translation="MRWEELSEQPCSLARVLAIVGDRWTLLVLRDCFLGIRRFDDFER
                     SLGVTRHVLADRLKRLVEAEILAKSPYQEKPLREEYRLTEKGMELYPTILSLVNWGDR
                     HLAGVEGPPLEHVHKRCGQHMHGVLVCSECGEPLHARDVTVREGLFWRGRLLRRG"
     gene            207379..208107
                     /locus_tag="PSPA7_RS00925"
                     /old_locus_tag="PSPA7_0192"
     CDS             207379..208107
                     /locus_tag="PSPA7_RS00925"
                     /old_locus_tag="PSPA7_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011979161.1"
                     /db_xref="GI:500713194"
                     /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPL
                     VQAIRDQGGEALACACDARQEQQVIDLFARIEREVGPLEAVIFNVGANVWFPITETTE
                     RVYRKVWEMAAFGGFLSGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFAL
                     RALAQSMARELGPKGIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETY
                     WQIHCQPRDCWVHELDLRPWTETF"
     gene            208132..208719
                     /locus_tag="PSPA7_RS00930"
                     /old_locus_tag="PSPA7_0193"
     CDS             208132..208719
                     /locus_tag="PSPA7_RS00930"
                     /old_locus_tag="PSPA7_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_003156084.1"
                     /db_xref="GI:489247934"
                     /translation="MNKQIEFFFDVGSPTTYLAWTQLPRIAAERGATIAWRPMLLGGV
                     FKATGNHSPIEVPAKGRYTLHDLARHAQRYGVPLAFNPAFPINTLTLMRGAQGYLGGE
                     GFHPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTE
                     EAVRRGVFGAPSFFVGDQLFFGQDRLDFVAEALAG"
     gene            208964..210298
                     /locus_tag="PSPA7_RS00935"
                     /old_locus_tag="PSPA7_0194"
     CDS             208964..210298
                     /locus_tag="PSPA7_RS00935"
                     /old_locus_tag="PSPA7_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UXQ5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter 1"
                     /protein_id="WP_011979162.1"
                     /db_xref="GI:500713195"
                     /translation="MFIKRCSRSIFLQVVIGLVIGVLCGVGIPDLAVQMKPLGDGFIK
                     LIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYSLGL
                     GSGANIHLNELPAGDIALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQVLLFSV
                     LFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDSL
                     SHLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELLIVMGTASSDAVLP
                     QVMRKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMTDLLTI
                     LLVSLVTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIG
                     NCVATVTIARWENDIDLPRAQAILDGRLEAPTRTGGEPLERGVVAGEGKLQG"
     gene            210347..211033
                     /locus_tag="PSPA7_RS00940"
                     /old_locus_tag="PSPA7_0195"
     CDS             210347..211033
                     /locus_tag="PSPA7_RS00940"
                     /old_locus_tag="PSPA7_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_011979163.1"
                     /db_xref="GI:500713196"
                     /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISR
                     PSLREAIMVLETLGVVRSMPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFI
                     VGIVAQSAGAAEISELRLLLLDLREAVEDGAAQAVVEAYTAFHRRLVKLTSNPIFLSV
                     SEQIGSALERSDNLVRRQPEYAEEILQEHEAILRAIRQHDSERASQAMRQHILNEGAR
                     LNIDLRLPQG"
     gene            211134..211868
                     /locus_tag="PSPA7_RS00945"
                     /old_locus_tag="PSPA7_0196"
     CDS             211134..211868
                     /locus_tag="PSPA7_RS00945"
                     /old_locus_tag="PSPA7_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011979164.1"
                     /db_xref="GI:500713197"
                     /translation="MVGFEARTPQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKET
                     LGQIFRVSNGTIQRALTRLAEDGAVVMAPKEVASVARPDERQARQVLEARLLVESEVL
                     RQLRKGVDATTLDELRALVDEEQACLEARDSAGVIRLAGRFHLRLAECTENPLLLGFV
                     RGLVARASLDIALNKGAVYSVEACVAQRGLLDALEAGDSVAATELMDEYLRGLFARMR
                     FLPPPTTDLRKAFGMSARRQDKRQEA"
     gene            212035..212436
                     /locus_tag="PSPA7_RS00950"
                     /old_locus_tag="PSPA7_0197"
     CDS             212035..212436
                     /locus_tag="PSPA7_RS00950"
                     /old_locus_tag="PSPA7_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_049791984.1"
                     /db_xref="GI:908647970"
                     /translation="MEIDMAYAEWIAVKVVVSNSIGTAGIRNATLQWGMFCRCSNRDD
                     EISAEKDSSMNVQAGSPQWIASCGRENAASGTRGCFDCHDGNTKMGTFSWDDPRKSGA
                     TQTRHFTPASQNYAGISSGGNATGAASARSP"
     gene            complement(212503..213393)
                     /locus_tag="PSPA7_RS00955"
                     /old_locus_tag="PSPA7_0198"
     CDS             complement(212503..213393)
                     /locus_tag="PSPA7_RS00955"
                     /old_locus_tag="PSPA7_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011979166.1"
                     /db_xref="GI:500713199"
                     /translation="MDSLKGMAIFATVVDKGSMAAAAESLGLTPSAVSQQIRRLESRA
                     QVTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGL
                     SGSLITQALKPLLEDHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGD
                     WNHILCAAPGYLRQRAPLKRPEQLLELDWIALNTASQFNLLTLTGADGEVCKLRLEPR
                     VAANGMLAVRQFTLDGLGVSCQPLPEVREALDAGRLQRLLPEWKLPDLGIHAVTPRRD
                     AQPAKVKVAIEALRRAFATG"
     gene            complement(213690..213971)
                     /locus_tag="PSPA7_RS00960"
                     /old_locus_tag="PSPA7_0200"
     CDS             complement(213690..213971)
                     /locus_tag="PSPA7_RS00960"
                     /old_locus_tag="PSPA7_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_003156094.1"
                     /db_xref="GI:489247944"
                     /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQ
                     EVANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKEIQILRIDRVEITP"
     gene            complement(213968..214195)
                     /locus_tag="PSPA7_RS00965"
                     /old_locus_tag="PSPA7_0201"
     CDS             complement(213968..214195)
                     /locus_tag="PSPA7_RS00965"
                     /old_locus_tag="PSPA7_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003112628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003083775.1"
                     /db_xref="GI:489174240"
                     /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQ
                     WQVAAIDEGLADANAGRLLEHTEIEKRWGLQ"
     gene            complement(214371..214991)
                     /locus_tag="PSPA7_RS00970"
                     /old_locus_tag="PSPA7_0202"
     CDS             complement(214371..214991)
                     /locus_tag="PSPA7_RS00970"
                     /old_locus_tag="PSPA7_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003101226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979168.1"
                     /db_xref="GI:500713201"
                     /translation="MPTRVLRGLVAALPLFLAACSDPAPSSEEIARLLTERGFDKPAC
                     ASSTLFKAFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLQRDGDTYALTPAGREDYKP
                     ESKAFCYSSGFDVSVRSVDPAKPDDHGPAVEKGWLVTVEVRPRGVKDWAKNPEVLKQA
                     SLTTLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
     gene            215092..215592
                     /locus_tag="PSPA7_RS00975"
                     /old_locus_tag="PSPA7_0203"
     CDS             215092..215592
                     /locus_tag="PSPA7_RS00975"
                     /old_locus_tag="PSPA7_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979169.1"
                     /db_xref="GI:500713202"
                     /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPG
                     QGMEMRFMVKLRVQNPNDEPIEYNGIALDLDVNGQPLASGVSDQAGEVPRFGERVVSV
                     PLTVSAFSAFRQAWGLSNNAPTQGMPYVVKGKLAGGLFGTVRFSEKGTLDFPGPAVGV
                     PKTKGL"
     gene            215665..216006
                     /locus_tag="PSPA7_RS00980"
                     /old_locus_tag="PSPA7_0204"
     CDS             215665..216006
                     /locus_tag="PSPA7_RS00980"
                     /old_locus_tag="PSPA7_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014603467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003101229.1"
                     /db_xref="GI:489191875"
                     /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGK
                     VIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGA
                     MKLKSEFVRKV"
     gene            complement(216126..217553)
                     /locus_tag="PSPA7_RS00985"
                     /old_locus_tag="PSPA7_0205"
     CDS             complement(216126..217553)
                     /locus_tag="PSPA7_RS00985"
                     /old_locus_tag="PSPA7_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003137015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GABA permease"
                     /protein_id="WP_011979170.1"
                     /db_xref="GI:500713203"
                     /translation="MSKVVLASQLPDKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGS
                     GHAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTI
                     GWLYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFE
                     FWFALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLT
                     TMFSFMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLL
                     IQVGSYQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLARRGDAPSVL
                     KLTNTAHVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQL
                     RMRKQLQASGQPIEFRMWLYPWLTWAVILFIVAALSIMLVMPEHRHEVFATALLTIFT
                     VCLGLLNARRKPRLGEDYAGKTARV"
     gene            complement(217722..219215)
                     /locus_tag="PSPA7_RS00990"
                     /old_locus_tag="PSPA7_0206"
     CDS             complement(217722..219215)
                     /locus_tag="PSPA7_RS00990"
                     /old_locus_tag="PSPA7_0206"
                     /EC_number="1.2.1.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="WP_011979171.1"
                     /db_xref="GI:500713204"
                     /translation="MGMLQHLINGELVADSGRSADVFNPSTGEAIHKVPLADGKTLQK
                     AIDAAKAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELK
                     RGIENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYP
                     LAIACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKDAVDGLIQAPEVK
                     AISFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSC
                     GERCMAISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTG
                     YIDSGVAQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVR
                     VNSLEEAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFG
                     GWKRSLFGDLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
     gene            complement(219296..219583)
                     /locus_tag="PSPA7_RS00995"
                     /old_locus_tag="PSPA7_0207"
     CDS             complement(219296..219583)
                     /locus_tag="PSPA7_RS00995"
                     /old_locus_tag="PSPA7_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_003156101.1"
                     /db_xref="GI:489247951"
                     /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVP
                     MTDGTLLLETAEGDRHAPLVAGQAYFRKAGVEHNVVNASAHEVVFIETEIK"
     gene            complement(219583..220929)
                     /locus_tag="PSPA7_RS01000"
                     /old_locus_tag="PSPA7_0208"
     CDS             complement(219583..220929)
                     /locus_tag="PSPA7_RS01000"
                     /old_locus_tag="PSPA7_0208"
                     /EC_number="2.6.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156103.1"
                     /note="catalyze the conversion of beta amino acids to the
                     corresponding beta keto acid with pyruvate as the amine
                     acceptor; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="omega amino acid--pyruvate aminotransferase"
                     /protein_id="WP_003156103.1"
                     /db_xref="GI:489247953"
                     /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSW
                     LTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEK
                     IAQLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAG
                     TSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDAS
                     NIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEY
                     FGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVA
                     CAAGLAALDILARDNLVQQSAELAPHFEKVLHGLQGAKNVIDIRNCGLAGAIQIAPRD
                     GDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALDGIA"
     gene            221065..221982
                     /locus_tag="PSPA7_RS01005"
                     /old_locus_tag="PSPA7_0209"
     CDS             221065..221982
                     /locus_tag="PSPA7_RS01005"
                     /old_locus_tag="PSPA7_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_011979172.1"
                     /db_xref="GI:500713205"
                     /translation="MGKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRS
                     AISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQH
                     LRGELNIGIINNLVTLPQMRITHALSTLKGQGPQVRINIGMTTPNEIELGVLDGHLHV
                     GVVPLISPLSGLEYLPLYDEHAQLYCSRGHPLFERADGDIAVDQVLAADAVAPSYRLP
                     AEAQARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFH
                     YAIALTIVTRKGRRPNLVLERFLEAVAVS"
     gene            complement(222088..223386)
                     /locus_tag="PSPA7_RS01010"
                     /old_locus_tag="PSPA7_0210"
     CDS             complement(222088..223386)
                     /locus_tag="PSPA7_RS01010"
                     /old_locus_tag="PSPA7_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003111218.1"
                     /note="Catalyzes the deamination of guanine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="WP_003156109.1"
                     /db_xref="GI:489247959"
                     /translation="MSSSAHRGRILHFLGDPAKLGDKAWEYFDDGLLWIEHGQVRALD
                     HAAYLLPRLPAGLALEEHPGRLLLPGFVDCHVHYPQLGVVASYGTQLLDWLEAHTYPA
                     EQRFADAGYATVQAELFLDELLRHGTTTALVFGTVHAVSAEAFFQAAQKRRLRMIAGK
                     VLMDRNAPPALCDTAASGYAESRALIERWHGNGRLQYAVTPRFAPTSSPGQLAAAARL
                     LDEYPGVYLHSHLSENLKEVAWVGELFPQAQDYLDVYHRAGLVGERSVFAHGIHLSER
                     ECRCLAHKNAALAHCPSSNLFMGSGLFDLGRAQQYGIRVGIGSDLGGGTSLSLLANLA
                     DAYKIQQLRGASLDPFQALYLATLGGARTLGLDGLIGNFLPGREADFVALDLAATPMI
                     AQRMEHARGLADTLFVLNTLGDDRAVAATWVLGERRHAKG"
     gene            224616..226187
                     /locus_tag="PSPA7_RS01015"
                     /old_locus_tag="PSPA7_0213"
     CDS             224616..226187
                     /locus_tag="PSPA7_RS01015"
                     /old_locus_tag="PSPA7_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011979175.1"
                     /db_xref="GI:500713208"
                     /translation="MTTVSSPAPPRLELRGISKRYPGCLANDRIDLRIDAGEIHALLG
                     ENGAGKSTLMKIIYGVTRPDAGEILWQGEPVRVRDPAGARALGIGMVFQHFSLFETLS
                     VAQNIALALGTEAGGPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLM
                     QDIRLLILDEPTSVLTPREAEDLFVILRRLAEEGCSVLFISHKLAEVRALCRRATVLR
                     GGRVAGQCLPAQCSDLELARLMVGDAEGLAAEYPKVAGGAPFLQVRDLYWRNPDPFGV
                     SFAGLDLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRVQAGRIRLGGTAGGHLAA
                     DARRRAGQAFVPAERLGHGAVPEMSLADNTLLSAFQRGLVKRGLVRRRKVLALAEEII
                     RRFAVKTPGAGAPARSLSGGNLQKFILGREILQSPRLLVAAHPTWGVDVGAAALIHRA
                     LIALRDAGTAILVVSEDLDELFLLSDRIAALCSGRLSPAVATASASPQQVGGWMAGQF
                     EAPAAVAGAVAQGSL"
     gene            226187..227284
                     /locus_tag="PSPA7_RS01020"
                     /old_locus_tag="PSPA7_0214"
     CDS             226187..227284
                     /locus_tag="PSPA7_RS01020"
                     /old_locus_tag="PSPA7_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_011979176.1"
                     /db_xref="GI:500713209"
                     /translation="MLLSLEPRGRQSRWILLASPLLAGLLTLVCGALLFAGLGHDPWQ
                     ALHTVLVQPVSDLYGIGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLIGALAGS
                     AVAIQLLDWQSRWALAGVLLAGSAAGAFWAGLAAWLRTRFNANEILTTIMLNYIALNL
                     LLYGVHGPLKDPEGFNFPQSALFGEASRLPALFEDSRVHFGALFGLLALAAVWVLAQR
                     SFLGFQVRVLGLDRRAAGFAGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQV
                     SPGYGYAAITVAFLGRLNPFGILAASLLMALLYLGGEAAQMSLNLPLALTGLFQGMML
                     FFLLACDVLILYRPRLHGHWRKRPALRDALA"
     gene            227308..228234
                     /locus_tag="PSPA7_RS01025"
                     /old_locus_tag="PSPA7_0215"
     CDS             227308..228234
                     /locus_tag="PSPA7_RS01025"
                     /old_locus_tag="PSPA7_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011979177.1"
                     /db_xref="GI:500713210"
                     /translation="MDIDLLNNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMM
                     LFGAVIGFMVAFSSGSLWLGVLLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGV
                     GLSSFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLL
                     RSRAGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAEN
                     MTAGRGWIALALVVFASWRVFRVLLGAWLFGLASILHLVAQGVGLAIPANLLAMLPYV
                     ATILVLVLLSRDALRTRLYAPVSLGQPWKAGL"
     gene            228400..228963
                     /locus_tag="PSPA7_RS01030"
                     /old_locus_tag="PSPA7_0216"
     CDS             228400..228963
                     /locus_tag="PSPA7_RS01030"
                     /old_locus_tag="PSPA7_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015474956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit C"
                     /protein_id="WP_003083828.1"
                     /db_xref="GI:489174294"
                     /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFT
                     FNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTH
                     QLTNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAA
                     HPGEVCPAKWKEGEKTLAPSLDLVGKI"
     gene            229109..230674
                     /locus_tag="PSPA7_RS01035"
                     /old_locus_tag="PSPA7_0217"
     CDS             229109..230674
                     /locus_tag="PSPA7_RS01035"
                     /old_locus_tag="PSPA7_0217"
                     /EC_number="1.8.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit F"
                     /protein_id="WP_011979178.1"
                     /db_xref="GI:500713211"
                     /translation="MLDANLKAQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIV
                     GLTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSK
                     LDAEVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQD
                     EVEARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTAREAFDVLVVG
                     GGPAGAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLARALEEHV
                     RHYEVDIMNLQRASKLVPAKNAGELHEVQFESGGSLKARSLILATGARWREMGVPGEQ
                     EYKAKGVCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRAD
                     AVLQRKLYSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGL
                     LPNTEWLKGSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASL
                     SAFDHLIRTSAPE"
     gene            complement(230748..231821)
                     /locus_tag="PSPA7_RS01040"
                     /old_locus_tag="PSPA7_0218"
     CDS             complement(230748..231821)
                     /locus_tag="PSPA7_RS01040"
                     /old_locus_tag="PSPA7_0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_011979179.1"
                     /db_xref="GI:500713212"
                     /translation="MSEEPTVSPPSAEQPAAQPAKPARPAARRAPRKPATRRPRVASP
                     AQKAREEIQAISQKPVALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDL
                     QIELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQE
                     QGQWYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERML
                     TNSGILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMF
                     FHTDTADAPWTVIKSDDKKRARLNCIRHFLHALDYPGKDRRIAHEPDPLLVGPASRVI
                     EEDEKVYAEAAAAPGHANLDIPA"
     gene            232099..233448
                     /locus_tag="PSPA7_RS01045"
                     /old_locus_tag="PSPA7_0219"
     CDS             232099..233448
                     /locus_tag="PSPA7_RS01045"
                     /old_locus_tag="PSPA7_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxydechloroatrazine ethylaminohydrolase"
                     /protein_id="WP_011979180.1"
                     /db_xref="GI:500713213"
                     /translation="MSRTWIRNPLAIFTANGLDAAGGLVVEDGRIVELLGAGQHPAQP
                     CASQFDASQHVVLPGLINTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKL
                     ELATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLG
                     EKDGGLPPQQTVQEAETILADSERLIARYHQRGEGARVQIALAPCSPFSVTPEIMRAS
                     AELAARHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAE
                     EIRRLGEAGTGICHCPSSNMRLASGICPTMELEAAGAPIGLGVDGSASNDASNMILEA
                     RQALYLQRLRYGAERITPALALGWATRGSARLLGRGDIGELAPGKQADLALFKLDELR
                     FSGSHDPLSALLLCAADRADRVMVGGTWRVVDGAVEGLDLAALIARHRAAASALIAG"
     gene            233557..234609
                     /locus_tag="PSPA7_RS01050"
                     /old_locus_tag="PSPA7_0220"
     CDS             233557..234609
                     /locus_tag="PSPA7_RS01050"
                     /old_locus_tag="PSPA7_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979181.1"
                     /db_xref="GI:500713214"
                     /translation="MSRAARPRNRFCRLLLGLALLMPASLPFAAAETAAPQSPRTLII
                     DTDPGADDVIALLFAMASPKELKIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVY
                     AGAPRPLLRTPIYAADVHGSEGISGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTL
                     AMLGPETNLALALTQAPDIVKGIREIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVL
                     KSGAPITMLPLDVTHKILTSPERIARLRNLGNRAGKTVADILDAYVQYDIKYYGLEGG
                     PVHDATVVAYLLEPSLFKGKRINVQVDSREGITFGQTVADWYGGLKQPANVNWINEGD
                     AQGFFDLLAERIARLP"
     gene            complement(234624..235160)
                     /locus_tag="PSPA7_RS01055"
     CDS             complement(234624..235160)
                     /locus_tag="PSPA7_RS01055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside 2-deoxyribosyltransferase"
                     /protein_id="WP_049792064.1"
                     /db_xref="GI:908648050"
                     /translation="MPGVRAAARPRKLYLAGPDVFRADAVAHGEALKALCARYGFEGL
                     YPLDNALPKRIADPREQAAWIYRANLGLIERADAVLANLNFFRGAEPDSGTAFEVGYA
                     TALGKPVYGYVDDAGSYAERIRRHAPALIGQDPSRDRDGMALEEFGLPLNLMLAVPAT
                     LVVGDAEQALRQLAGHHG"
     gene            complement(235372..235890)
                     /locus_tag="PSPA7_RS01060"
                     /old_locus_tag="PSPA7_0222"
     CDS             complement(235372..235890)
                     /locus_tag="PSPA7_RS01060"
                     /old_locus_tag="PSPA7_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside deoxyribosyltransferase"
                     /protein_id="WP_011979183.1"
                     /db_xref="GI:500713216"
                     /translation="MTAIYLAGPDVFRPDAEAHGETLKALCAEFGFVGLYPLDHALPA
                     DIREPAAQAAWIYRANVGLIERADCVLANLDPFRGSEPDSGTAFEVGYALALGKPVYA
                     YLDDAGAYAERLARLAPEWLGERPGVDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREA
                     LLRLAEDLGRNT"
     gene            236128..237225
                     /locus_tag="PSPA7_RS01065"
                     /old_locus_tag="PSPA7_0224"
     CDS             236128..237225
                     /locus_tag="PSPA7_RS01065"
                     /old_locus_tag="PSPA7_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011979185.1"
                     /db_xref="GI:500713218"
                     /translation="MKHRRTQSRTSVLCRLAAVLGLGACALAAEAAEPLKVGFVYVGP
                     VGDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTS
                     FGYMNPTAKVARQFPRVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKI
                     GYIASFPIPEVIRDINAIRLALDKYDPQAELKVMWVNTWFDPGKEADAANALIDQGVD
                     VVFQHTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMD
                     GTWKSEDFWGGLAESMVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSG
                     KERFAAGVSATNADLASMNYYVEGIKADLPK"
     gene            237298..238260
                     /locus_tag="PSPA7_RS01070"
                     /old_locus_tag="PSPA7_0225"
     CDS             237298..238260
                     /locus_tag="PSPA7_RS01070"
                     /old_locus_tag="PSPA7_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015647815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="WP_011979186.1"
                     /db_xref="GI:500713219"
                     /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPL
                     PAARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFD
                     MALHLPAEHPDVGAGTSFYGPNRHPDLPGWEALLEGHYADMLALARTVLRALAIALGI
                     EEDFFDRRFEQPVSVFRLIHYPPAADRQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQ
                     NRQGEWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVLSPRGVDRYSMPFFAEPHS
                     DTEIRCLPGCFDADNPPRYPPTTCGEWLTSRFAQTYAYRRGETA"
     gene            238360..239310
                     /locus_tag="PSPA7_RS01075"
                     /old_locus_tag="PSPA7_0226"
     CDS             238360..239310
                     /locus_tag="PSPA7_RS01075"
                     /old_locus_tag="PSPA7_0226"
                     /EC_number="3.5.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004346883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="WP_011979187.1"
                     /db_xref="GI:500713220"
                     /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVET
                     LRKAYAFNNLQEFLDLYYAGADVLRSEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTH
                     TDRGIPFEVVLAGIRAALRDGEKQLGIRHGLILSFLRHLSEEEAQKTLDQALPFRDAF
                     VAVGLDSSEVGHPPRKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDH
                     GVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDD
                     PAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
     gene            239448..240035
                     /locus_tag="PSPA7_RS01080"
                     /old_locus_tag="PSPA7_0227"
     CDS             239448..240035
                     /locus_tag="PSPA7_RS01080"
                     /old_locus_tag="PSPA7_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_011979188.1"
                     /db_xref="GI:500713221"
                     /translation="MSDRDLPSGPRPDALPADGEAARRADLLKAFLAQRQRMESLVRR
                     RVGCRATAADLVQELFLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDD
                     WLPEQRQGEPVGPEQALEAGDQWRRVEAALRDLPERTRRIFLLNRIHGRTYAEIARAM
                     QLSQSAVEKHMMRALDACKASLAGPAGEQTRSAQP"
     gene            240032..241027
                     /locus_tag="PSPA7_RS01085"
                     /old_locus_tag="PSPA7_0228"
     CDS             240032..241027
                     /locus_tag="PSPA7_RS01085"
                     /old_locus_tag="PSPA7_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron dicitrate transporter FecR"
                     /protein_id="WP_011979189.1"
                     /db_xref="GI:500713222"
                     /translation="MTRTDSDAAPCDPALEQTAQAWLVRLRGTSDVAVRRAFEDWLAQ
                     RPEHAQAYARAETLWRLTEMPATRLALEEADALEIYLRPRRAPRNPRRWAYPLASVAC
                     LLAMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQ
                     RRVELLRGAVALRVKRDALPFVVEAGEGRARVLGTEFEVRRGARATRVTVLQGRVAVS
                     AGTGAGAAEEVLGAGQQVGFADGELGRPVAVDAAAALAWRQGWLSFYRQPLAEVLDEL
                     ARYYPGRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
     gene            241176..243563
                     /locus_tag="PSPA7_RS01090"
                     /old_locus_tag="PSPA7_0229"
     CDS             241176..243563
                     /locus_tag="PSPA7_RS01090"
                     /old_locus_tag="PSPA7_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003117214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011979190.1"
                     /db_xref="GI:500713223"
                     /translation="MTPFPRFALHTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLA
                     RALDAFSRASGQTLLYTAELPPQATAPALHGSLGAEEALQRLLQGSGLRARRVDERTL
                     TLEPIPASGALDLDATTVSAAAPAQGYRPAASASISRGDAPVLEIPQTISVVPAQALQ
                     DQRPRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTA
                     TADHVEVLKGPASLLYGIQDPGGVVNVVSRKPQLQQANALTLRGSAYAHGRNGGGGQL
                     DSTGPLGDSGLAYRMILDHEDEDYWRDFGKSRETLVAPSLAWYGEDTTVNLSYEHREF
                     TTPFDRGTAIDPRTNRPLDIPRSRRLDEPFNITEGRSDLTRLDLERQLDDSWKAHFGY
                     GYSRETYDDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGALQLAGMRHDLQ
                     FGMDHEKRKIFRADLLRDSRTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYF
                     QDSIHLDDRWILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSL
                     YGSYTRSFKPNSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRK
                     KNVLVNELDGAGNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLDAEVTEDPTL
                     EGKRLQNVARNTASLSAVYELGEVLGGDRLRLGGGARYVGERPGDPGNSFDLPSYTVA
                     DAFASYDTRFGGHGVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQVSTTVEF"
     gene            243746..244663
                     /locus_tag="PSPA7_RS01095"
                     /old_locus_tag="PSPA7_0230"
     CDS             243746..244663
                     /locus_tag="PSPA7_RS01095"
                     /old_locus_tag="PSPA7_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016254344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_003155604.1"
                     /db_xref="GI:489247448"
                     /translation="MNLDNRIKFRHLACFLEVARQRSFAKAADAVAVSQPAISKTLKE
                     LEEILGARLFERSKAGVELTEAGVTFLRYAGPCVQALRDGVNTLRGHEAQVETVRVGV
                     LSTVESLVVPEVLRRLHRRHRALVVSVATGPSAYLLAQLKVGELDLVVGRMTDSPEIQ
                     GLTFEHLYSESMMLVVRPGHPLLAAPLRDPQRLADFPLVLPLAGTTIRRHADSLFVQC
                     GIPLAGQRLETLSPTLSRSYVLRSEAIWVAPRDAVRLDVGNGELVELDLGIREPGGSV
                     GLCHNAALPLPLGAQWFSVVLREVAAELH"
     gene            244798..245517
                     /locus_tag="PSPA7_RS01100"
                     /old_locus_tag="PSPA7_0231"
     CDS             244798..245517
                     /locus_tag="PSPA7_RS01100"
                     /old_locus_tag="PSPA7_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit beta"
                     /protein_id="WP_003155602.1"
                     /db_xref="GI:489247446"
                     /translation="MHDAENRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSL
                     SETSGPDFSHLKLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQ
                     ANAGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGNYYFRTIKPGPYPWRNGPNDWRPA
                     HIHVSVSGPAIATRLITQMYFEGDPLIPRCPIIRTLADPEAAQSLIGRLDMSMANPMD
                     CLAYRFDIVLRGQRRTFFENA"
     gene            245528..246133
                     /locus_tag="PSPA7_RS01105"
                     /old_locus_tag="PSPA7_0232"
     CDS             245528..246133
                     /locus_tag="PSPA7_RS01105"
                     /old_locus_tag="PSPA7_0232"
                     /EC_number="1.13.11.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014603473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit alpha"
                     /protein_id="WP_011979191.1"
                     /db_xref="GI:500713224"
                     /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMARED
                     APGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPEQPFNSFGRTATTFDA
                     GEWTLHTVKPGVVRNAQGVPMAPHINVALFARGINIHLQTRLYFDDEAEANAACPVLN
                     LIEQAPRRDTLVARRCEVNGQLAYRFDIRIQGDNETVFFDF"
     gene            246352..247191
                     /locus_tag="PSPA7_RS01110"
                     /old_locus_tag="PSPA7_0233"
     CDS             246352..247191
                     /locus_tag="PSPA7_RS01110"
                     /old_locus_tag="PSPA7_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003155598.1"
                     /db_xref="GI:489247442"
                     /translation="MSEHPEHPATLAPPSVLSPARRIAAFTGDPNFMTSLARGLAVIH
                     AFQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGHAY
                     LSSTPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGSRL
                     PAYCTSMGRILLAALDDDALHGYLGEVEMQAKTSRTLYTPDTLLPCLMDIRRQGWCIV
                     DQELEVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELENRFLPLLLEASRELSAR
                     LFS"
     gene            247392..248495
                     /locus_tag="PSPA7_RS01115"
                     /old_locus_tag="PSPA7_0234"
     CDS             247392..248495
                     /locus_tag="PSPA7_RS01115"
                     /old_locus_tag="PSPA7_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003102193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_011979193.1"
                     /db_xref="GI:500713226"
                     /translation="MALPAILCASLLAGCGAEPPTEERTRVLAQTVKLAEFASATSIT
                     GDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQRSNVENAQAAVAAQ
                     QAQSKLADLNYRRQKALLPKGYTSQSEYDQALASVRSAQSSLKAAQAQLANARDLLSY
                     TELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYESLFSHDVEGQRIS
                     VSLLGRPEVTASGKVREITPTVDERSGTLKVKVGLDAVPAEMTLGSVVNASVAAPAQH
                     SVVLPWSALSKLGSQPAVWLLDQERKARLQPVRVARYASEKVVIASGLEAGQTVVTVG
                     GQLLHPGQVVEVAQPPQPTQTTASRDALGGGQP"
     gene            248492..249562
                     /locus_tag="PSPA7_RS01120"
                     /old_locus_tag="PSPA7_0235"
     CDS             248492..249562
                     /locus_tag="PSPA7_RS01120"
                     /old_locus_tag="PSPA7_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017002058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_003155781.1"
                     /db_xref="GI:489247628"
                     /translation="MKPVVLASLFGCALLLSACGDEQPSAPPRPVLSVTVKTLKNDDL
                     GRFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGD
                     LASAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAALQQARD
                     QLSYTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPAD
                     ARFLVSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSS
                     AGSVRSVLPASVLLERDGKTQVWVIDAKQSSVALREVQVLSRDERQVVIGRGLVDGDR
                     VVRAGVNSLEPGQKIKLDEDAR"
     gene            249559..252606
                     /locus_tag="PSPA7_RS01125"
                     /old_locus_tag="PSPA7_0236"
     CDS             249559..252606
                     /locus_tag="PSPA7_RS01125"
                     /old_locus_tag="PSPA7_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004346873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACR family transporter"
                     /protein_id="WP_011979194.1"
                     /db_xref="GI:500713227"
                     /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSF
                     AIKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDT
                     TKAGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLR
                     DYVEKVRLDIRSVKDLGKVQMIGAQDEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAV
                     TPSGVVEAGPERISVRTSGNFRSEKDLQAINLRVNERFYRLSDLASISRDFVDPPTSL
                     FRYKGEPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKA
                     VGGFTQALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSL
                     GALIIALGLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFV
                     PIGLNASSAGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKSRI
                     AERFDSLLHLAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQN
                     SSIHETRAVMDRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTK
                     DLEARERVATRLRERLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMG
                     LAGVLDGNPNIGDIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVT
                     QVRDDIYLVNVIGRAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWR
                     RDRKPTITVKASLRGEIQPTDLVARLAPEVRRFADGLPANYRIEVGGTVEESGKAEGP
                     IAKVVPLMLFLMATFLMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILG
                     ILALIGIIIRNSVILVTQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPI
                     AREVFWGPMAYAMIGGIVAATLLTLIFLPALYVAWYRIPEPGR"
     gene            252805..253743
                     /locus_tag="PSPA7_RS01130"
                     /old_locus_tag="PSPA7_0237"
     CDS             252805..253743
                     /locus_tag="PSPA7_RS01130"
                     /old_locus_tag="PSPA7_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041025268.1"
                     /db_xref="GI:751334170"
                     /translation="MDTLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHL
                     QTRLLHRTTRRLALTEAGERYLERCRAILADIEVAEAEASGAHIRPCGRLRVQSLMGL
                     GQHHLVPMIARYGALFPDVVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLG
                     SIHSVLCASPGYLQQRGVPRSVDELEQHVCLRLQDPAYPEGWLFVDEQGERTVSPQNT
                     FMVNVAEVMAQAARAGLGIALLPSYVAAPALRNGELRRVMPGHTMHERTIYALYPSRR
                     YLDAKIRTWVDLLQQELPQAFARDETTMQSSSYWAQ"
     gene            253859..254044
                     /locus_tag="PSPA7_RS01135"
                     /old_locus_tag="PSPA7_0238"
     CDS             253859..254044
                     /locus_tag="PSPA7_RS01135"
                     /old_locus_tag="PSPA7_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979196.1"
                     /db_xref="GI:500713229"
                     /translation="MNRQILAAAVLSLFSLAFSQVGFAEESSLMTNRMVDANQQAIEH
                     QQELSASAAPAETRRDS"
     gene            254327..>254477
                     /locus_tag="PSPA7_RS01140"
                     /pseudo
     CDS             254327..>254477
                     /locus_tag="PSPA7_RS01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118586.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            254630..255964
                     /locus_tag="PSPA7_RS01145"
                     /old_locus_tag="PSPA7_0242"
     CDS             254630..255964
                     /locus_tag="PSPA7_RS01145"
                     /old_locus_tag="PSPA7_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_011979200.1"
                     /db_xref="GI:500713233"
                     /translation="MRNLFALTPLALALFSAPGAWADEGEAEEGFIEGSSLQLLTRNY
                     YFNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTS
                     ILPITAPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLGNPVVAGGESRMLP
                     QTFRGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGG
                     TWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDEDWSLNPGAHYYKTVDSGDSLLG
                     RIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNE
                     KSWKLQYDYDFVALGMPGLTASASYSRGKLDLTRVDPDSPGYGGWYSADGNNAKHWER
                     DLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPVDVF"
     gene            complement(255993..256784)
                     /locus_tag="PSPA7_RS01150"
                     /old_locus_tag="PSPA7_0243"
     CDS             complement(255993..256784)
                     /locus_tag="PSPA7_RS01150"
                     /old_locus_tag="PSPA7_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003147081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_033998562.1"
                     /db_xref="GI:730360800"
                     /translation="MNGQPAELHRPIPRLARLPRPVYARAESLRAGSWTSRHHHAWVQ
                     LSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAWAP
                     TRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPMPR
                     EPRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRLLA
                     SLNALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
     gene            256868..258484
                     /locus_tag="PSPA7_RS01155"
                     /old_locus_tag="PSPA7_0244"
     CDS             256868..258484
                     /locus_tag="PSPA7_RS01155"
                     /old_locus_tag="PSPA7_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003162958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_011979201.1"
                     /db_xref="GI:500713234"
                     /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGG
                     NAIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAA
                     GHDRMPLYGWTPVTVPGCPAAWAELSRRFGKLPFGQLLQPAIELARDGFPVSPVIARL
                     WQGGLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESF
                     YRGELARTIAGHAEHSGGYLRLDDLAGYRAQWVEPIALNYRGYDVWEIPPSGQGLIAL
                     MTLNILKGFEFGERDCAQTWHRQLEAMKLAYVDGLHYISQPRSMRVSVEELLHEDYAA
                     SRRALIGAHALDPTPGQPKPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIA
                     LQNRGAEFSLDPDHVNCLEPGKQTFHTIIPGFLSKDGIPLGPFGVMGAYMQPQGHVQM
                     VMNLVDFGLNPQAALDAPRWQWLGGLRVGIEHAAPRALATELAQRGHQVEIAYDSTSY
                     GRGQIVLRDPASGVLCGGTEPRTDSQIAVW"
     gene            259148..259984
                     /locus_tag="PSPA7_RS01160"
                     /old_locus_tag="PSPA7_0245"
     CDS             259148..259984
                     /locus_tag="PSPA7_RS01160"
                     /old_locus_tag="PSPA7_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012613454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003102209.1"
                     /db_xref="GI:489192867"
                     /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNES
                     LTYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEI
                     TPRLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNF
                     YYRKPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYH
                     ANLHFNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKY
                     HF"
     gene            260228..261634
                     /locus_tag="PSPA7_RS01165"
                     /old_locus_tag="PSPA7_0246"
     CDS             260228..261634
                     /locus_tag="PSPA7_RS01165"
                     /old_locus_tag="PSPA7_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725687.1"
                     /note="high-affinity transporter for xanthine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine permease"
                     /protein_id="WP_011979202.1"
                     /db_xref="GI:500713329"
                     /translation="MHSEEQRPHDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPL
                     VIGSLLGLGEHLPYLISMALTVSGVGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAA
                     GMLVKQRGGGPEDILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVS
                     LIKVGITDLGGGAGAADFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVGGLALGT
                     LAAWATGVFVPRPLPELPLLSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTAN
                     CMLSRQPLDGPKYLERLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRH
                     VGIYIGGVLLALGLFPWIGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTAMDRRS
                     VLIIAASFGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGVTAILLNLLLPEERVAQA
                     PLGSPEGGALARWRKPLG"
     gene            261727..262392
                     /locus_tag="PSPA7_RS01170"
                     /old_locus_tag="PSPA7_0247"
     CDS             261727..262392
                     /locus_tag="PSPA7_RS01170"
                     /old_locus_tag="PSPA7_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003137048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_011979203.1"
                     /db_xref="GI:500713333"
                     /translation="MTLTVPAHAPDARDKPAGRIRQKNEEAILAAAEEEFARHGFKGT
                     SMNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDGTFNTLGPGDDPAEALAGY
                     IRAKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMD
                     PVDPVHLIFLLWGSTQHYADFATQIGLVTGRKRLSKQDFAAATENLVRIILKGCGLTP
                     PAA"
     gene            262397..262987
                     /locus_tag="PSPA7_RS01175"
                     /old_locus_tag="PSPA7_0248"
     CDS             262397..262987
                     /locus_tag="PSPA7_RS01175"
                     /old_locus_tag="PSPA7_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_011979204.1"
                     /db_xref="GI:500713338"
                     /translation="MPSTLQGLAEFREEIRKSRFHTIAAPVADEGAAQAFIAAHRDAS
                     AGHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVAVLVSRWFGGIKLGTG
                     GLARAYGGGAAKCLQQAPRRELVERCRVRFACAFAEHALLKARSLALGARVEEEEYRA
                     DGVGLVLELPAARFDELQALLVDLSRGQVRPQRLEA"
     gene            complement(262992..263819)
                     /locus_tag="PSPA7_RS01180"
                     /old_locus_tag="PSPA7_0249"
     CDS             complement(262992..263819)
                     /locus_tag="PSPA7_RS01180"
                     /old_locus_tag="PSPA7_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011979205.1"
                     /db_xref="GI:500713342"
                     /translation="MSRERELDAWIDGLLADPRFHGHPLHEALGRLRQQSLEQLVRLE
                     RIARISDGFQSMAREQNLTLSERYHKQLRRLEKVARISDRYQQMMRDLNLALKEASIR
                     DPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQVNDTWGHDSGDRVLVE
                     IARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVRDSVRTLAVRVGTEAL
                     SVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAVPATPASPRPAPAR"
     gene            complement(263826..264206)
                     /locus_tag="PSPA7_RS01185"
                     /old_locus_tag="PSPA7_0250"
     CDS             complement(263826..264206)
                     /locus_tag="PSPA7_RS01185"
                     /old_locus_tag="PSPA7_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003150848.1"
                     /db_xref="GI:489242641"
                     /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVID
                     WVERFLAEERRPLELDLRLLYLNTSSIKAMMDIFDLLEEAHQGGRAIDLRWHYDRRNE
                     RVAELAEEFREDCSFPFAIQAHDE"
     gene            complement(264233..264775)
                     /locus_tag="PSPA7_RS01190"
                     /old_locus_tag="PSPA7_0251"
     CDS             complement(264233..264775)
                     /locus_tag="PSPA7_RS01190"
                     /old_locus_tag="PSPA7_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009614787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979206.1"
                     /db_xref="GI:500713347"
                     /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHA
                     EQAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLV
                     ERDDGQRLVQSIQAIANLDKAALKAAYKEQLRRPRDSGSASGAGLGLLDIARKSSEPL
                     AASLKEQPDGRAFFSLRAVI"
     gene            complement(264784..266775)
                     /locus_tag="PSPA7_RS01195"
                     /old_locus_tag="PSPA7_0252"
     CDS             complement(264784..266775)
                     /locus_tag="PSPA7_RS01195"
                     /old_locus_tag="PSPA7_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003112649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011979207.1"
                     /db_xref="GI:500713349"
                     /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLA
                     YAKNFTLLHRQQILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRG
                     DFRDHAYFIIASGSGHYYFNDGRQAHSDAPRYTLEADDPEDAWYFNTLRNSAAYNINV
                     NVDSKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGA
                     IQAHPDRRLIAYSSAAGGASERHRVFDLLDRPEQRDALREAMRLARAKAGSVHCLWAG
                     LDGRQQLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYA
                     VERLLLRPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELE
                     DKVQERTQALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKP
                     RDVVGGDFYVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAI
                     LDETDQAMRSMLSQEQIPQALATNMDAGLVWVDRRRGQLAFAGAKISLYASDGEEVQE
                     LKGARRAIGDKRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLR
                     DHARQPLPEQAEAFVATLAEYQGEHPQRDDITILSFRFD"
     gene            complement(267049..268098)
                     /locus_tag="PSPA7_RS01200"
                     /old_locus_tag="PSPA7_0253"
     CDS             complement(267049..268098)
                     /locus_tag="PSPA7_RS01200"
                     /old_locus_tag="PSPA7_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011979208.1"
                     /db_xref="GI:500713353"
                     /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLI
                     RQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVD
                     FIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIAL
                     GASTGGTEALKEVLLGLPANSPGVVITQHMPPGFTRSFAERLDRLTRLAVSEARDGDR
                     ILPGHALIAPGDYHMQVQRSGADYMVRLNRQPQVNGHRPAVDVMFESLARCAGRNLLA
                     GLLTGMGRDGARGLLAIRQAGGYTLAQDEATCVIYGMPREAVELGAAEDVLPLERIAQ
                     ALLQQACRRGGGNRL"
     gene            complement(268118..268720)
                     /locus_tag="PSPA7_RS01205"
                     /old_locus_tag="PSPA7_0254"
     CDS             complement(268118..268720)
                     /locus_tag="PSPA7_RS01205"
                     /old_locus_tag="PSPA7_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheD"
                     /protein_id="WP_011979209.1"
                     /db_xref="GI:500713357"
                     /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASDEDLLIVTVL
                     GSCVSVCLRDPVNGIGGMNHFMLPERGAGSDPASPSARYGGHAMELLINRMLALGARR
                     ERLQAKVFGGGSVLRQISAAIGQRNVEFTLGYLATERIPLLASDVLEAFPRKIYFFPR
                     NGRVLVKSLVELKNDTVLQRERDYRRRIDRNPDGGPIDLF"
     gene            complement(268726..269568)
                     /locus_tag="PSPA7_RS01210"
                     /old_locus_tag="PSPA7_0255"
     CDS             complement(268726..269568)
                     /locus_tag="PSPA7_RS01210"
                     /old_locus_tag="PSPA7_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="WP_011979210.1"
                     /db_xref="GI:500713361"
                     /translation="MSISTPSPVFGNHEFHYTREDFQQVRERLYRLTGISLAESKVQM
                     VYSRLSRRLRLLRLASFAEYFAHLDREPGERQLFVNALTTNLTAFFRERHHFPLLADL
                     ARRQLQRHRPLRVWSAAASTGEEPYSIAITLVEALGRFDPPVKIIASDIDTGVLDCAR
                     QGVYPLDRLEQLPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWPIAG
                     ELDAIFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRSVGQTV
                     YRPA"
     gene            complement(269638..271677)
                     /locus_tag="PSPA7_RS01215"
                     /old_locus_tag="PSPA7_0256"
     CDS             complement(269638..271677)
                     /locus_tag="PSPA7_RS01215"
                     /old_locus_tag="PSPA7_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003112650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011979211.1"
                     /db_xref="GI:500713365"
                     /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERL
                     YDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDRTIPDERLEGRAARIGK
                     GINELVAAHIAVKMKVVSVVTAYGRGDFEPLMDRLPGKKAQITEAIDGVRERLRGAAE
                     ATAAQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLP
                     NFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFALDVVPVFNDANER
                     LGSAVQWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEESGKEGFFLRLAKDLNSLVDT
                     ADRGLRDVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNETAQSLSRMLGQIRDAAD
                     TINTAAGEIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANA
                     SEVATQGGTVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGE
                     QGRGFAVVAGEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAI
                     RRVTDIMSEIAAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGL
                     LNQSVAVFRLDNAPSVVQLASARPPAPRPAAPAPLARGGMARASKARKEDGWEEF"
     gene            complement(271713..272198)
                     /locus_tag="PSPA7_RS01220"
                     /old_locus_tag="PSPA7_0257"
     CDS             complement(271713..272198)
                     /locus_tag="PSPA7_RS01220"
                     /old_locus_tag="PSPA7_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003158064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine-binding chemotaxis protein"
                     /protein_id="WP_011979212.1"
                     /db_xref="GI:500713369"
                     /translation="MNGTEASQAHGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTA
                     IANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSV
                     SDVIALGGDAIRPPPEFGASFDTKYLLGLATAGERMLILVDIERLMTSREMALVDEAA
                     A"
     gene            complement(272185..274062)
                     /locus_tag="PSPA7_RS01225"
                     /old_locus_tag="PSPA7_0258"
     CDS             complement(272185..274062)
                     /locus_tag="PSPA7_RS01225"
                     /old_locus_tag="PSPA7_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein A"
                     /protein_id="WP_011979213.1"
                     /db_xref="GI:500713371"
                     /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIF
                     RAAHSIKGSSGMFGFDDISAVTHELETLLDRIRCGQMRLRPDMISAFLEARDVLQRLL
                     DAHRSGHADPDVPLDETVERLRGWLRAPEEQPEDGFGFFDGAPGSPAEDAALDDAFGF
                     FDDAPGAPGEASGTEAFGLFDDSPGTPLPQERAFGLFDGAPGSPAAPGAPAQTIAATA
                     RGAAASARGDGESGSIRVSVEKIDSLINLVGELVITQAMLGQLGEQLEPSRHERLQHA
                     LAQLEHNTRDLQESVMSIRMLPINFIFSRFPRLVRDTAARLGKQVELHLHGEHTELDK
                     SVIEKLSDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKLAASHQGGSVVVEVSDDG
                     RGLSRPRILAKARERNLPVHDGMSDAEVWQLVFMPGFSTAETVTELSGRGVGMDVVKR
                     NIGAMGGRIDIDSAPGMGTRIGIRLPLTLAILDGLIVAVAAVNYVIPLTYIVESLQAR
                     SEDVRGLGGEDNAMIRVRGEYLPLFSLHELLRIGGEAPAPERGIVVILESEGRSFALQ
                     VDELVGQQQVVIKSLEQNFRRVEGIAGATIMGDGSVALILDVDALPRLAAREDTADER
                     H"
     gene            complement(274090..274455)
                     /locus_tag="PSPA7_RS01230"
                     /old_locus_tag="PSPA7_0259"
     CDS             complement(274090..274455)
                     /locus_tag="PSPA7_RS01230"
                     /old_locus_tag="PSPA7_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_011979214.1"
                     /db_xref="GI:500713372"
                     /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQS
                     RNYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGW
                     LVKPFDPPKLLEVTRKVLP"
     gene            complement(274651..275826)
                     /locus_tag="PSPA7_RS01235"
                     /old_locus_tag="PSPA7_0260"
     CDS             complement(274651..275826)
                     /locus_tag="PSPA7_RS01235"
                     /old_locus_tag="PSPA7_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011979215.1"
                     /db_xref="GI:500713373"
                     /translation="MRESLGVSVPSRSLALTLGLLSLPWALCAGLYAMGLDTWLALSL
                     GWLASLAAVLPLRRADRQSATTNSGSEADAALPAWDEAQRALGEETAQLDGHARQVDE
                     LLHSAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGHGQVDEGINFQDFIRTTQQTLS
                     LFVEATLETSRTSQQLVERMDHVRQKIAEILQSTQDMDAIAKQTNLLALNAAIEAARA
                     GESGRGFAVVADEVRALSTRSTEFSAAIRKHVDVVYHEIQDAKGAISQLADKDMSFAL
                     DSKQKIQGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVNAAVTALQFQDMSSQLLGQM
                     RKHHARLGAFALGLGALRTRPRQEWPARVAQEVAELRRPLPSPVSQNSVEVGEVELF"
     gene            complement(276019..276951)
                     /locus_tag="PSPA7_RS01240"
                     /old_locus_tag="PSPA7_0261"
     CDS             complement(276019..276951)
                     /locus_tag="PSPA7_RS01240"
                     /old_locus_tag="PSPA7_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011979216.1"
                     /db_xref="GI:500713376"
                     /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNL
                     GVRLFQRSTRRLALTEAGERFLQEVGGSLAGIQTALANVSNVGNQPSGTLKVSMGLAF
                     GRDYILPLLGEFLERYPGIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPGVVARHLTP
                     GHLILLASPAYLRDKPPIRHPGDLCDFDGIRIRSPQTGRVRPWPLRRRDGEQAPIELR
                     ERMTMSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAA
                     NRLLPAKTRVFVDFVVDYFRRQELARRFCAFPSG"
     gene            277071..277823
                     /locus_tag="PSPA7_RS01245"
                     /old_locus_tag="PSPA7_0262"
     CDS             277071..277823
                     /locus_tag="PSPA7_RS01245"
                     /old_locus_tag="PSPA7_0262"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_003149588.1"
                     /db_xref="GI:489241373"
                     /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSS
                     ADKSRALAAELEAAGSSVLALHADSADAAALVAAVDAAAARFGRIDILVNNAAILAFG
                     SVEELPLADFERTLAINVRSVFVATQAAIRHMGDGGRVISIGSTNAERMPFAGGATYA
                     MSKSALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAETLKGLMALPRYAR
                     SEEIASFVAYLAGPEAAYITGASLSIDGGFSA"
     gene            complement(277924..279534)
                     /locus_tag="PSPA7_RS01250"
                     /old_locus_tag="PSPA7_0263"
     CDS             complement(277924..279534)
                     /locus_tag="PSPA7_RS01250"
                     /old_locus_tag="PSPA7_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_011979217.1"
                     /db_xref="GI:500713385"
                     /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTD
                     FHTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELEGKPGYEGHLNERVAALPELLR
                     EAGYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGT
                     PALYVEDEHYLDTLPEGFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPR
                     EIVEKYRGRYDAGPEALRQDRLARLKELGLVEADVEAHPVLALSREWERLDEEERAKS
                     ARAMEVYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPD
                     LLGFLDQHYDNSLDNIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYP
                     RLSRQGAISHAFATVMDVTPTLLDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEA
                     AHDENTVTGWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPG
                     KLAELIEHWKRYVSETGVVEGASPFLVR"
     gene            complement(279621..280460)
                     /locus_tag="PSPA7_RS01255"
                     /old_locus_tag="PSPA7_0264"
     CDS             complement(279621..280460)
                     /locus_tag="PSPA7_RS01255"
                     /old_locus_tag="PSPA7_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter ATP-binding protein"
                     /protein_id="WP_011979218.1"
                     /db_xref="GI:500713390"
                     /translation="MNALTAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGE
                     FIAIVGASGCGKSTLLRLLIGLDRDYDGEISVDGRPIAGIGGERGIVFQEHRLFPWLT
                     VQQNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLV
                     ASPRLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVM
                     EPRPGRIRRVVEVDLAHPRERGGFDFLRQREALLHELTADGEYLAPPPRRVENLPFEF
                     LAC"
     gene            complement(280457..282028)
                     /locus_tag="PSPA7_RS01260"
                     /old_locus_tag="PSPA7_0265"
     CDS             complement(280457..282028)
                     /locus_tag="PSPA7_RS01260"
                     /old_locus_tag="PSPA7_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003106694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_049792065.1"
                     /db_xref="GI:908648051"
                     /translation="MPRLAPPSSAAFARRLGDSLLPWSLPLGLALLWWVASHYHWMSA
                     QVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASGAALGTWLGFSARAER
                     LVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVPVTIHTLVGVRDAQPK
                     LREAAAVLRLPPRLLIWRLILPAALPAFLTGLRLALAQGWTSLLAVELLASSEGIGYL
                     MVQGRQLFMLDIVFVCILVIGLVGVGMDRAIHWLDRRLLHWPQAATGEFRRRPPGRGW
                     QRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSGALDGSLPGALFDSLK
                     RTLGGLLLGGGLGFLGGLLLGLWHPAERLFGPTFAALRQVAIFAWVPLLTAWFGLGEP
                     AKLAFVALAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRRLLRLALPGAAPSVFA
                     GLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIGAGMLLVGLTGALLNA
                     LGQRIEARATRWRHA"
     gene            282340..283401
                     /locus_tag="PSPA7_RS01265"
                     /old_locus_tag="PSPA7_0267"
     CDS             282340..283401
                     /locus_tag="PSPA7_RS01265"
                     /old_locus_tag="PSPA7_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_003157453.1"
                     /db_xref="GI:489249330"
                     /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVS
                     AGNSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLG
                     DLAAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLS
                     FDNALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLST
                     RDLNGAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQA
                     SYPVVILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRRQFSAEQWAAPE
                     LLEAADRLAKGKAVAQAGQ"
     gene            complement(283427..284785)
                     /locus_tag="PSPA7_RS01270"
                     /old_locus_tag="PSPA7_0268"
     CDS             complement(283427..284785)
                     /locus_tag="PSPA7_RS01270"
                     /old_locus_tag="PSPA7_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_011979221.1"
                     /db_xref="GI:500713401"
                     /translation="MHDLRHAVFAGLLAGTLCEGAAATAGAGGFIEDSELQFLARTYY
                     FNRDYRDGPNNAGRNRFKPRSERNGYREETTQGLRLLFGSGYTPGNLGFGLDAHAMLG
                     LQLDSGGGRTGTGNLPVGADGHPEHRYGKLGGALKLRHGETRLKYGQTSTSAPVFAAS
                     SNRTLTGMAYGLLLEDRTFDGLLLEGGRFSAASGPGESRMHGEISTVYGRLGAYPVRL
                     DTVNFLGGQWQAGERLQLSLYAARFDDVWRQAYLGARYRQPLGEQRALLLDFNAYRTR
                     DSGQSRFGRIDTLASSLALGYEQGPQRLTLAYQHVRGEQPFDYMAFGDGRSSASMVLA
                     NSLGYSDFNGPGERSWQLRYDLELGALGLPGLSLHALHARGRAGASADSAAESIYAGL
                     YGRDGRHRETDLGLAYRVKAGPLAGLALRASQAWHRDNPTYLGGDVDETRLILDYPWT
                     IW"
     gene            285035..285760
                     /locus_tag="PSPA7_RS01275"
                     /old_locus_tag="PSPA7_0269"
     CDS             285035..285760
                     /locus_tag="PSPA7_RS01275"
                     /old_locus_tag="PSPA7_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase"
                     /protein_id="WP_011979222.1"
                     /db_xref="GI:500713405"
                     /translation="MTHNKTLRPSLLLCLALLAPLACLGETAVPYALAQPPRLADYLP
                     PPPSADSAAAVADLGAVLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGESFSKER
                     LPLARSFFNRAQENLVEVLMPAKKHFARPRPYEVTPLVNPVLPPPEGESYPSGHTMDG
                     YLKASLLSMLVPERHDAFFARAEEHAQSRVLAGVHFPSDLEGGRTAAAALVASLLAEP
                     AVAADFAAVREEVRGALGLPKLQ"
     gene            complement(285785..286702)
                     /locus_tag="PSPA7_RS01280"
                     /old_locus_tag="PSPA7_0270"
     CDS             complement(285785..286702)
                     /locus_tag="PSPA7_RS01280"
                     /old_locus_tag="PSPA7_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003137069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011979223.1"
                     /db_xref="GI:500713409"
                     /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELG
                     CQLVNRGSKDLRPTPEGQVVLQHALNLVQGAANLSQEIAQLNKLDAGELRFGSGPAPA
                     QELVPDAVADFIRRHPRVQISLEVDNWEKLSRALLREELEFFVADIRDFEADPNFQTR
                     PLTPRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAAN
                     IRCENMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGII
                     SRSGYRLSAAAKAMIETLVELDQAQHAAA"
     gene            287060..289432
                     /locus_tag="PSPA7_RS01285"
                     /old_locus_tag="PSPA7_0271"
     CDS             287060..289432
                     /locus_tag="PSPA7_RS01285"
                     /old_locus_tag="PSPA7_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011979224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011979224.1"
                     /db_xref="GI:500714865"
                     /translation="MTRRFRFPLDRTPPSGTDYTLALLLALGGALPASAAEAPDDAAP
                     ATSVAAATPGRADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQ
                     VLPSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIE
                     QLELLRGPQGTLFGKNTTAGVLNISTRAPTFTAERTVEVSGGQDGYFQGRGTVSGPLG
                     ETLAGRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEE
                     DSSNGSMVVYGAAERFWQRAALVGASPLRDPQRKKVNVNGRQHVSVHQGGSSLEANWN
                     LASGYRLTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFD
                     YVVGAYAFRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQG
                     TWHLTERLDFTAGLRGTYEEKDAKVERFAPLGGAAVGGIGAAVRNGQLGAYDSGDLSQ
                     YNFAPSALLSLSYQFSDELLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERAND
                     AELGLKSTLFDRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLE
                     FEATALPLRGLTLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLTGQRVVGASK
                     WIANLNGEYRWRLDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSD
                     LGDGQLDTSVWLKNAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
     gene            289473..290375
                     /locus_tag="PSPA7_RS01290"
                     /old_locus_tag="PSPA7_0272"
     CDS             289473..290375
                     /locus_tag="PSPA7_RS01290"
                     /old_locus_tag="PSPA7_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_012073837.1"
                     /db_xref="GI:501021169"
                     /translation="MSNAAQALATPVRLDIQPVAGRIGAEIRGVTLSGELDAATVEAI
                     QAALVRHKVIFFRGQSQLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRR
                     ANSWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAV
                     HSNEYDYAGVKPSASVEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRL
                     KGLSQHDSAHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAIDDYGNQPRMV
                     RRVTLGGDVPVGIDGQRSRTIRKA"
     gene            290442..291341
                     /locus_tag="PSPA7_RS01295"
                     /old_locus_tag="PSPA7_0273"
     CDS             290442..291341
                     /locus_tag="PSPA7_RS01295"
                     /old_locus_tag="PSPA7_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014603479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine dioxygenase"
                     /protein_id="WP_012073838.1"
                     /db_xref="GI:501021170"
                     /translation="MSQTATARPLDSDAAEAFRITPLQAPLGAEVRGLDARRPLAPEQ
                     VLALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPDIV
                     KVANTGDGELGNFALPAHIDHQWTPVPSSGSFLYALEVPSSGGETRFTNLARAYESLD
                     EATRREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRR
                     VLFLSAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHA
                     RNAFPASERRRLKRISLAGSRPF"
     gene            291989..293107
                     /locus_tag="PSPA7_RS01300"
                     /old_locus_tag="PSPA7_0275"
     CDS             291989..293107
                     /locus_tag="PSPA7_RS01300"
                     /old_locus_tag="PSPA7_0275"
                     /EC_number="1.6.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073839.1"
                     /note="Pyridinenucleotide transhydrogenase subunit alpha;
                     Nicotinamide nucleotidetranshydrogenase subunit alpha;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_012073839.1"
                     /db_xref="GI:501021171"
                     /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNAS
                     QPDSAYEVAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIA
                     RMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAG
                     TVKAARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETD
                     EERECAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATV
                     AEMKPGSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNI
                     LDFLKLTLSAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
     gene            293183..293491
                     /locus_tag="PSPA7_RS01305"
                     /old_locus_tag="PSPA7_0276"
     CDS             293183..293491
                     /locus_tag="PSPA7_RS01305"
                     /old_locus_tag="PSPA7_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_003083974.1"
                     /db_xref="GI:489174441"
                     /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAIS
                     AIVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH
                     "
     gene            293491..294927
                     /locus_tag="PSPA7_RS01310"
                     /old_locus_tag="PSPA7_0277"
     CDS             293491..294927
                     /locus_tag="PSPA7_RS01310"
                     /old_locus_tag="PSPA7_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007911651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_012073840.1"
                     /db_xref="GI:501021172"
                     /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIA
                     VATTVGLVFKLGAEIATTGVGYILVGLLVGGSAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVVEPQSLGIVAQLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAV
                     ARAQHALMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINS
                     EFGQTDVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     gene            295271..296065
                     /locus_tag="PSPA7_RS01315"
                     /old_locus_tag="PSPA7_0279"
     CDS             295271..296065
                     /locus_tag="PSPA7_RS01315"
                     /old_locus_tag="PSPA7_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein TonB"
                     /protein_id="WP_012073842.1"
                     /db_xref="GI:501021174"
                     /translation="MATPQPVDARTQPWRETPGGDLVEFGRPVRQALHLVRHNPAQGR
                     VLSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPP
                     PPEPLAPVVEEPPPPVVDEKAVKPPPPKPVPKPKPKPKPQPRPEPAPKAVEPAPPAPP
                     QPAAPPAPPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSEIQ
                     VQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVGVPIDFKLN"
     gene            296094..296813
                     /locus_tag="PSPA7_RS01320"
                     /old_locus_tag="PSPA7_0280"
     CDS             296094..296813
                     /locus_tag="PSPA7_RS01320"
                     /old_locus_tag="PSPA7_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016252855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter ExbB"
                     /protein_id="WP_003083979.1"
                     /db_xref="GI:489174446"
                     /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQD
                     RQFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRL
                     ERALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLET
                     VAGPIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRV
                     IVHPSAARQAGNPSRNVKEAS"
     gene            296815..297216
                     /locus_tag="PSPA7_RS01325"
                     /old_locus_tag="PSPA7_0281"
     CDS             296815..297216
                     /locus_tag="PSPA7_RS01325"
                     /old_locus_tag="PSPA7_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012699476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_003106175.1"
                     /db_xref="GI:489196869"
                     /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPI
                     NLPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQ
                     ADEGVNYGQVAKAMASIERAGITRLAVITAR"
     gene            complement(297397..297609)
                     /locus_tag="PSPA7_RS01330"
                     /old_locus_tag="PSPA7_0282"
     CDS             complement(297397..297609)
                     /locus_tag="PSPA7_RS01330"
                     /old_locus_tag="PSPA7_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157027.1"
                     /db_xref="GI:489248891"
                     /translation="MAKKFPLHPSHPERICWGCDRYCSAQSMGCGNGASRTQHPSELF
                     GEDWAGEWEVEGTEDAKEQEAPARQA"
     gene            297822..298403
                     /locus_tag="PSPA7_RS01335"
                     /old_locus_tag="PSPA7_0284"
     CDS             297822..298403
                     /locus_tag="PSPA7_RS01335"
                     /old_locus_tag="PSPA7_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004352029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012073844.1"
                     /db_xref="GI:501021176"
                     /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRTLPNASRVEQKDWIAP
                     LRADWIAGLDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDRVRGALLVAPADV
                     ERESCAEALRNFAPISREPLPFPAVLVGSDNDQACSPQRAMHLARAWGAETVILPEAG
                     HINVKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
     gene            complement(298411..299868)
                     /locus_tag="PSPA7_RS01340"
                     /old_locus_tag="PSPA7_0285"
     CDS             complement(298411..299868)
                     /locus_tag="PSPA7_RS01340"
                     /old_locus_tag="PSPA7_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073845.1"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_012073845.1"
                     /db_xref="GI:501021177"
                     /translation="MNRYPPINELVLLQAHQLAERIRLRQVSCREVMQAYLAHIERFN
                     PRVNALVSLLPAERLLAEAAARDDELAHGQYRGWMHGLPHAIKDLSLTRGIRTTLGSP
                     LYRDYVPERDGIMVERIRAAGAILIGKTNTPEFGLGSQTYNPLFGATACAYDERLSAG
                     GSSGGAAAALALHLVPVADGSDMMGSLRNPAAFNNVIGFRPSQGRVPFDDSADLFFDQ
                     LGYEGPMGRSVRDTALLLSVQAGADRRAPLSIAEPGASFAAPLERDFAGTRLGWLGDL
                     DGYLPMQDGILQLCQRALGDFRSLGCEVEEAALGFAPERLWESWRTLRHWLVAGSLGA
                     LHADPAKRTQLKPEALWEVENGLRLGADAVYRASVIRSDWYRAIGRLFERYDYLLLPS
                     AQVFPFAKEIPWPRSIEGVAMDTYHRWMEVVVPGSLSGCPVANVQAGFNAEGLPMGLQ
                     IIGPHQADFAVLQLAHAYEQASRWFERQPSPLLVG"
     gene            complement(299935..300969)
                     /locus_tag="PSPA7_RS01345"
                     /old_locus_tag="PSPA7_0286"
     CDS             complement(299935..300969)
                     /locus_tag="PSPA7_RS01345"
                     /old_locus_tag="PSPA7_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012073846.1"
                     /db_xref="GI:501021178"
                     /translation="MYQRIARIGLGLSIVLGGSAQAAGQLNVVSWSGYFSPQLLEKFE
                     KESGIRVTVDSYDSNETLLAKLKQGGAGYDVAIPSQQFVPILVEERLLERFDPAAEPY
                     YANLVDNLKKPAWDPEGAYSVPFIWGTTSVVLDGARYAGPADSYAVLYQPPEELRGRI
                     NMFDSVSEVVDMASLYLGIPLCSEDPKQMQRVLDLLKAQKPFVKTYSSKAGSIRENLA
                     AGEVDMSMFWGGSSLRARELKPSLKYLYPKEGVLAWVDNLVIPRGSRNPDNARRFIAF
                     LAQPENAALTQNFLKHQSPVKGVEPYLEPGLKDAPELHVPEGTRVVFSQTCGEAAIRL
                     ADRLWTNLMR"
     gene            complement(300991..301800)
                     /locus_tag="PSPA7_RS01350"
                     /old_locus_tag="PSPA7_0287"
     CDS             complement(300991..301800)
                     /locus_tag="PSPA7_RS01350"
                     /old_locus_tag="PSPA7_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003158002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003158002.1"
                     /db_xref="GI:489249894"
                     /translation="MNARLWRGGRRSVQDFPGFGAFSLLFYLYLYAPILVLVVYSFNA
                     NQSATVWTGFSLDWYRAAFANQALRQAAGNSLLIAVCASAAATAIATLAALGTSRGAR
                     FKGLRLSMGTIMLPLVLPEIVVGVATLALFSTLGLSLGYGNLIIAHTVFCIPFAYLPV
                     RARLDDMDLSLEQAAADLYAGPWRTLRKVTLPLLAPGIFSGLMLAFIVSLDNFVISMM
                     VAQAGTTTLPIFIFGLLRMGVTPDVNAVSTLILGVSVIFVSLSYLLGKPRA"
     gene            complement(301797..302717)
                     /locus_tag="PSPA7_RS01355"
                     /old_locus_tag="PSPA7_0288"
     CDS             complement(301797..302717)
                     /locus_tag="PSPA7_RS01355"
                     /old_locus_tag="PSPA7_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003158003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003158003.1"
                     /db_xref="GI:489249895"
                     /translation="MHPTSSPGAALQRRQALRSFLGVTPALVAIGLFLVLPILIVGAY
                     SLMEANPYGGVNRTFSGESYVALLFERQMDDSLAFADSYLVIALRSLGIAALTTLVTL
                     LIGFPVAVWLVMQPPRRRGLLIFLITVPFWANLLVRTYAWILLLRGSGVINNGLLGLG
                     LIDQPLPLLYSDGAVLLGLVYTYAPFVVLPIYATLEKMDMRLLEAAQDLYAGRLRTLR
                     KVVLPLARPGILAGAMLTFVPCLGAMIAPELLGGGTRMMLGNLIFRQFADARNWPLGA
                     ALSLLLMAAVMLVLSLYAWRAGRLARGAGR"
     gene            complement(302742..303854)
                     /locus_tag="PSPA7_RS01360"
                     /old_locus_tag="PSPA7_0289"
     CDS             complement(302742..303854)
                     /locus_tag="PSPA7_RS01360"
                     /old_locus_tag="PSPA7_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_012073847.1"
                     /db_xref="GI:501021179"
                     /translation="MNALHSLRTHAVSIRAVRKVYGDPGSGPVALKRIDLDIRDNEFF
                     TLLGPSGCGKTTLLRMIAGFEFPTEGEILLYGENIAARPPFERPVNTVFQHYALFPHM
                     SIAENLAFGLESRPPGRSLDKAGVAERVREMLALVQMERFAERRPAQLSGGQQQRVAL
                     ARALAPQPRVLLLDEPLSALDLKLRQAMREELKAIQAKTGITFIFVTHDQEEALTMSD
                     RIAVLSEGQVQQVGPPEEIYERPGNRFVADFIGETNFIEAELLRRDGSLALYRGPGGE
                     SFEAAARDDLAPGARVSLSIRPERLGLRDAGTGDGLPCTVQSQVYLGTDLQYRVRLAD
                     GSLLTVRAPNATGRRFAAGEAARLAVARDSASVLLD"
     gene            304084..304977
                     /locus_tag="PSPA7_RS01365"
                     /old_locus_tag="PSPA7_0291"
     CDS             304084..304977
                     /locus_tag="PSPA7_RS01365"
                     /old_locus_tag="PSPA7_0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012073849.1"
                     /db_xref="GI:501021181"
                     /translation="MSIPRLPPLNAVRAFEAAARLGSYVAASKALHVTQPAVGRHVRL
                     LEDWLGARLFERTSRGVRLTPAGRQYYAAVSAALQQIAEAGGQLGGARWLRIMAVPAF
                     ARRWLTPRLETLCAQRPGLKIALEPNPTFDHVEERSADLGIVYGLPGQYANPRALLIR
                     PKVFPVCSPAYLAAAGPLETVERLVEHKLIHVDDGEWWNLWFSAVGVDVRVSPAVLYL
                     SNDHALARAEEGLGIALANEVLVRQELRSGALVRPLAAEAALESYQVLTPPGVPSADV
                     EWFIDWLGEALREAFPDAVTC"
     gene            305097..306761
                     /locus_tag="PSPA7_RS01370"
                     /old_locus_tag="PSPA7_0292"
     CDS             305097..306761
                     /locus_tag="PSPA7_RS01370"
                     /old_locus_tag="PSPA7_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003083990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit alpha"
                     /protein_id="WP_012073850.1"
                     /db_xref="GI:501021182"
                     /translation="MTTTLSPPPQWSRRRQEKQRRLERARSLADGVVLPRDRIVAALE
                     ALIAPGDRVVLEGNNQKQADFLSRSLARVDPGRLHDLHMIMPSVGRPEHLDLFELGIA
                     RKLDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLLVDLIPNVALVAGFMADRE
                     GNVYTGPSTEDSPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQ
                     PFYIEPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYG
                     ESLGLKGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRD
                     GSLRSNRMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGR
                     RHSTPAWLDMRPEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLA
                     PVMIYGDDVTHVLTEEGIAYLYKARSLEERRAMIAAVAGISPIGLRHDPRETQRMRRE
                     GLIALPEDLGIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
     gene            306761..307642
                     /locus_tag="PSPA7_RS01375"
                     /old_locus_tag="PSPA7_0293"
     CDS             306761..307642
                     /locus_tag="PSPA7_RS01375"
                     /old_locus_tag="PSPA7_0293"
                     /EC_number="2.7.8.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725698.1"
                     /note="catalyzes the reversible formation of
                     2'-(5''-triphosphoribosyl)-3'dephospho-CoA from
                     3-dephospho-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A
                     synthase"
                     /protein_id="WP_012073851.1"
                     /db_xref="GI:501021183"
                     /translation="MNAIANLAATPRADLGECLADLAVDALIDEAELSPKPALVDRRG
                     NGAHADLHLGLMQASALSLWPCFKEMADAAQRHARIDARLRGVLGQLGREGEVAMLRT
                     TEGVNSHRGAIWALGLLVAAAALAPRRTQAGEVAARAGRIALLDDPAAASGDSHGERV
                     RRRYGVGGAREEARLGFPRAVRHGLPQLWRSRESGAGEQNARLDALLAIMSVLDDTCV
                     LHRAGRVGLAAMQEGARAVLAAGGSASLAGRRRLRELDRRLLALNASPGGAADLLAAC
                     LFLDRLPAALGGWAGSL"
     gene            307644..307943
                     /locus_tag="PSPA7_RS01380"
                     /old_locus_tag="PSPA7_0294"
     CDS             307644..307943
                     /locus_tag="PSPA7_RS01380"
                     /old_locus_tag="PSPA7_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I6S8.1"
                     /note="acyl carrier protein of malonate decarboxylase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase ACP"
                     /protein_id="WP_012073852.1"
                     /db_xref="GI:501021184"
                     /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIEV
                     VTSVNGSGPRWQQLFARVFAAATAPAAAIRIHDFGATPGVVRLRLEQALEEAGHD"
     gene            307936..308799
                     /locus_tag="PSPA7_RS01385"
                     /old_locus_tag="PSPA7_0295"
     CDS             307936..308799
                     /locus_tag="PSPA7_RS01385"
                     /old_locus_tag="PSPA7_0295"
                     /EC_number="4.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073853.1"
                     /note="The beta subunit catalyzes the decarboxylation of
                     the malonyl moiety on coenzyme A; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit beta"
                     /protein_id="WP_012073853.1"
                     /db_xref="GI:501021185"
                     /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSP
                     WLERQGIVPQADDGVVIARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAE
                     DNRNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCF
                     GGMSIAAGLCSHVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFAS
                     GLADAYLADDLDEIRASVLAHFAKGLPARPRCRRAGDYLRRLDDLDTAGQPDAADVRR
                     LYRGLSQGDVA"
     gene            308796..309602
                     /locus_tag="PSPA7_RS01390"
                     /old_locus_tag="PSPA7_0296"
     CDS             308796..309602
                     /locus_tag="PSPA7_RS01390"
                     /old_locus_tag="PSPA7_0296"
                     /EC_number="4.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit gamma"
                     /protein_id="WP_012073854.1"
                     /db_xref="GI:501021186"
                     /translation="MSQPSASRGQAWFQALAGNLPPRAGDPASLRVADLELDGYPARV
                     LAVVPDAGNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAY
                     GRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALRD
                     PGVMVHAMGKAAAARITLRSVEELEALAAQVPPMAYDIDSYASLGLLWKTLEVEAIEA
                     PTTNDLARVRECLGAALLDILAGPRDLGGRLGAANREASARVRRLLREQW"
     gene            309678..310310
                     /locus_tag="PSPA7_RS01395"
                     /old_locus_tag="PSPA7_0297"
     CDS             309678..310310
                     /locus_tag="PSPA7_RS01395"
                     /old_locus_tag="PSPA7_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-dephospho-CoA transferase"
                     /protein_id="WP_041025269.1"
                     /db_xref="GI:751334171"
                     /translation="MREASAPEPHDLLLGMAPEHLADDAPPWAREVLAAGWPVVVRRA
                     PGDPATVAIGVRGPAREQRWAGWMPLVAITRRLRPEALCQREPPLSRDLPAWRALRQL
                     RAPLNALGLAWGVIGGAGFELASGVAVLHPDSDLDLLLRTPRPFPRDDALRLLRCFEH
                     CPCRIDLQLQTPAGGVALREWAEGRPRVLAKGVEAPVLLEDPWRVAEIGA"
     gene            310307..311239
                     /locus_tag="PSPA7_RS01400"
                     /old_locus_tag="PSPA7_0298"
     CDS             310307..311239
                     /locus_tag="PSPA7_RS01400"
                     /old_locus_tag="PSPA7_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl transferase"
                     /protein_id="WP_012073856.1"
                     /db_xref="GI:501021188"
                     /translation="MSTLFAYPGQGAQRPGMLAALPDEPVVRDCLAQAADCLGQAPAE
                     LDSAEALRGTRAVQLCLLIAGVAASRLLEQRGHRPGLVAGLSIGAYAAAVAAGALDFD
                     DALRLVALRGELMQAAWPQGYGMSAILGLDQAQLEALIQAVRRAHPSLYLANVNGERQ
                     LVVAGSDAALAALAERARDAGASAAKRLAVSVPSHCPLLDEPAARLAEAFAGIRLRRP
                     RVPYLSGSRARLVGDPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLS
                     GLARPLFGCATPAFEGTHPDTLDALLREEERRTR"
     gene            311295..311699
                     /locus_tag="PSPA7_RS01405"
                     /old_locus_tag="PSPA7_0299"
     CDS             311295..311699
                     /locus_tag="PSPA7_RS01405"
                     /old_locus_tag="PSPA7_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter"
                     /protein_id="WP_012073857.1"
                     /db_xref="GI:501021189"
                     /translation="MIIYGVALLSLCTLAGLFIGEVLGVLLGVPANVGGVGIAMLLLI
                     FVGSYLGKRGLLSAKTEQGVEFWSAIYIPIVVAMAAQQNVIGALSGGPAAILAGIAAV
                     AVAFALVPLLDRVGRGKPEGVPPLKPHTSAQG"
     gene            311705..312469
                     /locus_tag="PSPA7_RS01410"
                     /old_locus_tag="PSPA7_0300"
     CDS             311705..312469
                     /locus_tag="PSPA7_RS01410"
                     /old_locus_tag="PSPA7_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter"
                     /protein_id="WP_003156934.1"
                     /db_xref="GI:489248794"
                     /translation="MIESLNKVINGYGLISGFAIIGVTMALSYWLSARLTRGRLHGSA
                     IAIFLGLLLSYVGGLATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELR
                     RAGVSGVASLFLGVGSSFVAGVGVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGA
                     SSEVMALSIAAGLVKAILVMVLTPFIAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAAT
                     DPKLVPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
     gene            complement(312580..313509)
                     /locus_tag="PSPA7_RS01415"
                     /old_locus_tag="PSPA7_0301"
     CDS             complement(312580..313509)
                     /locus_tag="PSPA7_RS01415"
                     /old_locus_tag="PSPA7_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012073858.1"
                     /db_xref="GI:501021190"
                     /translation="MLIDEEITLKKLETFLAFMRTGNLARAAVELGTSNVSVHRAIHS
                     LESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLG
                     ALYSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSD
                     PDCECLPLFSDDIYLAVPVDSPYAGLAEIDLSTLRDAPFVTLTQGFATHQDGTRVFRQ
                     AGFEPQIAMQVNDIFTLLSMVSSGVGYALLPKRIEAVYENRVRLIPLQPRYRLQQHIG
                     VVFLKAKERDPNLLALLAECRMHSLRLEQEATG"
     gene            complement(313695..314126)
                     /locus_tag="PSPA7_RS01420"
                     /old_locus_tag="PSPA7_0302"
     CDS             complement(313695..314126)
                     /locus_tag="PSPA7_RS01420"
                     /old_locus_tag="PSPA7_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003156935.1"
                     /db_xref="GI:489248795"
                     /translation="MKKYLLPAFLFAAASLTGCTSYNISQPSAPVDGLVKTDLKADVA
                     VGAPISGQSSVNILFGFIRFGGDSQFADGVTYGGGESGLGLGFDPISSTKAAAAFKAV
                     KSADADLIVAPRYEVAVNDYFVFKKVDVKVTGSKGTIQSIR"
     gene            complement(314318..315238)
                     /locus_tag="PSPA7_RS01425"
                     /old_locus_tag="PSPA7_0303"
     CDS             complement(314318..315238)
                     /locus_tag="PSPA7_RS01425"
                     /old_locus_tag="PSPA7_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012073859.1"
                     /db_xref="GI:501021191"
                     /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEE
                     SFGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCF
                     ETVAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIE
                     TEPLMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLT
                     PNIAFSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVVMVDLAEPVSTSGLAAA
                     WLKRAQLTKPARLFVDYCREQLGKLAVRRY"
     gene            315589..317079
                     /locus_tag="PSPA7_RS01430"
                     /old_locus_tag="PSPA7_0305"
     CDS             315589..317079
                     /locus_tag="PSPA7_RS01430"
                     /old_locus_tag="PSPA7_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003162024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_012073861.1"
                     /db_xref="GI:501021193"
                     /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNR
                     LLARVAACDATDVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALL
                     DSLNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAREALATITRVPLGVIG
                     AVVPWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGVPEGVLNVV
                     PGLGEQAGKALGLHPEVDALVFTGSTEVGKYFMQYSAQSNLKQVWLECGGKSPNLVFA
                     DCRDLDLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLD
                     PASRAGAIVDRRQTAGILAAIERAQGEGATLLGGGRRLTINGSDNFIEPTLFGGVRPD
                     MQLAREEIFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGT
                     VSVNTVDALDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
     gene            317137..318570
                     /locus_tag="PSPA7_RS01435"
                     /old_locus_tag="PSPA7_0306"
     CDS             317137..318570
                     /locus_tag="PSPA7_RS01435"
                     /old_locus_tag="PSPA7_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_012073862.1"
                     /db_xref="GI:501021194"
                     /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGT
                     AGPGFIVPLGVAYLLALSYAFSFSELALMIPRAGGLSSYTEVAIGHFPAILATFSGYV
                     VVAMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALA
                     LLMMIVLLVLGLGAVSSEHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLV
                     EETRRPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGE
                     YGQLFLVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFRQLSRRARTPWVAVLF
                     VAAITGLPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTP
                     FYPLPQLFGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLF
                     VPEPLETAGETAQGKSVALDPLQSPSA"
     gene            318601..319983
                     /locus_tag="PSPA7_RS01440"
                     /old_locus_tag="PSPA7_0307"
     CDS             318601..319983
                     /locus_tag="PSPA7_RS01440"
                     /old_locus_tag="PSPA7_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_012073863.1"
                     /db_xref="GI:501021195"
                     /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGN
                     GLQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVE
                     LSELLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGS
                     TLGSTALGGMKFMHEMGGMLPDFAHVDEPYWYANGGELSPAEFGRRAALQLEEKILEL
                     GAENVAAFVAEPFQGAGGMIFPPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFA
                     HEHFGFQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAA
                     VAIANLKALRDEGVVTRVRDETGPYLQGCLREVFGAHPLVGEVQGAGFVAALQFAEDK
                     ATRRRFANENELAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAV
                     DRTAREIGVL"
     gene            320177..321205
                     /locus_tag="PSPA7_RS01445"
                     /old_locus_tag="PSPA7_0308"
     CDS             320177..321205
                     /locus_tag="PSPA7_RS01445"
                     /old_locus_tag="PSPA7_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003101898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_049792066.1"
                     /db_xref="GI:908648052"
                     /translation="MFSRLSLFGLAFAAAVQAQGQSLTVISFGGATKAAQEQAYFKPF
                     ERSGGGRVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLFERLDPARF
                     GDPAQFVPGTFSECGVATYVWSMVLAYDSTKLARAPQSWADFWNVREFPGKRGLRKGA
                     KYTLEVALLADGVKAEDIYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPPQWLAAG
                     DVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIAFASQP
                     QTQKVFSEQIPYGPVHKGTLALLPETVQEALPTAPANLEGARAVDAGFWVDHGEELEQ
                     RFNAWAAR"
     gene            complement(321283..322164)
                     /locus_tag="PSPA7_RS01450"
                     /old_locus_tag="PSPA7_0309"
     CDS             complement(321283..322164)
                     /locus_tag="PSPA7_RS01450"
                     /old_locus_tag="PSPA7_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003101895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="WP_012073865.1"
                     /db_xref="GI:501021197"
                     /translation="MSAPIHGIIGYTITPFAADGALDLPALGRSIERLINGGVHAIAP
                     LGSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEA
                     VMVLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDN
                     VTMVKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCTAAPNLIPTLN
                     GQLYQAVLDGDLERARALFYRQLPLLDFILRRGLPTTIKAGLALSGLEVGAPRLPVQA
                     LDTEGCRYLQGLLEELR"
     gene            complement(322224..323006)
                     /locus_tag="PSPA7_RS01455"
                     /old_locus_tag="PSPA7_0310"
     CDS             complement(322224..323006)
                     /locus_tag="PSPA7_RS01455"
                     /old_locus_tag="PSPA7_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II aldolase/adducin domain-containing
                     protein"
                     /protein_id="WP_012073866.1"
                     /db_xref="GI:501021198"
                     /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFE
                     AGHDSGLAGQITSRGPETGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPAN
                     RFHSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVP
                     VGNEEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGE
                     IKPIPPTLAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
     gene            323160..323699
                     /locus_tag="PSPA7_RS01460"
                     /old_locus_tag="PSPA7_0311"
     CDS             323160..323699
                     /locus_tag="PSPA7_RS01460"
                     /old_locus_tag="PSPA7_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_003156148.1"
                     /db_xref="GI:489247998"
                     /translation="MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAA
                     ALKLAKALNVQVEELFCEENDGLDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARAL
                     LPFIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHR
                     IRSLGETQAELLVVIHSEE"
     gene            323928..324779
                     /locus_tag="PSPA7_RS01465"
                     /old_locus_tag="PSPA7_0312"
     CDS             323928..324779
                     /locus_tag="PSPA7_RS01465"
                     /old_locus_tag="PSPA7_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase subunit A"
                     /protein_id="WP_003156146.1"
                     /db_xref="GI:489247996"
                     /translation="MAEILSLREAVQRFVHDGDSVALEGFTHLIPTAAGHELIRQGKK
                     DLTLIRMTPDLVYDLLIGAGCARKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEH
                     SHADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDV
                     SVIHAQKADRKGNVLLWGILGVQKEAALAARRCIVTVEEIVDELDAPMNACVLPSWAL
                     SAVCLVPGGAHPSYAHGYYERDNRFYQDWDPIARDRDAFTAWIDDYIRGTEDFGAFQA
                     KLAEGKR"
     gene            324776..325558
                     /locus_tag="PSPA7_RS01470"
                     /old_locus_tag="PSPA7_0313"
     CDS             324776..325558
                     /locus_tag="PSPA7_RS01470"
                     /old_locus_tag="PSPA7_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate:succinyl-CoA transferase subunit B"
                     /protein_id="WP_003156144.1"
                     /db_xref="GI:489247994"
                     /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSP
                     DVVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAA
                     QVDRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAREVLIILKQSHRTFVDKLAFVT
                     SVGHGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEAT
                     GWAIRFAERVAETPAPNEVELTALRDLEARTAAAHGQKGSDE"
     gene            325555..326760
                     /locus_tag="PSPA7_RS01475"
                     /old_locus_tag="PSPA7_0314"
     CDS             325555..326760
                     /locus_tag="PSPA7_RS01475"
                     /old_locus_tag="PSPA7_0314"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084064.1"
                     /note="catalyzes the thiolytic cleavage of
                     beta-ketoadipyl-CoA to succinate and acetyl-CoA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_012073867.1"
                     /db_xref="GI:501021199"
                     /translation="MSREVFICDAVRTPIGRFGGSLAAVRADDLAAVPLKALVERNPG
                     VDWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAF
                     RAIASGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYG
                     IDPMPQTADNVADDYRVSRADQDAFALRSQQRAGRAQAAGFFAEEIVPVTIRGRKGDT
                     LVEHDEHPRPDTSLEALARLKPVNGPEKTVTAGNASGVNDGAAALILASAEAVERHRL
                     TPRARVLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACL
                     RELGVADDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQ
                     GLALAIERV"
     gene            326913..328214
                     /locus_tag="PSPA7_RS01480"
                     /old_locus_tag="PSPA7_0315"
     CDS             326913..328214
                     /locus_tag="PSPA7_RS01480"
                     /old_locus_tag="PSPA7_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate transporter"
                     /protein_id="WP_012073868.1"
                     /db_xref="GI:501021200"
                     /translation="MTAPVHQYSHEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYF
                     APAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAG
                     SLAIACMPTYASIGTLAPTLLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASF
                     QYVTLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETA
                     SKSTLERKESGTFAELFGKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAK
                     TASAVMTFALLAYMLMQPLFGMLSDRIGRKTSMLWFGALGTLCTLPILLALKTVSSPY
                     MAFFLIILALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALG
                     LKSVGMENVFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
     gene            328237..329616
                     /locus_tag="PSPA7_RS01485"
                     /old_locus_tag="PSPA7_0316"
     CDS             328237..329616
                     /locus_tag="PSPA7_RS01485"
                     /old_locus_tag="PSPA7_0316"
                     /EC_number="5.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003101887.1"
                     /note="Catalyzes the cycloisomerization of
                     cis,cis-muconate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /protein_id="WP_012073869.1"
                     /db_xref="GI:501021201"
                     /translation="MSDVPANQLFDAYFTAAPMRAVFSDRGRLQGMLDFEAALARAEA
                     RVGVVPATAVAPIEAACRAELYDPLALAEAVANAGNSAIPLVKALGRQVAAGDAEAER
                     YIHLGATSQDAMDSGLVLQLRRALALLEEDLQRLAAALADQAARHADTPLAGRTWLQH
                     ATPVTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALA
                     EELGLALPEQPWHTQRDRLVEFASVLGLVAGSLGKLGRDVSLLMQTEAGEVFEPAGTG
                     RGGSSTMPHKRNPVGSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPEL
                     CCLVSGALRQAIGLLEGLEVDAGRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLV
                     EQCCRRAVEQRRGLRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHH
                     ALGFEPHPA"
     gene            329631..330422
                     /locus_tag="PSPA7_RS01490"
                     /old_locus_tag="PSPA7_0317"
     CDS             329631..330422
                     /locus_tag="PSPA7_RS01490"
                     /old_locus_tag="PSPA7_0317"
                     /EC_number="3.1.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003161006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="WP_012073870.1"
                     /db_xref="GI:501021202"
                     /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPAL
                     TAHFRVLRYDTRGHGASLVTPGPYTIGQLGADVVALLDALDLPRVHFCGLSMGGLIGQ
                     WLGIHAGARIGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASLARWFTAG
                     FAEREPAQAERIVAMLAATSPQGYAANCAAVRDADFREQLELVQAPTLVVAGSHDAVT
                     TPDDARFMQARIADAQLVVFAAAHLSNVEAGDAFSRRLVDFLLSA"
     gene            330433..330834
                     /locus_tag="PSPA7_RS01495"
                     /old_locus_tag="PSPA7_0318"
     CDS             330433..330834
                     /locus_tag="PSPA7_RS01495"
                     /old_locus_tag="PSPA7_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="WP_003151089.1"
                     /db_xref="GI:489242884"
                     /translation="MDEKQRYEAGMQVRRAVLGDAHVDRSLASLTPFNEEFQEMITRH
                     AWGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSA
                     IYCGIPAANATFHLAESVWDELGVESQQETR"
     gene            330985..331926
                     /locus_tag="PSPA7_RS01500"
                     /old_locus_tag="PSPA7_0319"
     CDS             330985..331926
                     /locus_tag="PSPA7_RS01500"
                     /old_locus_tag="PSPA7_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012073871.1"
                     /db_xref="GI:501021203"
                     /translation="MSRKLHIHAPAIHYFDMVRRCDSIREAARRLNVASSAVNRQILK
                     LEDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLCTGHVEIA
                     TIEAVTSDLLPCVLKAMRERYPDVTVGVTLLGSQAIPDAVASGAVDLGLAFALPRSAD
                     LQQISVGHFRLGAIVAPQHPLARRDAITFADCAGHGLIMAKSELSIHHLLAPLQRRLR
                     EPCRAALESSSLELSRQLARRGLGVAFQTRLGIEADIASGELRFLPLQDNGGIHSDLG
                     LYVRTGRYLPVAVDALARQIAEEVRLREREEARLNDA"
     gene            332106..332939
                     /locus_tag="PSPA7_RS01505"
                     /old_locus_tag="PSPA7_0320"
     CDS             332106..332939
                     /locus_tag="PSPA7_RS01505"
                     /old_locus_tag="PSPA7_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003162029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003151092.1"
                     /db_xref="GI:489242887"
                     /translation="MKKMMRGAAALVALVGAGESMALEWMSNSVGFRYGQQFTNPNNP
                     DKFAKRIYSFTHADGYRYGSNFFNLDVFLSDSRDPRKGTDHGGSEVYAVYRHQLYASR
                     VFDRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYR
                     EKNHFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGEKGEDYNDKD
                     TAAETLVRAALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFT
                     F"
     gene            complement(333059..334405)
                     /locus_tag="PSPA7_RS01510"
                     /old_locus_tag="PSPA7_0321"
     CDS             complement(333059..334405)
                     /locus_tag="PSPA7_RS01510"
                     /old_locus_tag="PSPA7_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016561488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate transporter"
                     /protein_id="WP_012073872.1"
                     /db_xref="GI:501021204"
                     /translation="MNSSSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLD
                     TAAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVF
                     LFGLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFC
                     GFNLGMACGGFVSAKLIPLFGWHSLLLLGGLLPLALALVLLFRLPESARYLVVRNRGS
                     ERVRRALAPIAPAQVALAQGFHVPEQHTVQARNVFAVIFSGTYSAGTLLLWLTYFMGL
                     VIVYLLTSWLPTLMRDSGASLEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLF
                     YLLAGVFAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSW
                     MLGIGRFGAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
     gene            334694..335572
                     /locus_tag="PSPA7_RS01515"
                     /old_locus_tag="PSPA7_0323"
     CDS             334694..335572
                     /locus_tag="PSPA7_RS01515"
                     /old_locus_tag="PSPA7_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003151095.1"
                     /db_xref="GI:489242890"
                     /translation="MNATSSALPGNDQPLRGIFLICAAVFLFASHDGLSKFLSGFYPI
                     VMVVWARYLVHTLLMVVVFVPRNGLAVIRTRRPFMQLARALCLIGTSLFFTTGLRYLP
                     LAEATAVNFLAPLLVTALSVPLLKEKVSPGQWLAVLTGFVGVLFIVRPGGALFTPAAL
                     FPLGSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLM
                     MIALGGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHAPDAWALLGI
                     LVICASGLLVAWRRGR"
     gene            complement(335600..336850)
                     /locus_tag="PSPA7_RS01520"
                     /old_locus_tag="PSPA7_0324"
     CDS             complement(335600..336850)
                     /locus_tag="PSPA7_RS01520"
                     /old_locus_tag="PSPA7_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_012073874.1"
                     /db_xref="GI:501021206"
                     /translation="MSHPSLVRALCASLCLGAGLPVHAERGFLEDAKVSLTARNFYLN
                     RDFVGHASQDKAEEWTQSFILDARSGFTEGSVGFGLDVLGLYSLKLDGGKGTAGTQLL
                     PTHGDGRPADDFGRLAVAGRLRVSNTELKLGEWMPVLPILRSDDGRSLPQTFRGGQLS
                     ASEIAGLTLHAGQLRGNSPRNDASMQDMSLFGRPAATSDRFDFVGGEYRFNGERTLLG
                     LWHAELKDIYRQQYLQLQHSQPLGGWLLGANLGWFRGRDDGSARAGELDNRTVSALFS
                     VRHGLHALYLGLQKVGGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFV
                     GLGLPGLTFMTRYLHGSHVRLAGVTDDGSEWGRESELGYTVQGGAFKRLNLRWRNSSQ
                     RRDWGSNTRFDENRLIVSYPLGLF"
     gene            complement(336916..338244)
                     /locus_tag="PSPA7_RS01525"
                     /old_locus_tag="PSPA7_0325"
     CDS             complement(336916..338244)
                     /locus_tag="PSPA7_RS01525"
                     /old_locus_tag="PSPA7_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003151100.1"
                     /db_xref="GI:489242895"
                     /translation="MIHSSSSRLPAADTAARATRGGRMRSALAVGHTRWGMLALVFFA
                     TTLNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDRVGVKR
                     AFFLAVLLWSLTTGLHGLATSAAGFMLCRFVLGLTEAANYPACVKTTRLWFPAGERAV
                     ATGIFNAGTNVGAMVTPALLPLVLSVWGWQAAFLCMSALGLVWLAFWWRNYHNPEEHP
                     RVRRSELDYIQQQEEPPVTRVPFSRILRRRGTWAFALAYSITAPVFWFYLYWLPPFLN
                     QQYGLGISVTQMGIPLILIWLTADFGSIGGGILSSWLVGRGMPAVRARLLSMLLFACT
                     IVGVVFAANADGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPRHLMSTVFGFGGMCA
                     ALGGMFMTQLVGGVLTATNNNYAVLFCMIPAMYFIALAWLYFMAPRRIEA"
     gene            338363..338548
                     /locus_tag="PSPA7_RS01530"
     CDS             338363..338548
                     /locus_tag="PSPA7_RS01530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014833856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041025270.1"
                     /db_xref="GI:751334172"
                     /translation="MERRSKGEVGERHGRYPIIEIVMSLGLRRFPEGSGERFRQSGMA
                     CTGGSDGERLVEKSSIR"
     gene            338772..340676
                     /locus_tag="PSPA7_RS01535"
                     /old_locus_tag="PSPA7_0327"
     CDS             338772..340676
                     /locus_tag="PSPA7_RS01535"
                     /old_locus_tag="PSPA7_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylpyruvate dioxygenase"
                     /protein_id="WP_012073876.1"
                     /db_xref="GI:501021208"
                     /translation="MQRSIATVSLSGTLPEKLEAIAAAGFDGVEVFENDLLHYDGSPR
                     DVRRLCADLGLDILLFQPFRDFEGCRRERLARNLERAERKFDLMQELGTDLVLVCSNV
                     AADALGEPALLVDDLRLLAERAAARGLRIGYEALAWGRQVSTWEQAWELVRRADQPNL
                     GLILDSFHTLSLNGDARGIAGLPAEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGF
                     DLAGFLAPIVASGYRGPLSLEVFNDGFRAAPTRANAADGLRALLYLEEKTRERLRREA
                     PQVAVDGLFAPPPASVCDGIEFLEFAVDEALRARLGQWLRQLGFARVGQHRSKNVSLL
                     RQGGINLVLNAEPYSFAHGFFEAHGPSLCATALRVRDAGQALERARRYGGQPYRGLVG
                     PNEREIPAVRALDGSLLYLVEQEGGGRDIYQTDFEMTGEATPGLGLRRIDHVAMALPA
                     EGLDSWVLFYKSLFDFSADDEVVLPDPYGLVTSRAVRSRCGQVRLPLNISEDRNTAIA
                     RALSSYRGSGVHHIAFDCADIFAAVAQAKEAGLTLLEIPLNYYDDLAARFDFTEEFLS
                     ELAYYNVLYDRDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVAVRLAAMAQ
                     ARRGVRRVKL"
     gene            340769..341437
                     /locus_tag="PSPA7_RS01540"
                     /old_locus_tag="PSPA7_0328"
     CDS             340769..341437
                     /locus_tag="PSPA7_RS01540"
                     /old_locus_tag="PSPA7_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003157798.1"
                     /db_xref="GI:489249682"
                     /translation="MSNPDPAAVEAPAPRGKGRKNNPEKTRQDILRAAADEFVAQGLS
                     GARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIENSLQLGELPPVKAM
                     RKLVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNGSIVQGIAEILRRGEA
                     EGVFRPGLVALDVHLLISSFCFYRVSNRYTVSRIFRTDLHDAGVRQRHLEMICEAVLR
                     YLRA"
     gene            complement(341502..342356)
                     /locus_tag="PSPA7_RS01545"
                     /old_locus_tag="PSPA7_0329"
     CDS             complement(341502..342356)
                     /locus_tag="PSPA7_RS01545"
                     /old_locus_tag="PSPA7_0329"
                     /EC_number="1.1.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073877.1"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="WP_041025271.1"
                     /db_xref="GI:751334173"
                     /translation="MSRPRSVLAGLIGAGIQASRTPALHEHEGDAQGIRYLYRLIDLD
                     LLGKSADDLESLLAAASDLGFTGLNVTFPCKQAIIPLLDELSAEARGIGAVNTVVLRD
                     GRRIGHNTDCLGFAEGFRRGLADAPRQRVVQLGAGGAGAAVAHALLAEGVERLILFDV
                     ETARAQALADNLNAHFGAARTLAGNDLASALGAAQGLVNTTPVGMAKLPGMPLPAELL
                     RSELWVAEVIYFPLETELLRQARALGCRTLDGGSMAVFQAVKAFELFSGVKADAARMQ
                     AHFASLGD"
     gene            complement(342353..342799)
                     /locus_tag="PSPA7_RS01550"
                     /old_locus_tag="PSPA7_0330"
     CDS             complement(342353..342799)
                     /locus_tag="PSPA7_RS01550"
                     /old_locus_tag="PSPA7_0330"
                     /EC_number="4.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073878.1"
                     /note="catalyzes the formation of 3-dehydroshikimate from
                     3-dehydroquinate in chorismate biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_012073878.1"
                     /db_xref="GI:501021210"
                     /translation="MTRTVLVLNGPNLNLLGTREPRTYGRQTLAGIAAQCAAFAESRG
                     FAVEFRQTNHEGELLDWIHQARGRIAGLVINPAAWTHTSVALRDALAAVELPVLEVHL
                     SNVHQREPFRHHSHVSPLATGVICGLGGLGYRLALEYFASQFEAAA"
     gene            complement(342916..344421)
                     /locus_tag="PSPA7_RS01555"
                     /old_locus_tag="PSPA7_0331"
     CDS             complement(342916..344421)
                     /locus_tag="PSPA7_RS01555"
                     /old_locus_tag="PSPA7_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_041025272.1"
                     /db_xref="GI:751334174"
                     /translation="MPELAHNPPVVRTVLVGLMLSIFLSALDQTIVAVSLPAISADFA
                     DLDLLAWVISGYMVAMTVSMPIYGKLGDLYGRRRLMLFAIAVFSAASLLCGLAQSMGQ
                     LVLGRVLQGIGAGGLMAVSQAIVGDIVPPRERGRYQGYFSSMYAIASVAGPVLGGLLT
                     EYLSWRWVFWINLPIGLLALAISRRTLVGLPVPRRQPLIDYPGIALMVVGLTALLLGI
                     TQIGQGVAWNDPALLGLFALAAVVLLLFILQERRFREPLVPMQLFCIRAATLSWLVAF
                     FASFQAISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAYCCGRLTASLGRYKP
                     LILGGALLLPCSIAGLALTPATHPWLSGLFMLLTGIAVGTQFPTSLVAAQNAVEQRHI
                     GVATSNATLFRSLGGAVGVALMSAILLALLKHLRIGGGIDQGFSESALLSSLNAASGP
                     AQIIFQHVLADAFKVLFLINAAVALLGLAVAAALPDMPLRGRPVAEPAAGE"
     gene            complement(344581..345765)
                     /locus_tag="PSPA7_RS01560"
                     /old_locus_tag="PSPA7_0332"
     CDS             complement(344581..345765)
                     /locus_tag="PSPA7_RS01560"
                     /old_locus_tag="PSPA7_0332"
                     /EC_number="1.14.13.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073880.1"
                     /note="catalyzes the formation of protocatechuate from
                     4-hydroxybenzoate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate 3-monooxygenase"
                     /protein_id="WP_012073880.1"
                     /db_xref="GI:501021212"
                     /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQAPDYVLGRIR
                     AGVLEQGMVDLLREAGVDQRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGRTVTVYGQ
                     TEVTRDLMEARAACGATTIYQAAEVRLHDLEGEHPHVTFERDGERVRLDCDYIAGCDG
                     FHGVSRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYASHPRGFALCSQRSATR
                     SRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAQRLVTGPALEKSIAPLRSFVVEPM
                     QHGRLFLAGDAAHIVPPTGAKGLNLAASDVATLYHLLLKAYREDRADLLERYSAICLR
                     RIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEA
                     VE"
     gene            345943..346809
                     /locus_tag="PSPA7_RS01565"
                     /old_locus_tag="PSPA7_0334"
     CDS             345943..346809
                     /locus_tag="PSPA7_RS01565"
                     /old_locus_tag="PSPA7_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012073881.1"
                     /db_xref="GI:501021213"
                     /translation="MTLPTGAVPVFKLYGEPLEWPTPDLLHCESIPARSRLHDWEIKP
                     HRHADLGQLLYVRRGWAQLQVEGELTRVERPAIQFVPPLCIHGFQFSERIDGYVLTLA
                     APLLARLQAHLGAQRQALEAPGLYPVGADRRYIDTLFDAIDGEYAGTAPARELLLQSL
                     IGVLAVWLGRQVMVRRAEARPGRGQEYLSGFSQLVERHFREHLGIDEYARRLGITPAH
                     LNGVARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRL
                     SGVAPSVFRKGG"
     gene            complement(346806..347252)
                     /locus_tag="PSPA7_RS01570"
                     /old_locus_tag="PSPA7_0333"
     CDS             complement(346806..347252)
                     /locus_tag="PSPA7_RS01570"
                     /old_locus_tag="PSPA7_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_003152138.1"
                     /db_xref="GI:489243945"
                     /translation="MSSPLQFRRYTPADRDATLAIWLEASRIGHGFLGEAELQKQKAL
                     VRDHYLDASETWLALDGETPLGFIGLLDAFIGGLFVAPAAHGRGIGRQLLEHAAALKG
                     ALEVEVYAANREALGFYGHCGFVETGRRKEDDEGRPLEIVHLRRGD"
     gene            complement(347344..347778)
                     /locus_tag="PSPA7_RS01575"
                     /old_locus_tag="PSPA7_0335"
     CDS             complement(347344..347778)
                     /locus_tag="PSPA7_RS01575"
                     /old_locus_tag="PSPA7_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_003152136.1"
                     /db_xref="GI:489243943"
                     /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVLN
                     HGEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHL
                     RHLPVVEEGRLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
     gene            complement(347920..348561)
                     /locus_tag="PSPA7_RS01580"
                     /old_locus_tag="PSPA7_0336"
     CDS             complement(347920..348561)
                     /locus_tag="PSPA7_RS01580"
                     /old_locus_tag="PSPA7_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003152134.1"
                     /db_xref="GI:489243941"
                     /translation="MNDYIARLRARYDEHFGCAPAMTLDCRGFWKHCAAVPDMAVFAY
                     RLENSRRAHHVAITAGMSQRPMHFAPYMGKARWSTELICYLDHLGGEDLRHLQWLAGM
                     PFHDQLALGRGHSVAFGFPLYEYSLLRHFLLLGTPDREDAGLFDGFADSAYPVDLLWV
                     VPLTEPEYQVKVKRNLEGIGALLSQSAHPLSLDRHRHCYVTGERPEGLGRVLH"
     gene            complement(349039..349488)
                     /locus_tag="PSPA7_RS01585"
                     /old_locus_tag="PSPA7_0337"
     CDS             complement(349039..349488)
                     /locus_tag="PSPA7_RS01585"
                     /old_locus_tag="PSPA7_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012073882.1"
                     /db_xref="GI:501021214"
                     /translation="MNETNALGLPRGPLNLMTEIVRQRERQLTALLAPLGLGLHEWRA
                     LRIIHAFDGDVPMSLLIEHSQTDRTALGRTIERLVQRGWASRLPDPEDGRAVLVRRSR
                     AAQAVFEQALERVARLDEALLASLEAGEDGTLVVALGKLLRALDGRS"
     gene            complement(349541..351031)
                     /locus_tag="PSPA7_RS01590"
                     /old_locus_tag="PSPA7_0338"
     CDS             complement(349541..351031)
                     /locus_tag="PSPA7_RS01590"
                     /old_locus_tag="PSPA7_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_012073883.1"
                     /db_xref="GI:501021215"
                     /translation="MNRSALDFRHFIDHLRHQGDLVDIHAEVDADLEIGAITRRVYER
                     GAPAPLFHTIRGSLPGARILGAPAGLRADKARAHGRLALHFGLPDHSGPREIVAALRA
                     AMRAAPIAPRRVERGPVQENVWIGERVDLTRFPVPLLHAQDGGRYFGTYGFHIVQTPD
                     RRWDSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRQGRPTPWAMALGAPPAALAA
                     AGMPLPEGVSEADYVGALVGEPVEVVRARTNGLWVPANAEIVLEGEISLDETALEGPM
                     GEYHGYCFPTGKPQPLFHVHAVTFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVL
                     QDAGLPVDMTWCSYEAATCWAVLSIDVQQLAALRTDAAAFAARIAEVAFGSHPGHLVP
                     KLILVGNDIDVSEIDQVVWALATRAHPLHDHFVFPAIRDFPMVPYLDAEDRARGSGGR
                     LVINCLYPEQFAGRMRASTASFRHSYPPALRQRVEERWREYGFADD"
     gene            complement(351163..351864)
                     /locus_tag="PSPA7_RS01595"
                     /old_locus_tag="PSPA7_0339"
     CDS             complement(351163..351864)
                     /locus_tag="PSPA7_RS01595"
                     /old_locus_tag="PSPA7_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073884.1"
                     /db_xref="GI:501021216"
                     /translation="MLPDSVVGSSARRLRLRRVRGRVGLGLVAGLSVLAGMTDAIGFL
                     ATGDFVSFMSGNTTRLAVSLGEGDLGGMARLAIALASFVAGNALGVILARFSGRRAAP
                     ILVCCAMLLALSAVWPFDWNVPALVAAIIAMGMLNAVVEQVNGLPIGLTYVTGALSRF
                     GRGLGRWLLGERRNGWRVQLVPWSGMCIGAVLGALLEQRLGLAAMAASAALAALLALA
                     ALVIPRPWQMDYMAR"
     gene            complement(352229..352305)
                     /locus_tag="PSPA7_RS01600"
                     /old_locus_tag="PSPA7_0340"
     tRNA            complement(352229..352305)
                     /locus_tag="PSPA7_RS01600"
                     /old_locus_tag="PSPA7_0340"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(352269..352271),aa:Arg,seq:ccg)
     gene            complement(352494..352910)
                     /locus_tag="PSPA7_RS30405"
                     /old_locus_tag="PSPA7_0341"
     CDS             complement(352494..352910)
                     /locus_tag="PSPA7_RS30405"
                     /old_locus_tag="PSPA7_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073885.1"
                     /db_xref="GI:501021217"
                     /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIREGQRPGAPFPSPCAS
                     GAAATGRPPRAMGGQERSRPPTNVGEDTKESRGKGIAKQTPRRRHGGPTARKAGRATG
                     RSERGHSRGTRPAELKPIPRSPIVVALGAFEISNES"
     gene            352935..354386
                     /gene="gabD"
                     /locus_tag="PSPA7_RS01605"
                     /old_locus_tag="PSPA7_0343"
     CDS             352935..354386
                     /gene="gabD"
                     /locus_tag="PSPA7_RS01605"
                     /old_locus_tag="PSPA7_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017938160.1"
                     /note="catalyzes the formation of succinate from succinate
                     semialdehyde; NADP dependent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase"
                     /protein_id="WP_012073886.1"
                     /db_xref="GI:501021218"
                     /translation="MQLKDAKLFRQQAYIDGAWVDADSGQTIKVNNPATGEIVGSVPK
                     MGAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPL
                     AEAKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPS
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGG
                     ELTSNPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEG
                     ALISKYRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDA
                     KAVTKVEEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKDALVSRDETFGPLA
                     PVFRFKDEAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVA
                     PFGGIKASGLGREGSKYGIEDYLEIKYLCLGGI"
     gene            354631..355911
                     /locus_tag="PSPA7_RS01610"
                     /old_locus_tag="PSPA7_0344"
     CDS             354631..355911
                     /locus_tag="PSPA7_RS01610"
                     /old_locus_tag="PSPA7_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485432.1"
                     /note="catalyzes the formation of succinate semialdehyde
                     and glutamate from 4-aminobutanoate and 2-oxoglutarate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-aminovalerate aminotransferase DavT"
                     /protein_id="WP_003106268.1"
                     /db_xref="GI:489196962"
                     /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREY
                     IDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDF
                     PKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVN
                     SKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFP
                     ISGVAGKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKA
                     GLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCG
                     TYYNVIRFLMPVTIPDAQLEKGLAILAECFDELA"
     gene            356225..357424
                     /locus_tag="PSPA7_RS01615"
                     /old_locus_tag="PSPA7_0345"
     CDS             356225..357424
                     /locus_tag="PSPA7_RS01615"
                     /old_locus_tag="PSPA7_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_012073888.1"
                     /db_xref="GI:501021220"
                     /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLSVRCDARLILCGDGGE
                     ALEHCRRRSFALVLAESNLPQVDGFELLREARLRRPVAEQPFILISDRADQASVRAAV
                     ALAPTAYLVKPFQAGNLLQRLRGLLLKDDEVIACPLPEVTPDEDLLAFLERARDATEG
                     APLLADVRAASDRCLGAEEQPLRVLEDEFGRDPQITAGLIAAANSAARHVGPPCQTLG
                     QALRRLGLGHSLNLVLGFSLQRAIQLDEPLLAARALQFWELSQRCADIAWELADALGA
                     DVERCYTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDEALGRFGASFGSALRARWR
                     LPLELRRLIAAAYQFGGVLSREELILSLATQAASLPEAETGQLADSKAARMLGLDGER
                     LVKLLQP"
     gene            complement(357659..359089)
                     /locus_tag="PSPA7_RS01620"
                     /old_locus_tag="PSPA7_0346"
     CDS             complement(357659..359089)
                     /locus_tag="PSPA7_RS01620"
                     /old_locus_tag="PSPA7_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_012073889.1"
                     /db_xref="GI:501021221"
                     /translation="MELQLTLDGRHDLVGQLYRQLRDAILRGRLATGDRLPPTRYLAE
                     RLEVSRKTVSEAYERLASEGFLEGRVGNGTFVARGLAQQQPPAGAEGPLRPAARWARI
                     EPQSGLMDQRPALRYSFAGGTTDKRRFPFDAWRTCVLQALRLQQRTPAFYKDTEGDPE
                     LRLATSRYLAISRAVQCDWNALMITQGAQQGLDLLGRVMLEPGDLAVVEEPGYPPARA
                     SLLATGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQ
                     RQRALIIEDDYDSEYRFDGRSLESLRSLDRHGQVAYLGTFSKTLFPELRLGYLLPPAS
                     LREAVLAARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRDRLLERLRGD
                     LEPWLEALPAVAGIHLAARCREPLDVDRIARHLRQQGLEVGTLPPFYAETPPQAGFLF
                     GFGCIECDDIDPALDLLRAELQRSGG"
     gene            359216..359653
                     /locus_tag="PSPA7_RS01625"
                     /old_locus_tag="PSPA7_0347"
     CDS             359216..359653
                     /locus_tag="PSPA7_RS01625"
                     /old_locus_tag="PSPA7_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="WP_012073890.1"
                     /db_xref="GI:501021222"
                     /translation="MTTRLEWAKAAPDAYTAMLGLEKALAKASLERPLIELVYLRTSQ
                     INGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERAALAWTEQLARLSQGP
                     LPHALLDELREHFDDREIAELTLAVSAINAWNRFGVGMGMQPE"
     gene            359665..360072
                     /locus_tag="PSPA7_RS01630"
                     /old_locus_tag="PSPA7_0348"
     CDS             359665..360072
                     /locus_tag="PSPA7_RS01630"
                     /old_locus_tag="PSPA7_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073891.1"
                     /db_xref="GI:501021223"
                     /translation="MRLSRTFACLLCAVLPALAAAHDAEKVVTLRDQPLAEPPGYRGL
                     MLTVSFKPGQVSAPHVHPGPVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVAHVL
                     ARNPDPMRPAKLLVWELLKDGEPVLKPLSPGAH"
     gene            360101..360385
                     /locus_tag="PSPA7_RS01635"
                     /old_locus_tag="PSPA7_0349"
     CDS             360101..360385
                     /locus_tag="PSPA7_RS01635"
                     /old_locus_tag="PSPA7_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073892.1"
                     /db_xref="GI:501021224"
                     /translation="MSASQVIRIRARKGQSDRLGLRLRQLSGPGREAPGCLDFQVRRD
                     ALEADVWLIRSQWREPQQMLDYLCGEIQQVFAEVLWRSLAASLEVRDEEG"
     gene            complement(360503..361273)
                     /locus_tag="PSPA7_RS01640"
                     /old_locus_tag="PSPA7_0350"
     CDS             complement(360503..361273)
                     /locus_tag="PSPA7_RS01640"
                     /old_locus_tag="PSPA7_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073893.1"
                     /db_xref="GI:501021225"
                     /translation="MPRLALSALLCLCSLLSTLPARAALDDQQRALQQLQVQACRVVG
                     SLLLLRGEGFQEQHAAQLEKDLASLDRALAAVPEGVLLRQGEKALVARIREGAAYGPR
                     EEDLPWRYPQQLSRALRDFLNLVERQVPPTPPGQPLPLWQLPARVEYLSLQYLARAYL
                     GGLEIAREQPRDYLGQDESVLVPLIDRRIALLVANSANPAGLKKLENRWEYLSQALRD
                     LNSKSSALVSASGRPWAPIIVDRHARVLSDSLMRLSAE"
     gene            complement(361384..362070)
                     /locus_tag="PSPA7_RS01645"
                     /old_locus_tag="PSPA7_0351"
     CDS             complement(361384..362070)
                     /locus_tag="PSPA7_RS01645"
                     /old_locus_tag="PSPA7_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_012073894.1"
                     /db_xref="GI:501021226"
                     /translation="MNARTDYRSQLQAGRWFQGLPEALQTHLLALAQPRQLPPGQRLF
                     ARGDAPCGLYCVVEGAIRISAVSEHGKEALLILVEPPHWFGEIALFDGQARTHDAYAE
                     GPTELLQVPQAALLELLRREPRYWRDMALLMSHKLRLAFIALEEMALLPAAQRLARRL
                     LMLAEGYDNSRSRQILHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILD
                     LAGLRAASHG"
     gene            362146..362661
                     /locus_tag="PSPA7_RS01650"
                     /old_locus_tag="PSPA7_0352"
     CDS             362146..362661
                     /locus_tag="PSPA7_RS01650"
                     /old_locus_tag="PSPA7_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003107722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041025273.1"
                     /db_xref="GI:751334175"
                     /translation="MKTLVDHLAQYAAYHRDRRNILSHFIGIPMIVLSIAVLLARPSP
                     GFGLSPASLLALAAVLFYLRLDLRFGATMAALLALTVWSGAQLAAGSTAAWLGWGIGL
                     FVVGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGEVQREVEERAG
                     PTCIREHKRAA"
     gene            complement(362701..363459)
                     /locus_tag="PSPA7_RS01655"
                     /old_locus_tag="PSPA7_0353"
     CDS             complement(362701..363459)
                     /locus_tag="PSPA7_RS01655"
                     /old_locus_tag="PSPA7_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073896.1"
                     /db_xref="GI:501021228"
                     /translation="MNTRLSLSALALACAALAGCQNLSQQDLMQHGMMAMKAATLSDA
                     EVRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEDVNA
                     WAMANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQATYAAAAVRGAAGA
                     SKSGTLAALSGSQLGELTESLINAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEK
                     LARLGGGDSSMFDSHPGSQARADHIRQRIAADRK"
     gene            complement(363620..364204)
                     /locus_tag="PSPA7_RS01660"
                     /old_locus_tag="PSPA7_0354"
     CDS             complement(363620..364204)
                     /locus_tag="PSPA7_RS01660"
                     /old_locus_tag="PSPA7_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073897.1"
                     /db_xref="GI:501021229"
                     /translation="MTNLWQLACGPSFLGLMKRLAGMLFGVVVGTLLVGAWLGDDAPR
                     QATGVLGLALVVYALLGLAAIALHLPARHERWVGPLVGLATGALTAVTGVFVIPAVPY
                     LGALGLQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLL
                     GQWLRQRISATLFRRCFFVGLLLLGADLAWRGFH"
     gene            364553..364864
                     /locus_tag="PSPA7_RS01665"
                     /old_locus_tag="PSPA7_0355"
     CDS             364553..364864
                     /locus_tag="PSPA7_RS01665"
                     /old_locus_tag="PSPA7_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073898.1"
                     /db_xref="GI:501021230"
                     /translation="MTEHRKVLTIRDPDPELIRQAKIATGRGTGSQALIASAEKMIHQ
                     REQIEQMQEQIAQMREQISAYQAVLADAHSAATRLAEVAGQGDIFAPSNPLRLGHRRQ
                     R"
     gene            complement(365677..366429)
                     /locus_tag="PSPA7_RS01670"
                     /old_locus_tag="PSPA7_0356"
     CDS             complement(365677..366429)
                     /locus_tag="PSPA7_RS01670"
                     /old_locus_tag="PSPA7_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease SbcC"
                     /protein_id="WP_012073899.1"
                     /db_xref="GI:501021231"
                     /translation="MSFKTIDRGTLNPALKERLAHFEMNRHAYADAQQRFSDIAQEDT
                     RLAAEASKLEAQAEATEQAWRKRAIQPQVDQTEISAEIERGAALKRQVQALRATVEAR
                     SGLTAPVLLEMAELRAGLQKEPAAINTAYWRALLDQVLAQDGLRDALLQAFTLSRDIY
                     LSQLDSLEPVLAARCSGQRERQAFIAQGIWEAFADELKRLFAGAENGMGSPMLASLPS
                     PLRDEVVAETPGELYRLRQASASPLNGRTALR"
     gene            complement(366452..367477)
                     /locus_tag="PSPA7_RS01675"
                     /old_locus_tag="PSPA7_0357"
     CDS             complement(366452..367477)
                     /locus_tag="PSPA7_RS01675"
                     /old_locus_tag="PSPA7_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage capsid protein"
                     /protein_id="WP_034000943.1"
                     /db_xref="GI:730373360"
                     /translation="MSKYLSARASTQYFQLQRTVAEAYHVDDAARTFAVEPTHAQELN
                     DQITERVDFLGRINVIPVSEVKGEKVMLGLSGPATSRTDTNARDREPRHLLDLKNNTY
                     ELAHTETDVALSFATIDAWAKFPDFVDRYLTAVQKRIALDRILVGWSGTHAATQTDPA
                     KYPQLEDVNKGWLQIAREQIPEQVLRSEDPAKKITLGPGGDYANLDALVHDVKQMIDP
                     VLRDEGDLVAIIGSDLLAAEKSTLYAAQGQKPTEKERIEEVKVTETYGGLPSLLVPFF
                     PVMGVVVTSLDNLSIYYQDSSWRRHLLENPKRSRAEDFNGRNEGYVIEQLGKFAALEG
                     SSLELVR"
     gene            367732..368004
                     /locus_tag="PSPA7_RS01680"
                     /old_locus_tag="PSPA7_0358"
     CDS             367732..368004
                     /locus_tag="PSPA7_RS01680"
                     /old_locus_tag="PSPA7_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012073901.1"
                     /db_xref="GI:501021233"
                     /translation="MRIYCPECDSKARIATREEISRQFVKLYCQCTNGHCGHRFVMQL
                     TFSHALYGPSKPLDKLLFDRLREMPSQERRVLFDQLENMGVMDRNT"
     gene            368015..368275
                     /locus_tag="PSPA7_RS01685"
                     /old_locus_tag="PSPA7_0359"
     CDS             368015..368275
                     /locus_tag="PSPA7_RS01685"
                     /old_locus_tag="PSPA7_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-finger protein"
                     /protein_id="WP_012073902.1"
                     /db_xref="GI:501021234"
                     /translation="MKIECPKCGGKARIYTRQKVTSDFCKLYCQCLDTKACHQRFVMN
                     LSLSHCLERPETVLDELVHERLRGLSVQQIKEMQDRIERTAI"
     gene            complement(368359..369690)
                     /locus_tag="PSPA7_RS01690"
                     /old_locus_tag="PSPA7_0360"
     CDS             complement(368359..369690)
                     /locus_tag="PSPA7_RS01690"
                     /old_locus_tag="PSPA7_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016715748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein"
                     /protein_id="WP_012073903.1"
                     /db_xref="GI:501021235"
                     /translation="MNDMTLGAVSAQVRPGFAVYDQDVTIDGKAYRAGLWYHGQERKG
                     AARTVEPVDQWVSIPLHIEAETLDENGYTGRLLRFTNRGRPVRWVLPMGMLATHGGNV
                     LKALFRQGFTADHQGHRQVLTYLREHPRPERLIQIATKPGWHDSGVFVLPGKPIGAAD
                     VYLDASRQQASLYHRRGTLDGWRQSVGLGCLGDPALELAVCLALAGPLLDALGVPGGG
                     VHLLGGTDSSAPLAVRVAASVWGDPFDLTASWHSTQAALIQEAIQRNNTVLPLNGGDW
                     PDLNAEKLGDAIARGRLDIYRHGSCSTLAWRVLMLSHGRRRLFSDARTDWPLVDIATD
                     RPAQAARLDVGHALETHYGHLGPAFVESLLACGGPDTLVPMFHEVRKRLLEVETPHVW
                     RVADRFAAMAVAGEHAIACELLDWSRGKALETCHRLYEQWRTTRKRPASRR"
     gene            complement(369687..369977)
                     /locus_tag="PSPA7_RS01695"
                     /old_locus_tag="PSPA7_0361"
     CDS             complement(369687..369977)
                     /locus_tag="PSPA7_RS01695"
                     /old_locus_tag="PSPA7_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016494807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073904.1"
                     /db_xref="GI:501021236"
                     /translation="MKSHLDYLRERGFEVASVGQDVTVFPLENLTPSLRLWINLHRSE
                     LLAELAAGDGIARHCVWRVYLRGEFVCTAVSEPMSLDEVRKRVRFPGAEVRP"
     gene            complement(369974..371530)
                     /locus_tag="PSPA7_RS01700"
                     /old_locus_tag="PSPA7_0362"
     CDS             complement(369974..371530)
                     /locus_tag="PSPA7_RS01700"
                     /old_locus_tag="PSPA7_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073905.1"
                     /db_xref="GI:501021237"
                     /translation="MAVKKDPYGDQWAGSDTLNDAIKKLGTDAGALYETKALAQLKKM
                     RGSDPAAFARLRAKVKDSKMLSMAEFDRLTIPAEDEEVAAGGDIFTEVEAWPKPVKGD
                     ELLDEICAVLRRYVAADKETIRAAALWSTFTWLIDVVQVAPIANITAPEKRCGKSILL
                     TALGKLAYRPMQVSNIAPAALYRAIELWSPTLLIDEVDAFLAAYDDARGILNAGFTRD
                     SASVIRCVGDDHMPTRFNVWGAKALCGIGKIADTLADRSIPLRLRRRVAGEKVERLRH
                     SDPVMWERLQAKLARWTADNAVTVGDARPAPIQGLNDRANDCWEPLLAIAEAAGGHWP
                     KSARQAAIVLHGLEGEAPSIGAELLQDVKAVFEDKNITKIFSGELLDALLSDDESPWA
                     TWNRGKPISTRQLSGKLGDFGIKSKQIRIGSDSKKGYEIKDFLDAFNRYLSANPPSAS
                     ETSKQTSNHAASSDFSNETLGDGVSDKKTLQPSNHAGCFDVSDKTPPPGRKGGKKGAT
                     SQVSYEEVRG"
     gene            complement(371530..371913)
                     /locus_tag="PSPA7_RS01705"
                     /old_locus_tag="PSPA7_0363"
     CDS             complement(371530..371913)
                     /locus_tag="PSPA7_RS01705"
                     /old_locus_tag="PSPA7_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence-associated protein E"
                     /protein_id="WP_012073906.1"
                     /db_xref="GI:501021238"
                     /translation="MTPIDKVLGRLDKVKRVKVNGKHRWKACCPAHDDKSPSLDVTEA
                     EDGTVLLKCWVGCSAAEIVGAIGLELRDLFPGEKRERSGPSPAAVRHERTIYLIGKNQ
                     LDQGGEMSAEDLERFNLAKQRLGVQ"
     gene            complement(371910..372476)
                     /locus_tag="PSPA7_RS01710"
                     /old_locus_tag="PSPA7_0364"
     CDS             complement(371910..372476)
                     /locus_tag="PSPA7_RS01710"
                     /old_locus_tag="PSPA7_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073907.1"
                     /db_xref="GI:501021239"
                     /translation="MKNIQERRSALTGSACPEKADDTLHQDRTDNCEGYVAPQRTCRH
                     VGDRQCVQVGDFGTAVAGERGYALAGESGFALAGDRGTARAGDFGTAMVGEFGKAIAG
                     DCGMASACDGGSARAGFRGIASAGFQGAVAAGEFGELRLTYWDSPSKRYRTAVGYIGE
                     DGLLADTFYTLDSSHQFVPAKTEREARV"
     gene            complement(372543..372776)
                     /locus_tag="PSPA7_RS01715"
     CDS             complement(372543..372776)
                     /locus_tag="PSPA7_RS01715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_046599141.1"
                     /db_xref="GI:817611473"
                     /translation="MLRWDAGEVDAFLPKGLSADELCERYQISRATLWRWTKLPGFPV
                     ASGIGRMLRWEPQAVDAFLSRQRRAGTAPVQSA"
     gene            complement(372926..373153)
                     /locus_tag="PSPA7_RS01720"
                     /old_locus_tag="PSPA7_0366"
     CDS             complement(372926..373153)
                     /locus_tag="PSPA7_RS01720"
                     /old_locus_tag="PSPA7_0366"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073909.1"
                     /db_xref="GI:501021241"
                     /translation="MTGLTSTQVIDNARQRIEAAQCREGLDVAWDQGLGALHTLLALG
                     RIDLSTWRWHHADFDSRAELRAFALEQGGEQ"
     gene            complement(373150..373350)
                     /locus_tag="PSPA7_RS01725"
                     /old_locus_tag="PSPA7_0367"
     CDS             complement(373150..373350)
                     /locus_tag="PSPA7_RS01725"
                     /old_locus_tag="PSPA7_0367"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073910.1"
                     /db_xref="GI:501021242"
                     /translation="MSALVPAPPRTSVRFSVLALLGEAVIVNRVTGTSASRTRLLALA
                     DMAYAVSMVSELERQAVIGGAK"
     gene            complement(374267..375646)
                     /locus_tag="PSPA7_RS01730"
                     /old_locus_tag="PSPA7_0368"
     CDS             complement(374267..375646)
                     /locus_tag="PSPA7_RS01730"
                     /old_locus_tag="PSPA7_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_034000937.1"
                     /db_xref="GI:730373172"
                     /translation="MAKRNRLTEMEAYSVKKRKSEPVGARGKGTLLLERKAAGTISGY
                     YRERVEGKDKRIYLGTLNRKPRSGTDELTLDAMRLAALRLSQTALEAGGLEHVKLSAA
                     KQLHSSGEGSFGDLLDSYCDHLEQAGKVSARPVRRMLDAHVKAHHPALLRRPASKVRP
                     EDIQLVLSQVLNRPPLPGGAGRTAKAHAANGMRTVCENLRLALQAAFSHAAKAHLSPE
                     RLATRGKTFAISSNPVRDIPAIRGARRAITESLTPDELGVLLRHLETLPEAHRAIAQA
                     LIYFGGQRIAQFCAVPWAAVTDSTISLLDSKGKKERPWEHILPITPRLTEIMHPLLQH
                     RIGPGPFSLRESNTASPSSVMKIFGAAGQSLAASGKARPFSYRNVRVTAETLMAHLGI
                     SSEIRAWILSHGRSGVQAKHYDRYSYLPEKRAALERWGDYLDGLARGDAPADNVMLLS
                     RNRKESDER"
     gene            complement(375786..375971)
                     /locus_tag="PSPA7_RS01735"
                     /old_locus_tag="PSPA7_0369"
     CDS             complement(375786..375971)
                     /locus_tag="PSPA7_RS01735"
                     /old_locus_tag="PSPA7_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003112932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073912.1"
                     /db_xref="GI:501021244"
                     /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPP
                     MQAAALLIVPSMVTNVR"
     gene            376066..376764
                     /locus_tag="PSPA7_RS01740"
                     /old_locus_tag="PSPA7_0370"
     CDS             376066..376764
                     /locus_tag="PSPA7_RS01740"
                     /old_locus_tag="PSPA7_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_012073913.1"
                     /db_xref="GI:501021245"
                     /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVS
                     PSSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALASASLALQPQRRSLPP
                     SHGTPSALREARTCYDHLAGELSVGVFARMLDAGWIEQEGRTVRLSATGEAGLAGLGI
                     DLVEARRRRRQFACACPDWSERKPHLGGALGAALLEACLRQGWLRPQDGSRALRVSPK
                     GRAGLRGLAERTAG"
     gene            complement(376778..377767)
                     /locus_tag="PSPA7_RS01745"
                     /old_locus_tag="PSPA7_0371"
     CDS             complement(376778..377767)
                     /locus_tag="PSPA7_RS01745"
                     /old_locus_tag="PSPA7_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter ATP-binding protein"
                     /protein_id="WP_012073914.1"
                     /db_xref="GI:501021246"
                     /translation="MSIEIRNVSKNFNAFKALDAINLDIQSGELVALLGPSGCGKTTL
                     LRIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMK
                     PKGERPGESAIKAKVHELLSMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLL
                     DEPFGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQI
                     GSPGEVYENPASDFVYHFLGDSNRLQLGDDQHLLFRPHEVSLSRSAVAEHRAAEVRDI
                     RPLGAITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
     gene            complement(377771..378637)
                     /locus_tag="PSPA7_RS01750"
                     /old_locus_tag="PSPA7_0372"
     CDS             complement(377771..378637)
                     /locus_tag="PSPA7_RS01750"
                     /old_locus_tag="PSPA7_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/thiosulfate transporter permease
                     subunit"
                     /protein_id="WP_012073915.1"
                     /db_xref="GI:501021247"
                     /translation="MSSASISAATASARRGHAGGRLTLIVLAWLVFALFLLLPLYVVL
                     SEALKQGFGTFFEAILEPDALAALKLTLLAVAISVPLNLLFGVAAAWCVSKFEFRGKS
                     ILVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSEHDIQIVFAVPGIVLATLFVTV
                     PFVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMG
                     EFGAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSES
                     RMSRLKSNADEE"
     gene            complement(378648..379466)
                     /locus_tag="PSPA7_RS01755"
                     /old_locus_tag="PSPA7_0373"
     CDS             complement(378648..379466)
                     /locus_tag="PSPA7_RS01755"
                     /old_locus_tag="PSPA7_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008055402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter CysT"
                     /protein_id="WP_003151763.1"
                     /db_xref="GI:489243566"
                     /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWE
                     QFWAIVSAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLP
                     FALPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQP
                     VLADIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIA
                     GNMPMKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
     gene            complement(379624..380622)
                     /locus_tag="PSPA7_RS01760"
                     /old_locus_tag="PSPA7_0374"
     CDS             complement(379624..380622)
                     /locus_tag="PSPA7_RS01760"
                     /old_locus_tag="PSPA7_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003151765.1"
                     /db_xref="GI:489243568"
                     /translation="MSLRRFALAALASALLSGPAAAATQLLNVSYDPTRELYQAYNAA
                     FIEHWKTQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELNKLGKLLPA
                     DWQARLPDNSTPYTSTIVFLVRKGNPKGIEDWGDLTKEGVEVITPNPKTSGGARWNFL
                     AAWAWAKKQYGSDEKARDYVQALYRHVPVLDTGARGSTITFVNNQIGDVLLAWENEAF
                     LAKKEQGGENFEIVVPSLSILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIA
                     AQNFYRPRNQKVAAEFAAQFPKLDLVTVDADFGGWKSAQPKFFNDGGIFDQIYQAQ"
     gene            complement(380798..380980)
                     /locus_tag="PSPA7_RS01765"
                     /old_locus_tag="PSPA7_0375"
     CDS             complement(380798..380980)
                     /locus_tag="PSPA7_RS01765"
                     /old_locus_tag="PSPA7_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003151767.1"
                     /db_xref="GI:489243570"
                     /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQI
                     ERKEKFRLQQPSVKQA"
     gene            complement(381137..383419)
                     /locus_tag="PSPA7_RS01770"
                     /old_locus_tag="PSPA7_0376"
     CDS             complement(381137..383419)
                     /locus_tag="PSPA7_RS01770"
                     /old_locus_tag="PSPA7_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012073916.1"
                     /db_xref="GI:501021248"
                     /translation="MNPRLSALRLSLAYLAVAIAWAFLSDHLLQNQVQDHDQLVFWMT
                     AKRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTG
                     RMFVSPGYAALVGLTPEELGDPIETWKKRLHPEEFATVLEAHRNHLQGLTDNLDHIYR
                     LRHKDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREG
                     VLVTDAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDV
                     WSGEIWNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHD
                     SLTGLPNRVLLRQRIEQALEDGKDRAVAGALLLIDLDHFKHINDSLGHTTGDMLLKEV
                     SKRLQHQLGERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYI
                     SASLGVSLYPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESA
                     LRHALDHDELRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIA
                     ALDNWVLKRACRQMREWQDRGVGLEFIAVNVSSRLFNRGGLEERIANALEESGLEPRY
                     LELEVTESAVMEDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQ
                     GFVAGLPGAVDDAAIARAIIALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYG
                     RPQPPETLRFDAPPVALPED"
     gene            383592..384770
                     /locus_tag="PSPA7_RS01775"
                     /old_locus_tag="PSPA7_0377"
     CDS             383592..384770
                     /locus_tag="PSPA7_RS01775"
                     /old_locus_tag="PSPA7_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_003151768.1"
                     /db_xref="GI:489243571"
                     /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDL
                     HPALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAEL
                     YKAEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQ
                     MAWIPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKL
                     SVKKWEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMA
                     QYRKLVIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQAL
                     KVIYEKRLALQQIWAKTSANGHDMLAAMKDWVHEAEASGIQSLKEFAAQLKTYSLRPA
                     "
     gene            384999..386384
                     /locus_tag="PSPA7_RS01780"
                     /old_locus_tag="PSPA7_0378"
     CDS             384999..386384
                     /locus_tag="PSPA7_RS01780"
                     /old_locus_tag="PSPA7_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:solute symporter"
                     /protein_id="WP_012073917.1"
                     /db_xref="GI:501021249"
                     /translation="MLLDYLIMLVYALAMLGLGWYGMRKARSQSDFLVAGRRLGPGLY
                     LGTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTV
                     TQVLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIV
                     IVYSVIGGMWSLTLTDIIQFVIKTIGIFLVLLPLSIDGAGGLGGMREALPAGFFDLGQ
                     IGLDTILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGTACALIG
                     AAARVLLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQE
                     DIYARFLRPGTTSDIRLSRCITLLMGVAMLALACLVNDVIAALSIAYNLLVGGLLVPI
                     VGALLWRRASPQGAIASIVVGCLAVVACMARDGLLANSPIVYGLLASLATFVVVSLAT
                     RPAAGLRAQPE"
     gene            386439..387395
                     /locus_tag="PSPA7_RS01785"
                     /old_locus_tag="PSPA7_0379"
     CDS             386439..387395
                     /locus_tag="PSPA7_RS01785"
                     /old_locus_tag="PSPA7_0379"
                     /EC_number="3.5.3.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="WP_012073918.1"
                     /db_xref="GI:501021250"
                     /translation="MSNDNPQPLDAAEIPRFAGIPTFMRLPAFTDPAAVRVGLIGVPW
                     DGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSL
                     RRIEGFYRQVHAAGTLPLSIGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGD
                     NPYTHGTPFRRAIEEGLLDPRRTVQIGIRGSVYSPNDDAFARECGIRVIHMEEFVELG
                     VEATLVEARRVVGDGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLD
                     LVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAARSA"
     gene            387462..388412
                     /locus_tag="PSPA7_RS01790"
                     /old_locus_tag="PSPA7_0380"
     CDS             387462..388412
                     /locus_tag="PSPA7_RS01790"
                     /old_locus_tag="PSPA7_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016254325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012073919.1"
                     /db_xref="GI:501021251"
                     /translation="MLGNLNDIDLRLLRTFCAIVEAGGFTAAQARLNTSLSRLSVLVR
                     DLEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDREALHL
                     GCVDGVIGQHCLPLPLAIRLFRQRAPEVRLNLHTRRPDELEHAVLEERLQLAVGAFHH
                     RLSGLCYQPLFREEQNLYCGRAHPFFARADDEPTLDEICAADYVGRGYMAENQRPHDL
                     RFRHGINAYTMEAIATLVFSGTYIGYLPTHYAANWVAEGRMRAIRPSQLAYDSEFHCV
                     TRQGHDERPTLSLFLSSLFEAQEQLGAQAPANMSGIARQL"
     gene            388525..389496
                     /locus_tag="PSPA7_RS01795"
                     /old_locus_tag="PSPA7_0381"
     CDS             388525..389496
                     /locus_tag="PSPA7_RS01795"
                     /old_locus_tag="PSPA7_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003104500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_003154582.1"
                     /db_xref="GI:489246416"
                     /translation="MDDLPSIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNS
                     VLWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLRQVLE
                     RGAVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKRMESELQR
                     LATTDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQ
                     VLQRIAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEG
                     EHSFGITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
     gene            390109..391491
                     /locus_tag="PSPA7_RS01800"
                     /old_locus_tag="PSPA7_0382"
     CDS             390109..391491
                     /locus_tag="PSPA7_RS01800"
                     /old_locus_tag="PSPA7_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_003154584.1"
                     /db_xref="GI:489246418"
                     /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRN
                     FYINTDNRNGSASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAG
                     KNGLDRQPGTVFPLESDGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGR
                     LLPVTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSASSRDSNKF
                     YYAGGDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGK
                     NGSRSGRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFP
                     FLNRGDGEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFATVGVPGLTFNTIYLSGDK
                     IKTARGDQSEWERDISLAYVIPDGTFKGLGFTWKNASFRSGLPAAGSSNNQRDQDENR
                     LIVSYTLPLL"
     gene            complement(391582..392688)
                     /locus_tag="PSPA7_RS01805"
                     /old_locus_tag="PSPA7_0383"
     CDS             complement(391582..392688)
                     /locus_tag="PSPA7_RS01805"
                     /old_locus_tag="PSPA7_0383"
                     /EC_number="3.5.3.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017002588.1"
                     /note="catalyzes the formation of carbamoylputrescine from
                     agmatine in the arginine decarboxylase pathway of
                     putrescine biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="WP_012073920.1"
                     /db_xref="GI:501021252"
                     /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQ
                     AAFTAVAKAIARFEPVTVCASAAQYENARARLDDTNIRVVEISTDDAWVRDTGPTFVI
                     DDQGDVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSI
                     HVDGEGTLITTEECLLNHNRNPHLSQAEIEGILRDHLAVDSIIWLPNGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDQDDPNYLRCQAALRILEESRDAKGRKLVVHKMPIPGPLY
                     ATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPKDAEARAILQRV
                     FPEHEVVMVPGREILLGGGNIHCITQQQPAPRKA"
     gene            complement(392750..393628)
                     /locus_tag="PSPA7_RS01810"
                     /old_locus_tag="PSPA7_0384"
     CDS             complement(392750..393628)
                     /locus_tag="PSPA7_RS01810"
                     /old_locus_tag="PSPA7_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="WP_003154588.1"
                     /db_xref="GI:489246422"
                     /translation="MSRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQE
                     LFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSI
                     AIIDADGSNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFP
                     ESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGR
                     EEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRR
                     PNLYGPLKTLDGSLES"
     gene            complement(393820..394455)
                     /locus_tag="PSPA7_RS01815"
                     /old_locus_tag="PSPA7_0385"
     CDS             complement(393820..394455)
                     /locus_tag="PSPA7_RS01815"
                     /old_locus_tag="PSPA7_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_003154590.1"
                     /db_xref="GI:489246424"
                     /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLSIYSVAE
                     RAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLERPVDHAGLRCWRDLSRIVEERM
                     LAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIF
                     SLAMELGDRVYALSVQRHGTIDARLAEEGMRVFDAYLGLYLPPFLEKRSEP"
     gene            complement(394516..395577)
                     /locus_tag="PSPA7_RS01820"
                     /old_locus_tag="PSPA7_0386"
     CDS             complement(394516..395577)
                     /locus_tag="PSPA7_RS01820"
                     /old_locus_tag="PSPA7_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_003154592.1"
                     /db_xref="GI:489246426"
                     /translation="MPRLSVLLFLAFAPWLAQAEETLRVYNWNDYIDPQVLEAFQKDT
                     GIRVEYHTFATAEELDRALRSGEPIDVAVPSHDTLPALLKDNLLRPLDFARLPNRSHL
                     DRQLLSKLAAVDPDNRHAIPYLWGAVGLAINTPQAEAAYGGPLPDSWSLLFDASQSQR
                     LKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAADALHGLRPNLRYVDSERYI
                     ADLEGGRLCVAMAWVGDALRAAKAGQPVSFTVPQEGSVLFIDNLVIPASAQHPQQALR
                     FIDYLMQPQVAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPP
                     EKLQPVLGEIWQAFRDAAH"
     gene            complement(395833..397209)
                     /locus_tag="PSPA7_RS01825"
                     /old_locus_tag="PSPA7_0387"
     CDS             complement(395833..397209)
                     /locus_tag="PSPA7_RS01825"
                     /old_locus_tag="PSPA7_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017520803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_012073921.1"
                     /db_xref="GI:501021253"
                     /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIER
                     NSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKR
                     PTAQLLMTMHELEGEPFFADPREVLRQVVEKFTEMELTIVAAFELEFYLIDQENVNGR
                     PQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFE
                     VNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDK
                     HGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWG
                     LDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLSNKVEPGAPIEG
                     NSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLE
                     YNWYLHTV"
     repeat_region   395843..397251
     gene            397488..398240
                     /locus_tag="PSPA7_RS01830"
                     /old_locus_tag="PSPA7_0388"
     CDS             397488..398240
                     /locus_tag="PSPA7_RS01830"
                     /old_locus_tag="PSPA7_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
                     /protein_id="WP_012073922.1"
                     /db_xref="GI:501021254"
                     /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIP
                     ALGELLDQATLLDSIDGLLFTGSPSNVEPRHYSGAASEPGTLHDPDRDATTLPLVRAA
                     IDAGIPVLGICRGFQEMNVAFGGSLHQKVHEAGTFMDHREPADQPLEVQYAPRHAMHV
                     QPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGV
                     QWHPEWQVLTNPNYLAIFQAFGKACGKRAGQR"
     gene            398281..399639
                     /locus_tag="PSPA7_RS01835"
                     /old_locus_tag="PSPA7_0389"
     CDS             398281..399639
                     /locus_tag="PSPA7_RS01835"
                     /old_locus_tag="PSPA7_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015479462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_012073923.1"
                     /db_xref="GI:501021255"
                     /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAE
                     KGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVI
                     HDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPV
                     GRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHG
                     DALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGRNIF
                     SNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTV
                     GLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERR
                     NLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLL
                     SV"
     gene            399717..401075
                     /locus_tag="PSPA7_RS01840"
                     /old_locus_tag="PSPA7_0390"
     CDS             399717..401075
                     /locus_tag="PSPA7_RS01840"
                     /old_locus_tag="PSPA7_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_024007709.1"
                     /db_xref="GI:566137275"
                     /translation="MTNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIW
                     DSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAI
                     ADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGV
                     SLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEEN
                     VAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYY
                     GNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALEN
                     IRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERF
                     TDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAV
                     LA"
     gene            401194..402294
                     /locus_tag="PSPA7_RS01845"
                     /old_locus_tag="PSPA7_0391"
     CDS             401194..402294
                     /locus_tag="PSPA7_RS01845"
                     /old_locus_tag="PSPA7_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003153287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine transporter"
                     /protein_id="WP_003153287.1"
                     /db_xref="GI:489245109"
                     /translation="MKRFGKTLLALTLAGTVAGMAQAADNKVLHVYNWSDYIAPDTLE
                     KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSK
                     LPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLV
                     FKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVT
                     YFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMV
                     AIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPS
                     EEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK"
     gene            402713..403810
                     /locus_tag="PSPA7_RS01850"
                     /old_locus_tag="PSPA7_0392"
     CDS             402713..403810
                     /locus_tag="PSPA7_RS01850"
                     /old_locus_tag="PSPA7_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_003153285.1"
                     /db_xref="GI:489245107"
                     /translation="MQHPIGKTLLVATLAAAIAGPVQAEKKSLHIYNWTDYIAPTTLK
                     DFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSK
                     LPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILF
                     EPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKEYKKAEEVLTKVRPYVSY
                     FHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMA
                     IPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAVPGARPLMDKSVSDSEEVYPPQ
                     AVLDKAYVSAVLPAKVLRLQTRTWTRIKTGK"
     gene            403867..405021
                     /locus_tag="PSPA7_RS01855"
                     /old_locus_tag="PSPA7_0393"
     CDS             403867..405021
                     /locus_tag="PSPA7_RS01855"
                     /old_locus_tag="PSPA7_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine/spermidine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_012073925.1"
                     /db_xref="GI:501021257"
                     /translation="MAIASGAYKKALEGSQQPKEVLVKIDRVTKQFDETLAVDTVSLT
                     INKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQS
                     YALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQR
                     VALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMT
                     MAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACP
                     QLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHPGHNWAQGTVYDIAYL
                     GGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
     gene            405018..405929
                     /locus_tag="PSPA7_RS01860"
                     /old_locus_tag="PSPA7_0394"
     CDS             405018..405929
                     /locus_tag="PSPA7_RS01860"
                     /old_locus_tag="PSPA7_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003160938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine/spermidine ABC transporter permease"
                     /protein_id="WP_003153281.1"
                     /db_xref="GI:489245103"
                     /translation="MKFANSLKKRMPGGRHAVIGVPFLWLFLFFLLPFAIVLKISLAE
                     ADVAIPPYTEIFAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFVSTLICLLV
                     GYPMAYAIARSSQSTQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGII
                     SEPLTILNTNVAVYIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKI
                     TVPLSKNGIIAGCMLVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASAL
                     AVVMLAILIIPIILFNKNQAKELEGKV"
     gene            406012..406881
                     /locus_tag="PSPA7_RS01865"
                     /old_locus_tag="PSPA7_0395"
     CDS             406012..406881
                     /locus_tag="PSPA7_RS01865"
                     /old_locus_tag="PSPA7_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003123857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine/spermidine ABC transporter permease"
                     /protein_id="WP_003153279.1"
                     /db_xref="GI:489245101"
                     /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSV
                     KWYVGLLDNTQLVSSVGRSLEIAFYTAFSSVILGTLAAFVLTRIPRFRGRTLFGGMVT
                     APLVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRE
                     LDLSIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGS
                     TTLPMEVFSAVRLGVKPEINAVASLILLSVSLFTFLAWYFTRQAEERRRRAIQQAMEE
                     TASDWQKGSPTPA"
     gene            complement(407064..409451)
                     /locus_tag="PSPA7_RS01870"
                     /old_locus_tag="PSPA7_0396"
     CDS             complement(407064..409451)
                     /locus_tag="PSPA7_RS01870"
                     /old_locus_tag="PSPA7_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003158441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin amidase"
                     /protein_id="WP_012073926.1"
                     /db_xref="GI:501021258"
                     /translation="MKRTLTVIAVAVAAAAAGAAWYLHAKQPVRSGSLALAHLQAPVD
                     VRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLSRGELAEVLGPRLVDTD
                     RLFRTLRIRDHAAAYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRP
                     FTPEDTLSIAGYMAYSFAAAFRTEPALTYVRDELGGDYLRIFDLDWHPQGVLTPSGAL
                     GAGDWQDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRSASGKPLLAGDPHIRFAAP
                     AVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLIAEKVNPDNP
                     NQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWA
                     FLESENPVLDAFYELNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKR
                     PEGVNPSFILDGSQGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYY
                     NLADRGQWLDAQLADRSVKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREAVDDAEGK
                     RLVEQLAAWKGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDNLIATRAIDSALP
                     RLAADADSPWWDDRRTERRESRADIVKAAWAASLAHLRGTLGNDPSGWLWGKAHTLTH
                     EHALGQQPLLRRLLNVGPFAAPGTHEVPNNLSAKIGPAPWPVTYGPSTRRLVDFADPT
                     HSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
     gene            409562..410614
                     /locus_tag="PSPA7_RS01875"
                     /old_locus_tag="PSPA7_0399"
     CDS             409562..410614
                     /locus_tag="PSPA7_RS01875"
                     /old_locus_tag="PSPA7_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012073928.1"
                     /db_xref="GI:501021260"
                     /translation="MQDDPSTSPLTHSATLRRLLYEAFDALGLDPTRVYRSVYRRTPL
                     PPPVLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEE
                     ALRSFVRFQHILSGGFAARLEVEGDSARLILDINYLGHASLRQQIECLMLLFLKLLAL
                     ISDDEFVAEHIEFRHPAPARLGEHRRLFGRLPLFSREHDALLFPAALLRRPSRNANPD
                     MHALLTRHAEEQSRELSENRLLNRVRYLVELRLGEGYGMRQCAAELGLGAGALQRALA
                     AGGASFRQVREEVRRQRAGEMLRAGSAIREVAKACGFAELSPFYRAFRRWYAAPPEQY
                     RARLAREERDYSTSGT"
     gene            complement(410593..411099)
                     /locus_tag="PSPA7_RS01880"
                     /old_locus_tag="PSPA7_0398"
     CDS             complement(410593..411099)
                     /locus_tag="PSPA7_RS01880"
                     /old_locus_tag="PSPA7_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012073929.1"
                     /db_xref="GI:501021261"
                     /translation="MSLRPTLALLAALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDL
                     ADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGN
                     VTDDQASKLIDRVEELQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEI
                     GRQVPLVE"
     gene            complement(411204..411815)
                     /locus_tag="PSPA7_RS01885"
                     /old_locus_tag="PSPA7_0400"
     CDS             complement(411204..411815)
                     /locus_tag="PSPA7_RS01885"
                     /old_locus_tag="PSPA7_0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase"
                     /protein_id="WP_049791992.1"
                     /db_xref="GI:908647978"
                     /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLTAYWWFEIRY
                     IRPFSEQTTLFSGDSLRLPAGLAGPGPIRLVHFWDPACPCNVGNQQHLGELIERFAGQ
                     GVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSE
                     GAVCTSSNSFIEPILEALLQGRPVNATHTLAVGCYCPWAGEKD"
     gene            411892..412833
                     /locus_tag="PSPA7_RS01890"
                     /old_locus_tag="PSPA7_0401"
     CDS             411892..412833
                     /locus_tag="PSPA7_RS01890"
                     /old_locus_tag="PSPA7_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003459215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012073930.1"
                     /db_xref="GI:501021262"
                     /translation="MSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRARHPDL
                     RARLGSMLVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLAC
                     DLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELALPQPWHLCGQSTGGAILLDYLL
                     HGGERPELGETILMAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPRFLDFLR
                     EHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGEADETVDWRHGLKVLREK
                     FDEPRILLLDEARHHLANESEGLRRRYFDFLSDALGA"
     gene            complement(412853..413605)
                     /locus_tag="PSPA7_RS01895"
                     /old_locus_tag="PSPA7_0402"
     CDS             complement(412853..413605)
                     /locus_tag="PSPA7_RS01895"
                     /old_locus_tag="PSPA7_0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073931.1"
                     /db_xref="GI:501021263"
                     /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAA
                     QKRYQDKLPPALYQTLVDNSNRRFAPAEVDRRALNGLRENLPDSANPLNFFESPLGRK
                     VVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVA
                     ADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRGLSDAELTQY
                     VSFAESSAGRSYYQAALAALKAGLAVDQSVAQ"
     gene            413723..414352
                     /locus_tag="PSPA7_RS01900"
                     /old_locus_tag="PSPA7_0403"
     CDS             413723..414352
                     /locus_tag="PSPA7_RS01900"
                     /old_locus_tag="PSPA7_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003148636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2OG-Fe(II) oxygenase"
                     /protein_id="WP_003148636.1"
                     /db_xref="GI:489240412"
                     /translation="MHINVDHPLLQRIVDELVDQGWSHQSVFMPERLTTRLAEECRSR
                     ACAGELTPAAIGRGDGQVIREGIRGDLTQWLEPAESAACDEYLGVMDSLRQALNASLF
                     LGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPG
                     RQLDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRDESPLLLP"
     gene            complement(414368..414922)
                     /locus_tag="PSPA7_RS01905"
                     /old_locus_tag="PSPA7_0404"
     CDS             complement(414368..414922)
                     /locus_tag="PSPA7_RS01905"
                     /old_locus_tag="PSPA7_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073932.1"
                     /db_xref="GI:501021264"
                     /translation="MFPTRSLLPYLLTSALLASGASQAAMEALDNHSLSQVTGQAGIN
                     LRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCAKAGDCPDGRGGNIPLGAAQLGLSLP
                     IFGVEQPTLALDVTTGSGGRQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLHIG
                     ENSIGRLELRDITDLRGTLKVRGH"
     gene            415187..415681
                     /locus_tag="PSPA7_RS01910"
                     /old_locus_tag="PSPA7_0405"
     CDS             415187..415681
                     /locus_tag="PSPA7_RS01910"
                     /old_locus_tag="PSPA7_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004352066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003148633.1"
                     /db_xref="GI:489240409"
                     /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWQAQGRIVALCPEV
                     AGGLPTPRPPAEIPGGQGGEVLDRLNQVLTVDGEDVSEAFLLGAEVAVQLVRRHDIRM
                     AVLKARSPSCGNLENYDGRFNGSRIAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGL
                     DAGG"
     gene            complement(415686..416378)
                     /locus_tag="PSPA7_RS01915"
                     /old_locus_tag="PSPA7_0406"
     CDS             complement(415686..416378)
                     /locus_tag="PSPA7_RS01915"
                     /old_locus_tag="PSPA7_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003142596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter"
                     /protein_id="WP_003148631.1"
                     /db_xref="GI:489240407"
                     /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGL
                     VLGFSVAVVRVTKVPLVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGI
                     LALTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLS
                     NSLISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQK
                     ALENRLTAPLRR"
     gene            complement(416452..417222)
                     /locus_tag="PSPA7_RS01920"
                     /old_locus_tag="PSPA7_0407"
     CDS             complement(416452..417222)
                     /locus_tag="PSPA7_RS01920"
                     /old_locus_tag="PSPA7_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010793552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012073933.1"
                     /db_xref="GI:501021265"
                     /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFN
                     FKQGGKLTGFETELGELLAAELKVRPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQR
                     RKVFDFSAPYTISSAQLIVRADETRQFKSLEDLKGLKLGVGQGTNYADLAKSVAGVNV
                     RTYPGAPEYLQDLASKRIDAALNDRLLIPFAIREARLPVKPGAAVGPVANMAIPYRKN
                     NPKFGEALDAALEKLKADGRFARLSEKWFGLDVSQPPK"
     gene            417514..417951
                     /locus_tag="PSPA7_RS01925"
                     /old_locus_tag="PSPA7_0408"
     CDS             417514..417951
                     /locus_tag="PSPA7_RS01925"
                     /old_locus_tag="PSPA7_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084345.1"
                     /db_xref="GI:489174814"
                     /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPAD
                     GATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFG
                     KGQTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
     gene            complement(418009..419238)
                     /locus_tag="PSPA7_RS01930"
                     /old_locus_tag="PSPA7_0409"
     CDS             complement(418009..419238)
                     /locus_tag="PSPA7_RS01930"
                     /old_locus_tag="PSPA7_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020306786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_003112947.1"
                     /db_xref="GI:489203860"
                     /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSG
                     DELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVF
                     NAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYG
                     SIGTQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQ
                     WMIGEKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEE
                     FASPLRGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPS
                     HPGKHRLLHIHANIPGVMSEINKVFADNGINVSGQYLQTNEKVGYVVIDVDAEYSDLA
                     LEKLQQVNGTIRSRVLF"
     gene            419442..420836
                     /locus_tag="PSPA7_RS01935"
                     /old_locus_tag="PSPA7_0410"
     CDS             419442..420836
                     /locus_tag="PSPA7_RS01935"
                     /old_locus_tag="PSPA7_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073934.1"
                     /db_xref="GI:501021266"
                     /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAI
                     VFPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDFNA
                     FDRTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMT
                     RNWVAGLKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPK
                     NLTAMVLGAPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPF
                     YALLEFEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISH
                     WTPYKNDISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGK
                     DEFFAKCATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVF
                     DPNGIMNPGKLFAE"
     gene            420928..421593
                     /locus_tag="PSPA7_RS01940"
                     /old_locus_tag="PSPA7_0411"
     CDS             420928..421593
                     /locus_tag="PSPA7_RS01940"
                     /old_locus_tag="PSPA7_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014872067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003148625.1"
                     /db_xref="GI:489240401"
                     /translation="MSYQHHYIDGTPIHFSLGKLVCVGRNYAEHARELNNPVPSEPLL
                     FIKPGSCVVPVGGGLSLPQARGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPAL
                     DLTLREVQAKLKEKGLPWELAKSFDGAGVLAPFVNADQFPDPTDIGIRLTINGEVRQD
                     GNSRDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLHSGDELVLELPGASRFET
                     RVL"
     gene            421749..422681
                     /locus_tag="PSPA7_RS01945"
                     /old_locus_tag="PSPA7_0412"
     CDS             421749..422681
                     /locus_tag="PSPA7_RS01945"
                     /old_locus_tag="PSPA7_0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_012073935.1"
                     /db_xref="GI:501021267"
                     /translation="MSLASKLPRFRWLLLAFVALVGVVLTVIMHWDDRAGLWWKESQA
                     SQQLRDESIWLPGYRVVIDAKPLQGLEEEETSDLAYNPATRTLFTVTGKRPLLVELSL
                     TGDVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTIFHVDPQTAELSTKSLAEFP
                     LGNLGKKNKGFEGIAWDRRQQRLLLSKERDPMTLFSWKSDGGPRLSGAMTALPSDDLY
                     MRNVSALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFISLLGGFNGLDSRIPRAEGV
                     AIDDDGTIYMVSEPNLFYVFRKKSGERLATSDAD"
     gene            422765..423115
                     /locus_tag="PSPA7_RS01950"
                     /old_locus_tag="PSPA7_0413"
     CDS             422765..423115
                     /locus_tag="PSPA7_RS01950"
                     /old_locus_tag="PSPA7_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003148621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073936.1"
                     /db_xref="GI:501021268"
                     /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAAD
                     DTPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTQVKLTGEVDRDL
                     VGREIDVEFVEVIK"
     gene            complement(423196..424230)
                     /locus_tag="PSPA7_RS01955"
                     /old_locus_tag="PSPA7_0414"
     CDS             complement(423196..424230)
                     /locus_tag="PSPA7_RS01955"
                     /old_locus_tag="PSPA7_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003148619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylpolyamine aminohydrolase"
                     /protein_id="WP_012073937.1"
                     /db_xref="GI:501021269"
                     /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRIRAVG
                     LGDVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLASGRSHDMLPIAWPTRRLRQTEP
                     DNIDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELAGGARSVFSLCRPPGHHA
                     AADYMGGYCFLNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIH
                     GDPRFEYPYFLGYADEKGKGVGEGYNCNYPLASGSDWATWSLALQAAIRQIQAYAPDV
                     LVVSLGVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFVMEGGYAVEEIGINAVN
                     VLQGFEGVHR"
     gene            complement(424246..425640)
                     /locus_tag="PSPA7_RS01960"
                     /old_locus_tag="PSPA7_0415"
     CDS             complement(424246..425640)
                     /locus_tag="PSPA7_RS01960"
                     /old_locus_tag="PSPA7_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_012073938.1"
                     /db_xref="GI:501021270"
                     /translation="MASERNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYM
                     VPLTMFTTYGVVTEMTGGRTAGAYLITLAAMLFTAFSYSFMVRKYPIAGSAYSYTSLS
                     FGPCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLAAIALVTLLNVI
                     GISSVAGMSNVIVGAQFVFALVFIAMAIKHLAGIPSLDFSLPFVGDGSQPGFTPLMAG
                     AAVLCLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSV
                     FQDAESAANEVMLAAGGQFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPR
                     RVFGGLSERFQTPVIAILVVSLISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSY
                     LLLDGRRAPRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLAWFAAGLAYLAFHTGG
                     FRRKAPSVTFSEQN"
     gene            complement(425722..426129)
                     /locus_tag="PSPA7_RS01965"
     CDS             complement(425722..426129)
                     /locus_tag="PSPA7_RS01965"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003148617.1"
                     /db_xref="GI:489240393"
                     /translation="MESAAPGQGLKALALRQGLDQAEEMLDAALSRQRWPAIQLGHFD
                     PFLTVYRVLTGETGLLESNRVLPRTTLGAAEMVPTVPKGTSPARAINPTRTLPETAMN
                     TITPRTAVPTHAAPRLFTTALSSDPTETPAVLP"
     gene            426476..427405
                     /locus_tag="PSPA7_RS01970"
                     /old_locus_tag="PSPA7_0418"
     CDS             426476..427405
                     /locus_tag="PSPA7_RS01970"
                     /old_locus_tag="PSPA7_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016263938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_033997975.1"
                     /db_xref="GI:730359076"
                     /translation="MSRAFTPRRLLLAVLLVALAALALLGQNFRVFDRAWFAVQEWRH
                     ADAWKERSIWLPDYRVRVEAQPIEGLSDDVSALTFDPDRRTLFTVTNQPAQIIELSLQ
                     GKVLRTIPLTGFGDAEAIEYISRGVYVITDEREQRLVKVRLEDDTRFIDAADAQQLSL
                     GIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAVHVVDDPGR
                     DRRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSLLRGMHGLKRSVP
                     QAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
     gene            complement(427435..429378)
                     /locus_tag="PSPA7_RS01975"
                     /old_locus_tag="PSPA7_0419"
     CDS             complement(427435..429378)
                     /locus_tag="PSPA7_RS01975"
                     /old_locus_tag="PSPA7_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003121730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073942.1"
                     /db_xref="GI:501021274"
                     /translation="MFKPLAVAVSLGCAALSSGANAYQYGEYAGETLERLITDYPGRY
                     RGTASFAGATELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKVLVLGAHYD
                     TYYGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVES
                     LDASQRANLLGMINLDSLVTGDRMYAHAGSNSVANPALGAYREQILRIARELDIPLFT
                     NPGLNAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTW
                     HDPAEDNKEVLTGAFGQERIDQRMRDFSRLLTRLVLELTNADLLASTASGGALARQME
                     DQLQRQHQALTRLHDRRWLTLLGSSRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRA
                     GVHLLGDYRYSEALTLGASLAFQRSRDKLDHGGRIEGDTWQLGLFGLYHDGGPQWLAG
                     ELNLGHTRYDSKRPVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGP
                     LAGLDYMRYRIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYA
                     SLRWVRELADGRLDDIDLTSRGDGRIRVADMGDVDKDFGRAQFGAQLAITEQLGIFAE
                     ANSRFAHSEGNQAGYSLGVNWQF"
     gene            429669..430394
                     /locus_tag="PSPA7_RS01980"
                     /old_locus_tag="PSPA7_0420"
     CDS             429669..430394
                     /locus_tag="PSPA7_RS01980"
                     /old_locus_tag="PSPA7_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_012073943.1"
                     /db_xref="GI:501021275"
                     /translation="MNIFREALLNRRLRKALARHGCRMASGVETLRDGTLVTLEPNVK
                     LGKAKIYSPALEIGAYTDVVSGCEFMEVASIGRFCSIAAGVVIGQPRRSHPMHWLSTH
                     AFTANPKLLRKPLQPEREATPARIGHDVWIGRDALILDGVEIGTGAVVGAQSLVNRDV
                     PPYAVVAGSPARVIRYRFEPELIERLLASRWWELPLDLLGELPLDDPRACVEALERQP
                     PKARQETRRLRIRHKPFAIEWLD"
     gene            complement(430431..430763)
                     /locus_tag="PSPA7_RS01985"
                     /old_locus_tag="PSPA7_0421"
     CDS             complement(430431..430763)
                     /locus_tag="PSPA7_RS01985"
                     /old_locus_tag="PSPA7_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073944.1"
                     /db_xref="GI:501021276"
                     /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALNGID
                     SVRKNAQRDGAFEVKPASNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAP
                     EAGLSDES"
     gene            complement(430887..431558)
                     /locus_tag="PSPA7_RS01990"
                     /old_locus_tag="PSPA7_0422"
     CDS             complement(430887..431558)
                     /locus_tag="PSPA7_RS01990"
                     /old_locus_tag="PSPA7_0422"
                     /EC_number="5.3.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019396260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase A"
                     /protein_id="WP_003148607.1"
                     /db_xref="GI:489240383"
                     /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALA
                     RHKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGA
                     ALTREKIVAAVARTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVY
                     REGVLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGV
                     QTLKA"
     gene            431817..433331
                     /locus_tag="PSPA7_RS01995"
                     /old_locus_tag="PSPA7_0423"
     CDS             431817..433331
                     /locus_tag="PSPA7_RS01995"
                     /old_locus_tag="PSPA7_0423"
                     /EC_number="4.3.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017001827.1"
                     /note="threonine deaminase; threonine dehydratase; in
                     Escherichia coli, IlvA is part of the isoleucine
                     biosynthetic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="WP_012073945.1"
                     /db_xref="GI:501021277"
                     /translation="MLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQVLLKREDL
                     QPVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRAVIVMPKTT
                     PEIKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTIAGQGTVAM
                     EILRQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGE
                     RVVLGQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITE
                     PAGALAVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGERREAIIAVT
                     IPERPGSFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREALVAYLREK
                     GFPVLDLTDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLTKLGGRWNI
                     SMFHYRNHGAADGRVVAGLQVPEDERQLIPQTLEAIGYPYWDETDNPAYQLFLG"
     gene            433450..433917
                     /locus_tag="PSPA7_RS02000"
                     /old_locus_tag="PSPA7_0424"
     CDS             433450..433917
                     /locus_tag="PSPA7_RS02000"
                     /old_locus_tag="PSPA7_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073946.1"
                     /db_xref="GI:501021278"
                     /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRSADAARIARG
                     FRRIRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLLLAG
                     RLARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
     gene            433968..435239
                     /locus_tag="PSPA7_RS02005"
                     /old_locus_tag="PSPA7_0425"
     CDS             433968..435239
                     /locus_tag="PSPA7_RS02005"
                     /old_locus_tag="PSPA7_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_012073947.1"
                     /db_xref="GI:501021279"
                     /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPADAPAGARW
                     LALDLERLAERPDSFAWPAGVDLLVNAAGVMSLDEASMARVQDSGARALFDLAAGHGA
                     KILQISALGAGEHPDVPFLASKAAADRHLLGLGIAALVLRPSLLLGPGGASSAWLERL
                     SPLPLIPLLDNRARLQPLHVDDLVGAVLALLRDWPERAQVIPLVGPQALTQGELLDRL
                     RRAQGWPRGRYLVPPAALLDALGGLGRRLGWRVLSPPMLKLVRQDNLADPAILQAACG
                     YRCAPLSSRLLGWPQAQNALASLLRPLMLAALVLIWLGTLVACLGPGYAWGLSILGEA
                     GIHGWPASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLVISLILPHYWY
                     DPYMAVGKNLVLMVATLWLLGGEPRAKEARG"
     gene            435236..435703
                     /locus_tag="PSPA7_RS02010"
                     /old_locus_tag="PSPA7_0427"
     CDS             435236..435703
                     /locus_tag="PSPA7_RS02010"
                     /old_locus_tag="PSPA7_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003157143.1"
                     /db_xref="GI:489249009"
                     /translation="MNLYLLLKTLHILSSTILFGTGLGSAYYALRAWRSGQLPVIAVT
                     FRHLVTADWLFIATTAVFQPLSGLAMVHVAGWPLTQGWLLWSLGLYVFAGLCWLPVVW
                     LQIRVRDMAESALREARPIEPLAHRYMRAWFILGWPAFIAFMAIFYLMVNKPV"
     gene            complement(435676..436917)
                     /locus_tag="PSPA7_RS02015"
                     /old_locus_tag="PSPA7_0426"
     CDS             complement(435676..436917)
                     /locus_tag="PSPA7_RS02015"
                     /old_locus_tag="PSPA7_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="WP_003157142.1"
                     /db_xref="GI:489249008"
                     /translation="MPHTAPAPGSLRPVVIVALVTALCLAGDSMLYIALPIYWREVGL
                     EALWQVGVLLSINRLIRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFL
                     AWVLLRGLWGIGWSFFRIGGLSAVVYCAADHQRGRAMGLYNGLYRLGSLVGMLLGGLL
                     VPVLGLPALALSFAILALLGLPLLAKGFVLPENPAGHARPPAATASTSVARLPPPRGL
                     VILSGFGTALLIQGVLAATLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPW
                     LAGRFGAWSDGPRGRQGYYVAALLAGALGFGLLSTALPILAWLALALLVMLVATALTT
                     LTDALAADVARAGDVVGFMTRYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAF
                     LLLALLWLRRTNPQTGLLTIR"
     gene            complement(436967..437620)
                     /locus_tag="PSPA7_RS02020"
                     /old_locus_tag="PSPA7_0428"
     CDS             complement(436967..437620)
                     /locus_tag="PSPA7_RS02020"
                     /old_locus_tag="PSPA7_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073949.1"
                     /db_xref="GI:501021281"
                     /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFY
                     ADYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMREVIEPIVLAKGEALLAEHRA
                     AGDRLVIITATNRFVTGPIAERLGVDTLIATECEMRDGRYTGQTFDVPCFQGGKVVRL
                     QRWLDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR"
     gene            437824..438303
                     /locus_tag="PSPA7_RS02025"
                     /old_locus_tag="PSPA7_0429"
     CDS             437824..438303
                     /locus_tag="PSPA7_RS02025"
                     /old_locus_tag="PSPA7_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003160931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="WP_003084400.1"
                     /db_xref="GI:489174870"
                     /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRE
                     TPEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLL
                     RLMSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
     gene            438327..440606
                     /locus_tag="PSPA7_RS02030"
                     /old_locus_tag="PSPA7_0430"
     CDS             438327..440606
                     /locus_tag="PSPA7_RS02030"
                     /old_locus_tag="PSPA7_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_012073950.1"
                     /db_xref="GI:501021282"
                     /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLD
                     TETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAET
                     GEERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEAT
                     GSIRGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIAL
                     FKQALEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQ
                     GALRQVVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVS
                     EELSPAMLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDL
                     IVDGYHGEVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTG
                     LLADVARAQERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTL
                     DIGGDKALSYFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPM
                     ISGTHELEEALHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSV
                     GSNDLTQYLLAVDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDP
                     AAAVLLMAMGFDSLSMNATNLPKVKWLLRQISLDKARDLLGQLLTFDNPQVIHSSLHL
                     ALRNLGLGRVINPAATVQS"
     gene            440724..441761
                     /locus_tag="PSPA7_RS02035"
                     /old_locus_tag="PSPA7_0431"
     CDS             440724..441761
                     /locus_tag="PSPA7_RS02035"
                     /old_locus_tag="PSPA7_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012073951.1"
                     /db_xref="GI:501021283"
                     /translation="MDERASKPPGLLPLSREDLEKTLRYALEIVSDGIWDWNIATNQV
                     SRSAGWYLMLGYPPNSLPESVDTWKGIIHPEDYPGVMASFQAYLDGESPEYCEEYRCR
                     TYSGDYLWISDRGRFVEFDERGEPRRMIGAHHEIHQRKLVELELQQRNEELFDWNLRL
                     EELVAERTEALHRVNQALALKMAEAQRLSEIDPLTGLYNRRKFEQCLHQEWMRRQRHG
                     RSTALVMIDIDHFKRINDLFGHSIGDSVLVDFGHLIAGELREVDVLARWGGEEFILLL
                     PETALEAAAALAERLRQRVRGQPFEVCGRLTASFGVGVLDDGETLDLLLCRVDDALYR
                     AKQRRDCVTCC"
     gene            complement(441766..442521)
                     /locus_tag="PSPA7_RS02040"
                     /old_locus_tag="PSPA7_0432"
     CDS             complement(441766..442521)
                     /locus_tag="PSPA7_RS02040"
                     /old_locus_tag="PSPA7_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073952.1"
                     /db_xref="GI:501021284"
                     /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFA
                     GRDLEAGGTWLGLGPAGRFAALTNVRDPSQPLGKRSRGELVADFLRDGGNPADYLARV
                     AERAADYSGFNLLVGDRHQLWHYNPRVGPPLLLPAGVYGLSNAALDSPWPKLLKARAA
                     LAERLAEPHPHALLELLADPQPATDGQLPDTGVGLATERLLSSVFIASPSYGTRASTA
                     LRVHADGSREIVERSFGPSGARLGEVSLVLPPD"
     gene            442643..443425
                     /locus_tag="PSPA7_RS02045"
                     /old_locus_tag="PSPA7_0433"
     CDS             442643..443425
                     /locus_tag="PSPA7_RS02045"
                     /old_locus_tag="PSPA7_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073953.1"
                     /db_xref="GI:501021285"
                     /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGD
                     VLTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIK
                     GPLLQKIIGVFAILVALQMTLDLKPRGRHEVPGKGGLTVAGAVIGWASAIFGIGGGSL
                     TVPFLSWRGVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALV
                     GIAATSMLFARFGARLAHRLSPRGLKRLFALLLFSVGVSFLI"
     gene            443449..444249
                     /locus_tag="PSPA7_RS02050"
                     /old_locus_tag="PSPA7_0434"
     CDS             443449..444249
                     /locus_tag="PSPA7_RS02050"
                     /old_locus_tag="PSPA7_0434"
                     /EC_number="2.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003128900.1"
                     /note="transfers the N-acyl diglyceride moiety to the
                     prospective N-terminal cysteine in prolipoprotein; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglyceryl transferase"
                     /protein_id="WP_012073954.1"
                     /db_xref="GI:501021286"
                     /translation="MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRF
                     DPSWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGL
                     LGVMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMV
                     FPNGGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEF
                     VRVPDAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA"
     gene            444458..445252
                     /locus_tag="PSPA7_RS02055"
                     /old_locus_tag="PSPA7_0436"
     CDS             444458..445252
                     /locus_tag="PSPA7_RS02055"
                     /old_locus_tag="PSPA7_0436"
                     /EC_number="2.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I6F1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_012073956.1"
                     /db_xref="GI:501021288"
                     /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFDLAAGFPL
                     VTTKKCHLKSIVHELLWFLQGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWP
                     APDGRHIDQIANLMTMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLS
                     CQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLRPGEFIWTGGDCHLYANHLEQADL
                     QLTREPLPLPSMKLNPEVKDLFDFRFEDFELVGYQAHPHIKAPVAV"
     gene            complement(445289..446665)
                     /locus_tag="PSPA7_RS02060"
                     /old_locus_tag="PSPA7_0437"
     CDS             complement(445289..446665)
                     /locus_tag="PSPA7_RS02060"
                     /old_locus_tag="PSPA7_0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase SAR1"
                     /protein_id="WP_012073957.1"
                     /db_xref="GI:501021289"
                     /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVE
                     GARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGR
                     FEQESKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPRHR
                     EEEWRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHEAQA
                     AARLRAGQRLIAELLVDVAACRRLVASAESAVQEATRDLHQQVRKREQACVEALLRLY
                     AFARDDARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVT
                     LGAAAALGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQT
                     RGHAALEAIRLETPEDRQWREGKLPEALRKARAHPEWSSLNGRRAGGGDRQEQIDALA
                     EHLADSGE"
     gene            complement(446658..448037)
                     /locus_tag="PSPA7_RS02065"
                     /old_locus_tag="PSPA7_0438"
     CDS             complement(446658..448037)
                     /locus_tag="PSPA7_RS02065"
                     /old_locus_tag="PSPA7_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073958.1"
                     /db_xref="GI:501021290"
                     /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEAVRQALAQGGSL
                     PRRILTRAHWLGRREGLLEAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPV
                     NVFWALASLLGLHLLTLLGWAIGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPAL
                     LVLLGRRRLARWGLGALVHGLWLLGLLAALALLLGLLATRRYGFVWETTILGSDTFVG
                     LTQALGALPALLGFPLPDAELIRASGDAALAGETARHAWAGWLVGVLLVYGVLPRLLL
                     GLFCLWRWKRGLAGLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSAQ
                     EAAGAVLVAVDDRRPWPPKLAEGIADAGILDDGQQRRRLLEQLTRYPPARLAIACDPR
                     RSPDRGSLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHAALERLQLPHGETSP
                     LAWLETGHD"
     gene            448225..448587
                     /locus_tag="PSPA7_RS02070"
                     /old_locus_tag="PSPA7_0439"
     CDS             448225..448587
                     /locus_tag="PSPA7_RS02070"
                     /old_locus_tag="PSPA7_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073959.1"
                     /db_xref="GI:501021291"
                     /translation="MKVVRRWPLALWLAMTGTLADELPDGSLLQRYGVAADQLPALTA
                     EPQPRKEKVEAPARFRLAPEQPLVTFGVKEPQDAEPTGNPSIDAMHERDRRLCRRIRQ
                     EALEKGKASPFDSYIGCP"
     gene            complement(448624..449781)
                     /locus_tag="PSPA7_RS02075"
                     /old_locus_tag="PSPA7_0440"
     CDS             complement(448624..449781)
                     /locus_tag="PSPA7_RS02075"
                     /old_locus_tag="PSPA7_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="WP_012073960.1"
                     /db_xref="GI:501021292"
                     /translation="MQSAFLRRQLGAACLLLAAGLASAASASADTGNVQRAIDWAQGQ
                     ASARHPAGQERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYIEPDLVMTRDGKMVA
                     RHDNELGLTTDVARHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIR
                     PGNARLDGTFEIPTLQEIIDLVKSLQISQQRSIGLYPEIKHGTHFQRLGLAMERPLVK
                     TLHRNGYLGPSAPVFIQSFEVNNLKELKRLTGIRLIQLYGSGQPYDQQATGGSLTYAE
                     MATAKGLRQVARYAYGVGPDKSYVIPRDANDNLGQPTRFVGDAHAAGLKVHPYTFRAE
                     NSFLPAEFRSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
     gene            450100..451086
                     /locus_tag="PSPA7_RS02080"
                     /old_locus_tag="PSPA7_0441"
     CDS             450100..451086
                     /locus_tag="PSPA7_RS02080"
                     /old_locus_tag="PSPA7_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049792067.1"
                     /db_xref="GI:908648053"
                     /translation="MAPPARAEARVPTAATDDWGRQPDSLMSGVPPRTLEASVGARGS
                     GSASSRLWIADTDFRLHDDIGFFIRRMLIRMEPSRPGTPLLLDDPTAMVARIQAGEIF
                     VSDATLATLLNQDLAASRAAVRNLRMSTRKDGQEVRGELLRKGRWRPLRMLTEIEPSG
                     PLEVTLIPRRIFVDGVEVTSSLAAASIEMSEVLKLKTRHMELVGNRIRVDLDGLFPPP
                     RLDFRVSRLALADGGLQLALGDPLDSLQWPALRAPDSYMFIEGGDIKMARTVLVKAYA
                     LFTSLSPERPLLFNLYDYRRQLQNGVIRLREDGMVQIAVSPVKAPAPLEARL"
     gene            451083..452126
                     /locus_tag="PSPA7_RS02085"
                     /old_locus_tag="PSPA7_0442"
     CDS             451083..452126
                     /locus_tag="PSPA7_RS02085"
                     /old_locus_tag="PSPA7_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073962.1"
                     /db_xref="GI:501021294"
                     /translation="MSRRPWGVPLLGCCLLAAGAAQAESAIDRQQRELALLREGWYRQ
                     VPPAPLPLPMRAAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPV
                     DFDRPQDMHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRV
                     RPFGVGPWLPLRLGGGVEVDAGSGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLD
                     RPGASLVGSAMRLDYRKVFPLLGIDGQVQEAWLDDQGLHLRFSQAPGRPSPVFSPPAV
                     AGPSFLWLQSGDLKIFEILITYAQVLLKTEKPEQVLTFNLRDYRKVLATGTTQVNEDG
                     TFFMQVPPYANPL"
     gene            452209..452715
                     /locus_tag="PSPA7_RS02090"
                     /old_locus_tag="PSPA7_0443"
     CDS             452209..452715
                     /locus_tag="PSPA7_RS02090"
                     /old_locus_tag="PSPA7_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003162105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_012073963.1"
                     /db_xref="GI:501021295"
                     /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVI
                     MGRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALVRAEEWAQAEDADELM
                     LIGGAQLYAEALPRAERLYLTRVGLAPEGDAFFPEIDDAGWRLASSIEHAAADDAPAY
                     AFEVWERR"
     gene            complement(452731..453183)
                     /locus_tag="PSPA7_RS02095"
                     /old_locus_tag="PSPA7_0444"
     CDS             complement(452731..453183)
                     /locus_tag="PSPA7_RS02095"
                     /old_locus_tag="PSPA7_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="WP_033998030.1"
                     /db_xref="GI:730359236"
                     /translation="MRIGLIADTHGLLRPEALERLRGCDQLIHAGDIGKPEILAELER
                     LAPLSVVRGNNDTQDWAADIPERLLLKIGRLTLYVLHDLKRLDLDPAAEGIDVVVAGH
                     SHKPLKEERDGVLYLNPGSAGPRRFSLPIGIGVLEVAGKKVEAQLITL"
     gene            complement(453342..454727)
                     /locus_tag="PSPA7_RS02100"
                     /old_locus_tag="PSPA7_0445"
     CDS             complement(453342..454727)
                     /locus_tag="PSPA7_RS02100"
                     /old_locus_tag="PSPA7_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004368469.1"
                     /note="high-affinity transporter for xanthine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine permease"
                     /protein_id="WP_004368469.1"
                     /db_xref="GI:490502372"
                     /translation="MSSLQSPSDASPRNDLVYGLDDRPSAPIALLAALQHLLAIIVPI
                     VTPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFV
                     GPLIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVV
                     LMIGLTLIKVGLISMGGGFSAMSDGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCA
                     IVIALAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSL
                     EAIGDVTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVI
                     QLTGVASRYIGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINIL
                     AGIQLDRRALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWF
                     LPESPAQRAEQ"
     gene            complement(454951..456789)
                     /locus_tag="PSPA7_RS02105"
                     /old_locus_tag="PSPA7_0446"
     CDS             complement(454951..456789)
                     /locus_tag="PSPA7_RS02105"
                     /old_locus_tag="PSPA7_0446"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003121741.1"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_012073964.1"
                     /db_xref="GI:501021296"
                     /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFT
                     QFVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIAD
                     SVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLASHGL
                     DLVDAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGS
                     TLATHADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIANFKAFENAMTLDIAMGGS
                     TNTILHLLAAAQEAEVPFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSIL
                     GELARGGLLHTDVATVHSPSMADAIARWDITQTRDEAVHTFFKAGPAGIPTQTAFSQN
                     TRWPSLDDDRAEGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGRA
                     KIFESQDAAVKGILGDEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCAL
                     LTDGRFSGGTSGLSIGHASPEAAAGGAIGLVQDGDKVLIDIPNRSINLLVSDEELAAR
                     RAEQDRKGWKPAAPRARRVSTALKAYALLATSADKGAVRNKALLDG"
     gene            complement(457117..458313)
                     /locus_tag="PSPA7_RS02110"
                     /old_locus_tag="PSPA7_0447"
     CDS             complement(457117..458313)
                     /locus_tag="PSPA7_RS02110"
                     /old_locus_tag="PSPA7_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019485881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_012073965.1"
                     /db_xref="GI:501021297"
                     /translation="MTLPSLRLKANAERRLRAGHLWVYSNEVDVAATPLNAFAAGDQA
                     VLEMANGKPLGVVALSPNNLICGRLISRDTKHVLDKSLLVHRINIALSLRERLFDKPF
                     YRLVYGDSDLLPGLVVDRFGDVLVVQLASAAMELRKDEVLAALLQVLKPAAVLWKNDS
                     SARDAEGLERYVANAYGEVPEWVALEENGVRFEAPVLAGQKTGWFYDHRMNRARLAPY
                     VQGKRVLDLFSYIGGWGIQAAAFGASEVMCVDASAFALDGVERNAALNGVAEKVACVE
                     GDVFEALRELKAADERFDVVIADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLSKDGIL
                     VSASCSMHLPENDLQDILIGSARHLDRNIQLLERGGQGPDHPVHLAIPETRYIKSLTC
                     RLLPNG"
     gene            complement(458386..458925)
                     /locus_tag="PSPA7_RS02115"
                     /old_locus_tag="PSPA7_0448"
     CDS             complement(458386..458925)
                     /locus_tag="PSPA7_RS02115"
                     /old_locus_tag="PSPA7_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_012073966.1"
                     /db_xref="GI:501021298"
                     /translation="MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSDKS
                     GEVRGWNHHQPADAFRVDGTFEDASLDDYDALLLPGGVVNSDQIRSLAKAQELVIRAE
                     QASKPVAVFCHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSS
                     RKPDDIPAFSRRFIDILAG"
     gene            459088..459966
                     /locus_tag="PSPA7_RS02120"
                     /old_locus_tag="PSPA7_0449"
     CDS             459088..459966
                     /locus_tag="PSPA7_RS02120"
                     /old_locus_tag="PSPA7_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009613908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073967.1"
                     /db_xref="GI:501021299"
                     /translation="MVQELTAEQIRQALQGISVPPQPQIMVDLQMEQVMPNPDLKNIA
                     RLISQDPGLSGALLKLVNSPFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSD
                     DTIVTLNRFWDTAQDVAMSCLSLAKRIGYESVDEAYALGLFHNCGIPLMLKRFPHYMA
                     VLEEAYAAASDERRVVDTENRVLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIF
                     GDESARDTQLKNLLAILKMAEHICGSHRILGNQPEDHEWNSIGALVLDYVGLTDYDFE
                     NLKSSILELGVGQGSY"
     gene            460025..460837
                     /locus_tag="PSPA7_RS02125"
                     /old_locus_tag="PSPA7_0450"
     CDS             460025..460837
                     /locus_tag="PSPA7_RS02125"
                     /old_locus_tag="PSPA7_0450"
                     /EC_number="3.2.2.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="WP_004368457.1"
                     /db_xref="GI:490502360"
                     /translation="MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVR
                     LSGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGM
                     SLRYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIM
                     DNAVVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTL
                     RDFVGGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR"
     gene            460914..461492
                     /locus_tag="PSPA7_RS02130"
                     /old_locus_tag="PSPA7_0451"
     CDS             460914..461492
                     /locus_tag="PSPA7_RS02130"
                     /old_locus_tag="PSPA7_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004365021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_012073968.1"
                     /db_xref="GI:501021300"
                     /translation="MSGNYLPRNTLVESLGHAMLKLSGWKIEGQLPALDKFVVIGAHH
                     TSNWDFVAFLAAKFVLRLNARWFGKHTLFNGPLGGLMRRWGGIPIQRHLKLNTVDQAI
                     QAFGEHREFMLIIAPEGTRKKVDRWRMGFYHIARGAGVPVVPAALDYENRRIVIGEPF
                     WPTGNEDADLRGLIGFYRPFIPKKPHYAFLGD"
     gene            461576..461920
                     /locus_tag="PSPA7_RS02135"
                     /old_locus_tag="PSPA7_0452"
     CDS             461576..461920
                     /locus_tag="PSPA7_RS02135"
                     /old_locus_tag="PSPA7_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_012073969.1"
                     /db_xref="GI:501021301"
                     /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTADAPPA
                     YAMIGDLLIARPFLIAATAIGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCL
                     GCTTSGYNHDES"
     gene            462190..463179
                     /locus_tag="PSPA7_RS02140"
                     /old_locus_tag="PSPA7_0453"
     CDS             462190..463179
                     /locus_tag="PSPA7_RS02140"
                     /old_locus_tag="PSPA7_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073970.1"
                     /db_xref="GI:501021302"
                     /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAKEQSKAEQGDKRGDE
                     LFAEFTRLRQAAETGEPQALFDFGAYFYQQQNYVSAREWWGKAAGAGMARAQIQLAML
                     YRDGDGGREDKTEAARWFRKAAEQGDAGAQNEMGVLYWRGEGVDQDRVKAGSWFERAA
                     ASGSEDAETNLGWFYLDDLQSDSAVPSSDEEAALLDRYAASREKAFQWFCKAASQGDA
                     RAQFKVGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESADQAAWYTRLENWV
                     HAALDGELSGIADCSGVADRRHSGRGVESAPSEPEAVEIGAEDAIQAAEAASQ"
     gene            complement(463292..463723)
                     /locus_tag="PSPA7_RS02145"
                     /old_locus_tag="PSPA7_0454"
     CDS             complement(463292..463723)
                     /locus_tag="PSPA7_RS02145"
                     /old_locus_tag="PSPA7_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157430.1"
                     /db_xref="GI:489249306"
                     /translation="MSLFRPLLIASTLALASGCASGLNSQQTAELEYYEARNLAVIEK
                     SPGTGAALGLLPGGGSFYGRSYGLGVVNLLFWPLSILWDPVSGYDASQRINYTATRVH
                     LEKLRQRDFDELQRLADNGALDGATLARKRQDVETKYRYAP"
     gene            complement(463875..465608)
                     /locus_tag="PSPA7_RS02150"
                     /old_locus_tag="PSPA7_0455"
     CDS             complement(463875..465608)
                     /locus_tag="PSPA7_RS02150"
                     /old_locus_tag="PSPA7_0455"
                     /EC_number="2.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_012073971.1"
                     /db_xref="GI:501021303"
                     /translation="MSFLNLPVRTLVAACSLTLLSLAAQADSLRGDARPPQQAAVATP
                     HPAATVAGLETLANGGNAFDAAVAIAAALAVAEPYGSGLGGGGFFLLRQAGAQPTYRF
                     LDARERAPKAAYADMYRRNGKVDPRLSVNGPLAAAIPGLPAALVELNGRYGRQPLADN
                     LVPAIRLAVDGVSVDRIYRDRASMRLEAMRKDPETARIFLDKGGIPDEWNLLRQPQLA
                     RTLERLGRYGRIGFYEGETADKLLAGVRAGGGVWSAADLRDYRVIERRPLEVKLANGR
                     ELISAPPPSAGGVALAQSLQMLEQLPWQKAEPVQRAHYVLEVLRRAYRDRGLLGDPDF
                     VANPLPRLLAPDYLKRLAAGIDPRRATPSAALPEAPAWREGDHTTHFAVIDAQGNAVA
                     ATLSVNLPFGAAFTVPGTGVVLNNEMDDFAADTQGANSYGLAGSQANAVAAGKRPLSS
                     MSPSFLESPTDFAAFGTPGGSRIPSMVLISMLQYFDGRPVGQWVAAPRYHHQYKPDVV
                     EYEPRAFSDAEAAELRRRGYQLKRLERSYGNQQVLYWDKRSGRVDAASDPRGIGYSAF
                     SPEMQAQPQTH"
     gene            complement(465736..465987)
                     /locus_tag="PSPA7_RS02155"
                     /old_locus_tag="PSPA7_0456"
     CDS             complement(465736..465987)
                     /locus_tag="PSPA7_RS02155"
                     /old_locus_tag="PSPA7_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003286306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_012073972.1"
                     /db_xref="GI:501021304"
                     /translation="MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGH
                     YDEPQCQQVCPVDCIPLDEANVESKDQLMEKYRKITGKA"
     gene            complement(466107..466586)
                     /locus_tag="PSPA7_RS02160"
                     /old_locus_tag="PSPA7_0457"
     CDS             complement(466107..466586)
                     /locus_tag="PSPA7_RS02160"
                     /old_locus_tag="PSPA7_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003162110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="WP_003084466.1"
                     /db_xref="GI:489174936"
                     /translation="MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPL
                     FSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLA
                     NMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR"
     gene            complement(466716..468308)
                     /locus_tag="PSPA7_RS02165"
                     /old_locus_tag="PSPA7_0458"
     CDS             complement(466716..468308)
                     /locus_tag="PSPA7_RS02165"
                     /old_locus_tag="PSPA7_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="WP_003154458.1"
                     /db_xref="GI:489246291"
                     /translation="MPVPDLFAEGLARGWKTYNGSRLDHDLELEADVVVVGTGAGGGT
                     TAEILSAAGLKVLLVEEGPLKTSSDFRMQEADAYPELYQEGIGRMSKDGAITILQGRA
                     VGGTTLINWTSSFRTPEPTLQHWAQVYGVKGHSAEDMAPWFEKMEQRLHVAPWALPPN
                     ANNDVIRLGCEKLGYHWKVIPRNVLGCWNLGYCGMGCPVNAKQSMLVTTIPATLDKGG
                     ELLYLARANRLLLEGDKVTGLECLGMDERCVAPNGRKVKVRARHYVLSGGGINTPAIL
                     LRSKAPDPSQRVGKRTFLHTVNFSAALFDRVINPFYGAPQSIYSDHFQWDDGVTGRMS
                     YKLEVPPLQPSLASVLLGGFGSDNALRMEQLPHTNMMLALLRDGFHPDSAEGSVGLRG
                     DDTPVLDYRMTDYTWDGIRRAFHTMAEIQFAAGAREVRPVHSDAHNAKNLQEAREIID
                     GLRLEIYRTRLGSAHVMGGCAMGEDPAVAVADSLGRHHHLQNLSIHDGSLFPTSIGAN
                     PQLSVYGLTAQLASALAERLKA"
     gene            complement(468363..468911)
                     /locus_tag="PSPA7_RS02170"
                     /old_locus_tag="PSPA7_0459"
     CDS             complement(468363..468911)
                     /locus_tag="PSPA7_RS02170"
                     /old_locus_tag="PSPA7_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073974.1"
                     /db_xref="GI:501021306"
                     /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVAASLTGCSAEKP
                     ASGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLT
                     RQLFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAM
                     MAWYARPEAWAHCGYPGPPKIA"
     gene            complement(468966..470396)
                     /locus_tag="PSPA7_RS02175"
                     /old_locus_tag="PSPA7_0460"
     CDS             complement(468966..470396)
                     /locus_tag="PSPA7_RS02175"
                     /old_locus_tag="PSPA7_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I6C8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coniferyl aldehyde dehydrogenase"
                     /protein_id="WP_012073975.1"
                     /db_xref="GI:501021307"
                     /translation="MVADIAYLQQSQQEINQLEALFARQRAAYLAQPMPDATQRVEWL
                     KALRDLLFKEQKALIEAIDRDFSARSADETLLAEIMPSLHGIHYAAKRVKKWMKPARR
                     AVGLQFQPASAQVVYQPLGVVGVIVPWNYPLFLSIGPLTGALAAGNRVMIKMSESTPA
                     TGRLLKDLLARIFPEDQVAVVLGEVDVGVAFSKLPFDHLLFTGATSVGKHVMRAAAEN
                     LTPVTLELGGKSPAIVSDSVPMKDAAERIAFGKSLNAGQTCVAPDYVLVPSRRVEEFV
                     SRYKEVVQGFFPRLSDNPDYTAIINERQLGRLQGYLDDAREKGATLVPLFAEGQQRRL
                     PQTLLLNVSDDMKVMQEEIFGPLLPVIPYERLEDALAYVNQRPRPLALYYFGYDKAQQ
                     RRVLHETHSGGVCLNDTLLHVAQDDIPFGGVGPSGMGHYHGHEGFLTFSKAKGVFSKP
                     RFNAARMIYPPYGKSIQKLVYKLFVR"
     gene            470685..471332
                     /locus_tag="PSPA7_RS02180"
                     /old_locus_tag="PSPA7_0462"
     CDS             470685..471332
                     /locus_tag="PSPA7_RS02180"
                     /old_locus_tag="PSPA7_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012073976.1"
                     /db_xref="GI:501021308"
                     /translation="MAPRIKTRDRIAQASLELFNAQGERSVTTNHIATHLGISPGNLY
                     YHYPNKQAIIAELFAEYESHVESFLRLPEGRGVTVDDKTFYLEALLAAMWRYRFLHRD
                     LEHLLESDPELAARYRAFAQRCLVNAKAIYRGFTEAGILRMNETQLEALTLNAWIILT
                     SWVRFLCTTLDLDGDLSEAQLRRGIYQVLALESGHIEAQAQEAVDGISERLYVPL"
     gene            complement(471317..471727)
                     /locus_tag="PSPA7_RS02185"
                     /old_locus_tag="PSPA7_0461"
     CDS             complement(471317..471727)
                     /locus_tag="PSPA7_RS02185"
                     /old_locus_tag="PSPA7_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_012073977.1"
                     /db_xref="GI:501021309"
                     /translation="MDLKLRHNPVLDDIDCEAILAIHAAVGWDRRMPAAELRTLYQHS
                     SYYLLAERDGRLVGLLRAEEETPIRVWLAEIAVLPGAQSSGVGAALLRRFAEDHRGAF
                     LFTDATLGTEAFFRRHGIHIQQVLEKTPRDQSGT"
     gene            complement(471790..472788)
                     /locus_tag="PSPA7_RS02190"
                     /old_locus_tag="PSPA7_0463"
     CDS             complement(471790..472788)
                     /locus_tag="PSPA7_RS02190"
                     /old_locus_tag="PSPA7_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012073978.1"
                     /db_xref="GI:501021310"
                     /translation="MSALPTFQPAWWLPNPHLQTLWSPFFRRGPALERQRERLWLADG
                     DFIDLDWAGPHEADTPLVLALHGLTGSSSSHYILGLQRALLERGWASVALNWRGCSGE
                     PNRLPRGYHSGVSDDLAEVVAHLRARRPQAPLYAVGYSLGGNVLLKYLGETAGDCPLL
                     GGVAVSVPFRLDECADRIGLGFSRVYQAHFMKAMLAYVQDKQRLFGEQGQAEGLAALQ
                     RLGPLEGMRTFWDFDGRVTAPLHGFADARDYYRRASSRYYLPDIRTPSLIIHSSDDPF
                     VFARSLPERSELAPCTELELHARGGHVGFVGGSPRQPSYYLERRIPDWLEARLRQR"
     gene            complement(472823..473386)
                     /locus_tag="PSPA7_RS02195"
                     /old_locus_tag="PSPA7_0464"
     CDS             complement(472823..473386)
                     /locus_tag="PSPA7_RS02195"
                     /old_locus_tag="PSPA7_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073979.1"
                     /db_xref="GI:501021311"
                     /translation="MNPASHAIRQRLLALGERSVAQPASDWQGDIALPAELERFYREV
                     GPLDCTLETAGNPFFLPSLARLWQRQAGYRWHGLSGERLAGWQDDWLVVADQGADPFI
                     LETGSGRVLFDLHGGAWDPAPCFDDLWQMAASLACFGQVWSDAGEDILLEDCSVAPCY
                     RHQLIDELLPILGSRQRAEDLADEFGW"
     gene            complement(473383..473985)
                     /gene="rsmD"
                     /locus_tag="PSPA7_RS02200"
                     /old_locus_tag="PSPA7_0465"
     CDS             complement(473383..473985)
                     /gene="rsmD"
                     /locus_tag="PSPA7_RS02200"
                     /old_locus_tag="PSPA7_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154452.1"
                     /note="catalyzes the methylation of 16S rRNA at position
                     G966; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_003154452.1"
                     /db_xref="GI:489246285"
                     /translation="MRKPTAKVPGRHGGQGQLRIIGGEWRSRRFAFPDGPGLRPTPDR
                     VRETLFNWLAPHIEGARVLDPFAGSGALFLEALSRGAREGLALDTNGEAVAALRSHLD
                     VLKCGTAQLILGDALRYLENQVASAFDLVFLDPPFHQNLLQDACRLLETRGWLNAEAW
                     IYTESESPPSSLGLPGNWRLHREKKAGNVHYALWQRSDRP"
     gene            complement(473985..475472)
                     /locus_tag="PSPA7_RS02205"
                     /old_locus_tag="PSPA7_0466"
     CDS             complement(473985..475472)
                     /locus_tag="PSPA7_RS02205"
                     /old_locus_tag="PSPA7_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_012073980.1"
                     /db_xref="GI:501021312"
                     /translation="MSERTGLRYGLLGLIVIALLAALAYFVARPTQTPAAAHAAAVAE
                     NQLQSLKDVAKQAPVHRKLDIQEWKTAEGAKVLFVEAHELPMFDLRLTFAAGSSQDAG
                     SPGLSMLTNAMLNEGVPGKDTTAIAAGFEDLGASFSNGSYRDMAVAGLRSLSDADKRT
                     QALKLFEQVIGQPTFPEEALARIKNQVLAGFEYQKQNPGKLAGLELFKRLYGEHPYAH
                     SSDGDEKSIPPITREQLQAFHKKAYAAGNVVIALVGDLSRQDAEAIAAEVSKALPQGP
                     ALAKTAQPEAPKPGLTHIEFPSEQTHLMLAQLGIDRQDPDYAALYLGNQILGGGGFGT
                     RLMDQVREKRGLTYGIYSGFTAMQARGPFMINFQTRAELSEGALKLVQDIVRDYLANG
                     PTQKELDDAKRELAGSFPLSTASNADIVGQLGAIGFYGLPLDYLESFLKQVEGLSVEQ
                     VRTAMARHLDADAFVIVSAGPSVPQKPLPPPTAKPAQQPSGVPEH"
     gene            complement(475465..476835)
                     /locus_tag="PSPA7_RS02210"
                     /old_locus_tag="PSPA7_0467"
     CDS             complement(475465..476835)
                     /locus_tag="PSPA7_RS02210"
                     /old_locus_tag="PSPA7_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003102860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_003102860.1"
                     /db_xref="GI:489193527"
                     /translation="MKTPARRRVGLLLASLCLPLFAQAAETQPTHEFSLDNGLKVIVR
                     EDHRAPVVVSQLWYRIGSSYETPGLTGLSHALEHMMFKGSRKLGPGEASRVLRDLGAE
                     ENAFTTDDYTAYYQVLARDRLPVALEMEADRMAHLSLPADQFKSEIEVIKEERRLRTD
                     DNPNALAFERFKAAAYPASGYHTPTIGWMADLQRMTIDDLRHWYESWYAPNNATLVVV
                     GDVTADEVKTLAKRYFGEIPWRQLPPARKPLELAEPGERRLKLYVRTQLPNLIMGFNV
                     PSLGSSENPREVNALRLIGALLDGGYSARLASRLERGEELVAGASTYYDAFNRGDSLF
                     VLSATPNVQKGKTLEQVEAGLWKQLDDLKQNPPSAAEIERVRAQMIAGMVYEKDSIAA
                     QASSIGQLESVGLSWKLIDQDLEALKAVTPDDIQKAARTYFTPSRLTLAQVLPVKAEE
                     KEARHE"
     gene            476983..478326
                     /locus_tag="PSPA7_RS02215"
                     /old_locus_tag="PSPA7_0468"
     CDS             476983..478326
                     /locus_tag="PSPA7_RS02215"
                     /old_locus_tag="PSPA7_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_012073981.1"
                     /db_xref="GI:501021313"
                     /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSET
                     TAAEQRTPADDAAPALTEQPVRQEPPAAVPAMPPAPVAEAPLAHGEPATPVEAPVAQP
                     EPILAAEPEPEPEPEPEPEPAAPVAAAPAASEPAARPGFFARLRQGLSKTSASIGEGM
                     ASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKAL
                     QEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAA
                     GDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGR
                     LHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQARQFNLAVELTGLA
                     LTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
     gene            478323..478994
                     /locus_tag="PSPA7_RS02220"
                     /old_locus_tag="PSPA7_0469"
     CDS             478323..478994
                     /locus_tag="PSPA7_RS02220"
                     /old_locus_tag="PSPA7_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015649769.1"
                     /note="ATP-binding protein of an ATP-binding cassette
                     transporter; when bound to FtsX, FtsEX localizes to the
                     cell division site and plays a role in the assembly or
                     stability of the septal ring under low-salt growth
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsE"
                     /protein_id="WP_012073982.1"
                     /db_xref="GI:501021314"
                     /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTL
                     LRLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVAGNIAL
                     PLQILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLL
                     ADEPTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIAD
                     REDEA"
     gene            478994..480001
                     /locus_tag="PSPA7_RS02225"
                     /old_locus_tag="PSPA7_0470"
     CDS             478994..480001
                     /locus_tag="PSPA7_RS02225"
                     /old_locus_tag="PSPA7_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_003156186.1"
                     /db_xref="GI:489248037"
                     /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFGAYLESHRAS
                     LVDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDL
                     KTSEDQGQDLRERIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVIS
                     VTPKQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLT
                     LLLVVGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAY
                     SLNWLNGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAP
                     R"
     gene            480115..480969
                     /locus_tag="PSPA7_RS02230"
                     /old_locus_tag="PSPA7_0471"
     CDS             480115..480969
                     /locus_tag="PSPA7_RS02230"
                     /old_locus_tag="PSPA7_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoH"
                     /protein_id="WP_003084510.1"
                     /db_xref="GI:489174981"
                     /translation="MTTSLQPVHALVPGANLEAYVHSVNSIPLLSPEQERELAERLFY
                     QQDLEAARQMVLAHLRFVVHIAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRL
                     VSFAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNEEVHRVAE
                     SLGVEPREVREMESRLTGQDMAFDPAADADDESAYQSPAHYLEDHRYDPARQLEDADW
                     SDSSSANLHEALEGLDERSRDILQQRWLSEEKATLHDLAEKYNVSAERIRQLEKNAMS
                     KLKGRILA"
     gene            481034..481639
                     /locus_tag="PSPA7_RS02235"
                     /old_locus_tag="PSPA7_0472"
     CDS             481034..481639
                     /locus_tag="PSPA7_RS02235"
                     /old_locus_tag="PSPA7_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003156185.1"
                     /db_xref="GI:489248036"
                     /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWREQV
                     LAPLADNALTLRELHDAVDGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEE
                     QLSLQRASALKPGSAPQPLSAGLEGQLGDKPIVALSMIPDGRVGAERLLASLGQPRLR
                     LQLAQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPLK"
     gene            482023..482908
                     /locus_tag="PSPA7_RS02240"
                     /pseudo
     CDS             482023..482908
                     /locus_tag="PSPA7_RS02240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003299032.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            483442..484791
                     /locus_tag="PSPA7_RS02245"
                     /old_locus_tag="PSPA7_0474"
     CDS             483442..484791
                     /locus_tag="PSPA7_RS02245"
                     /old_locus_tag="PSPA7_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-aminohexanoate-dimer hydrolase"
                     /protein_id="WP_012073984.1"
                     /db_xref="GI:501021316"
                     /translation="MKRIKIALGFTSLERGCREFNLTQVLEISTLPASLEKKGLNRMI
                     KKYTNKKIVIVLSAALVILTATYIGSKGVRFWKLHTLFNSNKINENFRSMPDMFESLP
                     VIKDSETNQFQTELANMPVSFSFQGRQILFDDWIKSSNTTGIIVFSNDRIAYERYFQG
                     NSSQSLAIGWSLSKSIMSLLIGMAVDDGSIHSLLDPVNLYAPQLSTSGYAGVSLRDVL
                     EMSSGIAFNEDYGDPDSDINQLGRTIALGGSVNETVSSLRRGDAPGRVHHYVSADTQV
                     LGMVLLGSTGMGPSKFMSKRLWSKLGAECKGEWLTDDKGTELAFGGVNLCLRDFARIG
                     LLYLRNGKSLNGNQIVSSAWVTASTKPRSDHLRPGRFKESGEPNLGYGYQWWIPEGME
                     GEFLAIGVYGQFIYVNPKRGVVIAKTSAYSNYNVDGISMEHEAIAAFRAISRTVGVK"
     gene            484794..485777
                     /locus_tag="PSPA7_RS02250"
     CDS             484794..485777
                     /locus_tag="PSPA7_RS02250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003156166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_003156166.1"
                     /db_xref="GI:489248016"
                     /translation="MDLTTEHILDFEWRPLQNYLRDRGIPTPPIETSQQLRSDRLYNW
                     IVSKGYSGEEGLNLGTYYHISDYGVIGLALQCAENVVDLLKVIRAYVKLFNRDIADVR
                     VNAGEHYEVEVHVLVNFKPEWTAASRQFHVNVIASASYKLMMDLLGTDFPISALTVPV
                     YISDKTNYEHFFSLPVSHELSEIVFKFPAQQMSKTLVTANPAVFQSALAMASETFNAL
                     LEIEMGGLRQRIELFLESIPDCYPSLVTTAKHLRMNERTIRRRLADEGCSYRQIVDTA
                     RKSRAISLLLNSSIPVERISDILGYSEPACFRHAFRRWTGKSTTSFRNKSH"
     gene            485809..486297
                     /locus_tag="PSPA7_RS02255"
     CDS             485809..486297
                     /locus_tag="PSPA7_RS02255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003124674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041025275.1"
                     /db_xref="GI:751334177"
                     /translation="MNYNNRNNQIQAMIAETQFDAYVLGYIAKARTNSAPDESLRIEA
                     EGSAMLAGLISDSCRKRRTPTPPFPYLLLQIAHEALDRTKSNLAKARDTSRADSSCLE
                     ILNQAVWDTAVAMDNISEFVEPDQGSVSLIKKLVEFAQKSGTKEGQALALQALAVLGV
                     NY"
     gene            complement(486779..488374)
                     /locus_tag="PSPA7_RS02260"
                     /old_locus_tag="PSPA7_0476"
     CDS             complement(486779..488374)
                     /locus_tag="PSPA7_RS02260"
                     /old_locus_tag="PSPA7_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VgrG protein"
                     /protein_id="WP_012073986.1"
                     /db_xref="GI:501021318"
                     /translation="MSIRCDLRFTFTAGAGAGADAFEVVEFHLVESLSETFHLDVQLS
                     CANPAVDFGQILDRPALLTIWQGGQPVRYVHGSVTSFQQGNTGFRRTRYRAIVEPRLA
                     RLQLASDWRIFQALSVPDIATAVLKKHAITLDYEQKVTNPHAPREYCVQAGGTDYHFV
                     ERIMREEGFFYGFLHNAEGHRLIHCDRLWIFGKQPGLPVEYNPQAGGDRPGPALRSFT
                     YGENVRTARQTQRDYNFKNPLYNQQTKRAGEGEGEGEGEEIYCDEFGRVKVQFPWDRE
                     GRHDEHSSCWIRVSQKIAGALWGHMAIPRIGQEVIISNFDGDPDQPVITGRSFNANQR
                     PPYELPRHKTRMPLKSQTHKGEGFNELRFEDEAGQEEILIHAQEDQNNIVNHDETTFV
                     GHDRKEQVEHDEIIDIGHDRTETVGNDEQVTIGQDRRHDIDRDDYLTIERNHTITTGK
                     TAPNRWATTAATRPPPTNGWRLAGTWSNGWRAMRCWKRASQLSSARALSSYRLVKSSA
                     CTAPAEPSRCTTEASHWRGSPSP"
     gene            complement(488633..489331)
                     /gene="mtgA"
                     /locus_tag="PSPA7_RS02265"
                     /old_locus_tag="PSPA7_0477"
     CDS             complement(488633..489331)
                     /gene="mtgA"
                     /locus_tag="PSPA7_RS02265"
                     /old_locus_tag="PSPA7_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I6B7.2"
                     /note="glycosyltransferase; polymerizes glycan strands in
                     the peptidoglycan; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan transglycosylase"
                     /protein_id="WP_034082385.1"
                     /db_xref="GI:730724220"
                     /translation="MLRSLLRRLFKYLLWFMAASVVLVAVLRWVPPPGTMVMLERKVG
                     SWVDGQPIDLQRDWRSWEQLPDSLKVAVIAGEDQHFAEHHGFDLPAIQQALAHNERGG
                     SIRGASTLSQQVAKNVFLWSGRSWLRKGLEAWFTLLIETLWTKQRILEVYLNSAEWGP
                     GVFGAQAAARYHFGLDAERLSRAQASQLAAVLPSPLKWSAARPGPYVRQRAAWIRQQM
                     WQLGGEDYLLRLER"
     gene            489401..489778
                     /locus_tag="PSPA7_RS02270"
                     /old_locus_tag="PSPA7_0478"
     CDS             489401..489778
                     /locus_tag="PSPA7_RS02270"
                     /old_locus_tag="PSPA7_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012073988.1"
                     /db_xref="GI:501021320"
                     /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEHLAVFQTGVH
                     YQLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIITP
                     FGGVSFLAGWLCLGLAAWRLGNA"
     gene            489881..490081
                     /locus_tag="PSPA7_RS02275"
                     /old_locus_tag="PSPA7_0479"
     CDS             489881..490081
                     /locus_tag="PSPA7_RS02275"
                     /old_locus_tag="PSPA7_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003110013.1"
                     /note="with ThiF, ThiG, and ThiO catalyzes the formation
                     of the thiazole moiety of thiamine pyrophosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="WP_003156175.1"
                     /db_xref="GI:489248026"
                     /translation="MQIQLNGEAFELPDAQSVADLLARLELGGRRVAVELNLDIVPRS
                     QHASTALKDGDRVEIVHAIGGG"
     gene            490135..490932
                     /locus_tag="PSPA7_RS02280"
                     /old_locus_tag="PSPA7_0480"
     CDS             490135..490932
                     /locus_tag="PSPA7_RS02280"
                     /old_locus_tag="PSPA7_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_012073989.1"
                     /db_xref="GI:501021321"
                     /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGA
                     EIVTVAVRRTNIGQNPGEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDG
                     HNLVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAV
                     MPLAGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTA
                     IAHARDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
     gene            491023..491757
                     /locus_tag="PSPA7_RS02285"
                     /old_locus_tag="PSPA7_0481"
     CDS             491023..491757
                     /locus_tag="PSPA7_RS02285"
                     /old_locus_tag="PSPA7_0481"
                     /EC_number="2.1.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="WP_003156179.1"
                     /db_xref="GI:489248030"
                     /translation="MSDTPQSPAQDSLAEHDEARPMRTVKSFVMRAGRMTEGQQRGLD
                     LGWPKFGLELSDEVQDFDAIFGRQAPRTFEIGFGMGHSTLEMAAAAPDLDFIGVEVHK
                     PGVGALLNGLLTQGLGNVRVYSCDALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRR
                     IVQPEFAELVRRKLKVGGVLHMATDWEPYAEHMLDVMSAAPGYRNQAEDGRFVPRPQE
                     RPVTKFERRGERLGHGVWDLKFERVD"
     gene            491920..493266
                     /locus_tag="PSPA7_RS02290"
                     /old_locus_tag="PSPA7_0482"
     CDS             491920..493266
                     /locus_tag="PSPA7_RS02290"
                     /old_locus_tag="PSPA7_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003100968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003114884.1"
                     /db_xref="GI:489205847"
                     /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGN
                     ADGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVLDSRNMAAYQALLTPGTQALL
                     QANPDYHLRVFPTRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSG
                     QEAIWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTL
                     FYYKYKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDT
                     NGMATADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDL
                     LRYELHRVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPI
                     NYYDVPLVSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
     gene            complement(493279..493536)
                     /locus_tag="PSPA7_RS02295"
                     /old_locus_tag="PSPA7_0483"
     CDS             complement(493279..493536)
                     /locus_tag="PSPA7_RS02295"
                     /old_locus_tag="PSPA7_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084524.1"
                     /db_xref="GI:489174996"
                     /translation="MKPIKHLYLHFTDGQRLSLRFPRQQDDPAEVARSIRQQLDTPYL
                     SVEVDGDLLLIPRDSIKYLQISPAPARLDDDGTLRGAELIV"
     gene            complement(493598..493921)
                     /locus_tag="PSPA7_RS02300"
                     /old_locus_tag="PSPA7_0484"
     CDS             complement(493598..493921)
                     /locus_tag="PSPA7_RS02300"
                     /old_locus_tag="PSPA7_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084525.1"
                     /db_xref="GI:489174997"
                     /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQ
                     RIGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGM
                     IADRS"
     gene            complement(494002..495156)
                     /locus_tag="PSPA7_RS02305"
                     /old_locus_tag="PSPA7_0485"
     CDS             complement(494002..495156)
                     /locus_tag="PSPA7_RS02305"
                     /old_locus_tag="PSPA7_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016561517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HemN family oxidoreductase"
                     /protein_id="WP_012073990.1"
                     /db_xref="GI:501021322"
                     /translation="MTQAAPFQLPPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAY
                     VDALLADLEQDLRHVHGRRLGSIFFGGGTPSLFSAKALGRLLEGVERRVGFADGIEIT
                     LEANPGTFEQAKFADYRRLGINRLSIGVQSFQADKLQALGRIHDGDEAVRAADMARQA
                     GFDNFNLDLMHGLPGQSLDDALADLRQALALAPTHLSWYQLTMEPNTVFWSQPPELPE
                     DDILWDIQEAGQALLDEHGYRQYETSAYARDGLRARHNLNYWSFGDFLGIGAGAHAKL
                     SAPDGRIVRTWKTRLPKDYLNPQKAFQAGERPLEAADLPFEFMMNVLRLVDGVPAALY
                     PQRTGQPLAALADACAAARDAGLLAEDPQRLRPSERGQLFLNDLLQHFLP"
     gene            complement(495278..495871)
                     /locus_tag="PSPA7_RS02310"
                     /old_locus_tag="PSPA7_0486"
     CDS             complement(495278..495871)
                     /locus_tag="PSPA7_RS02310"
                     /old_locus_tag="PSPA7_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017520108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-triphosphate diphosphatase"
                     /protein_id="WP_012073991.1"
                     /db_xref="GI:501021323"
                     /translation="MIKLEQLVLASHNAGKLKELQAMLGASVKVRSIGEFSQVEPEET
                     GLSFVENAILKARNAARISGLPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAK
                     LLEALKDVPDAGRGAQFVSVLALVRHADDPLPILCEGIWEGRILREARGAHGFGYDPL
                     FWVPERDCSSAELAPEEKNRLSHRARAMALLKQRLGL"
     gene            complement(495868..496287)
                     /locus_tag="PSPA7_RS02315"
                     /old_locus_tag="PSPA7_0487"
     CDS             complement(495868..496287)
                     /locus_tag="PSPA7_RS02315"
                     /old_locus_tag="PSPA7_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073992.1"
                     /db_xref="GI:501021324"
                     /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNV
                     ASAVGLVRSKAQGVINVVPMEKGKPVEASVTGSARDLTGKVIPLEFRRVSEEGAIYNL
                     AQFPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
     gene            complement(496417..497037)
                     /locus_tag="PSPA7_RS02320"
                     /old_locus_tag="PSPA7_0488"
     CDS             complement(496417..497037)
                     /locus_tag="PSPA7_RS02320"
                     /old_locus_tag="PSPA7_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="WP_003155370.1"
                     /db_xref="GI:489247213"
                     /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLE
                     IDPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRV
                     GKTCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLR
                     MRVLDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRSLAV"
     gene            complement(497045..498184)
                     /gene="metX"
                     /locus_tag="PSPA7_RS02325"
                     /old_locus_tag="PSPA7_0489"
     CDS             complement(497045..498184)
                     /gene="metX"
                     /locus_tag="PSPA7_RS02325"
                     /old_locus_tag="PSPA7_0489"
                     /EC_number="2.3.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017520111.1"
                     /note="Catalyzes the conversion of acetyl-CoA and
                     L-homoserine to CoA and O-acetyl-L-homoserine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-acetyltransferase"
                     /protein_id="WP_003155371.1"
                     /db_xref="GI:489247214"
                     /translation="MPTVFPDDSVGLVSPQTLHFNEPLELTSGKSLAEYDLVIETYGE
                     LNATQSNAVLICHALSGHHHAAGYHSAEDRKPGWWDSCIGPGKPIDTRRFFVVALNNL
                     GGCNGSSGPASINPATGKVYGADFPMVTVEDWVHSQARLADRLGIRQWAAVVGGSLGG
                     MQALQWTISYPERVRHCLCIASAPKLSAQNIAFNEVARQAILSDPEFLGGYFQEQGVI
                     PKRGLKLARMVGHITYLSDDAMGAKFGRVLKTEKLNYDLHSVEFQVESYLRYQGEEFS
                     TRFDANTYLLMTKALDYFDPAAAHGDDLVRTLEGVEADFCLMSFTTDWRFSPARSREI
                     VDALIAAKKNVSYLEIDAPQGHDAFLMPIPRYLQAFSGYMNRISV"
     gene            complement(498274..500241)
                     /locus_tag="PSPA7_RS02330"
                     /old_locus_tag="PSPA7_0490"
     CDS             complement(498274..500241)
                     /locus_tag="PSPA7_RS02330"
                     /old_locus_tag="PSPA7_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003459259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="WP_003155372.1"
                     /db_xref="GI:489247215"
                     /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAK
                     LERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFH
                     DPRAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTSDPEGMAQAFAQVAKTKA
                     LPVEQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALG
                     SEPELTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDV
                     LWDDLSGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRL
                     DRLEALLCERIVAQKEALLENAVLGQVLGLLHNSQHLLRLRLEKVEEQRALLDDKQRD
                     SGQLLFELTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRR
                     NLNGSLTTVGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDA
                     PQLRVQRYQHELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLYQRLREE
                     TERWAGDALLPLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAEELQEQM
                     REAGDILRQLRRPSPLQRQAKVVNLPGSQRA"
     gene            complement(500349..500645)
                     /locus_tag="PSPA7_RS02335"
     CDS             complement(500349..500645)
                     /locus_tag="PSPA7_RS02335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009615233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031628111.1"
                     /db_xref="GI:685886652"
                     /translation="MSFYRWDGEDLLLDCHLQPKASRDEFAGLHGERLKIRLTAPPVE
                     GKANAHLLAFLGKAFGVAKSLVSLESGELNRQKRVRIRRPTRLPEELGIAARPA"
     gene            complement(500642..501235)
                     /locus_tag="PSPA7_RS02340"
                     /old_locus_tag="PSPA7_0492"
     CDS             complement(500642..501235)
                     /locus_tag="PSPA7_RS02340"
                     /old_locus_tag="PSPA7_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003155373.1"
                     /db_xref="GI:489247216"
                     /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFI
                     VRATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIW
                     SIIAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGG
                     LDISPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
     gene            complement(501246..502067)
                     /locus_tag="PSPA7_RS02345"
                     /old_locus_tag="PSPA7_0493"
     CDS             complement(501246..502067)
                     /locus_tag="PSPA7_RS02345"
                     /old_locus_tag="PSPA7_0493"
                     /EC_number="1.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003142635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_012073993.1"
                     /db_xref="GI:501021325"
                     /translation="MSTPRIAFIGAGNMAASLIGGLRAQGVPAERIRASDPGAEQRAK
                     IAGEFAIDVVESNAEAVTGADVVVLAVKPQAMKAVCQALAPALQAEQLIVSIAAGIPC
                     ASLEAWLGQPRPVVRCMPNTPALLRQGASGLYANAQVSAVQREQAGQLLSAVGIALWL
                     DDEAQIDAVTAVSGSGPAYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALS
                     SDAGPAELRRRVTSPNGTTEAAIKSFQANGFEALVEQALNAASQRSAELAEQLGQ"
     gene            complement(502079..502771)
                     /locus_tag="PSPA7_RS02350"
                     /old_locus_tag="PSPA7_0494"
     CDS             complement(502079..502771)
                     /locus_tag="PSPA7_RS02350"
                     /old_locus_tag="PSPA7_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003155374.1"
                     /db_xref="GI:489247217"
                     /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVR
                     EAHAAGLRDFGENYLQEALGKQAELADLSLNWHFIGPIQSNKTRPIAEHFQWVHSVDR
                     LKIAQRLSEQRPAGLPPLNICLQVNVSGEASKSGCAPEDLPALAEAVKLLPNLRLRGL
                     MAIPEPTVERAAQHAAFARLRELLLGLNLGLDTLSMGMSDDLEAAIAEGATWVRIGTA
                     LFGARDYGAPTS"
     gene            502986..504020
                     /locus_tag="PSPA7_RS02355"
                     /old_locus_tag="PSPA7_0495"
     CDS             502986..504020
                     /locus_tag="PSPA7_RS02355"
                     /old_locus_tag="PSPA7_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017938554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching mobility protein"
                     /protein_id="WP_003084552.1"
                     /db_xref="GI:489175024"
                     /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEH
                     KQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSK
                     VLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIED
                     PIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAA
                     ETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGR
                     VAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENA
                     REKAKIPENF"
     gene            504200..505348
                     /locus_tag="PSPA7_RS02360"
                     /old_locus_tag="PSPA7_0496"
     CDS             504200..505348
                     /locus_tag="PSPA7_RS02360"
                     /old_locus_tag="PSPA7_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003115634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilU"
                     /protein_id="WP_033999672.1"
                     /db_xref="GI:730363629"
                     /translation="MEFEKLLRLMVEKGGSDLFITAGVPPSMKVNGRVMPVTKTPLSP
                     EQTRETVLGVMNEQQRRDFAENHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETN
                     IPTLDELKLPEILKKLALTKRGLVIFVGATGTGKSTSLAAMIGYRNKNSTGHIISIED
                     PIEYIHQHQGCIVTQREVGLDTDSFEVALKNTLRQAPDVIMIGEVRSRETMDHAVAFA
                     ETGHLCLATLHANNANQALERIIHFFPADRHGQVWMDLSLNLKAIVAQQLVPTPDGKG
                     RRAVIEVLLNTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYQLYTQGEITYED
                     ALAHADSANDLRLMIKLGSESDADHLSSMTQGLSLEITDDDPAGRRFR"
     gene            complement(505356..506255)
                     /locus_tag="PSPA7_RS02365"
                     /old_locus_tag="PSPA7_0497"
     CDS             complement(505356..506255)
                     /locus_tag="PSPA7_RS02365"
                     /old_locus_tag="PSPA7_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012073995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_012073995.1"
                     /db_xref="GI:501021327"
                     /translation="MSAGHEHSFAQTNETRLKWALLLTGSFLVAEVVGGILTGSLALI
                     SDAAHMLTDAMALVIALAAINIAKRPTNDRLTYGYHRFEILAAAFNAILLFGVAFYIL
                     YAAYERLSQPAEIQSVGMLVIAVLGLLVNLASMRLLAPAQGNSLNVKGAYLEVWSDML
                     GSLGVIVAAIVIRVTGWAWVDSLVAVLIGFWVLPRTWILLRESLHVLLEGVPKEIQLA
                     ELREALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPNQVDAEALLGTVKALLHDRY
                     EIEHSTLQLETSACAQAEEPLAY"
     gene            506408..506812
                     /locus_tag="PSPA7_RS02370"
                     /old_locus_tag="PSPA7_0498"
     CDS             506408..506812
                     /locus_tag="PSPA7_RS02370"
                     /old_locus_tag="PSPA7_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003155375.1"
                     /db_xref="GI:489247218"
                     /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGL
                     FFIGWIVDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGALGVHRMYMGKWITGII
                     YLFTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
     gene            507054..508427
                     /locus_tag="PSPA7_RS02375"
                     /old_locus_tag="PSPA7_0499"
     CDS             507054..508427
                     /locus_tag="PSPA7_RS02375"
                     /old_locus_tag="PSPA7_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004365040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-synthase"
                     /protein_id="WP_003157911.1"
                     /db_xref="GI:489249800"
                     /translation="MTSDSRPAVLDLIGNTPLVRVTRFDTGPCTLFLKLESQNPGGSI
                     KDRIGVAMIEAAERDGRLRPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSTE
                     KVLHLRAMGAEVHITRSDVGKGHPEYYQDVAARLAQDIPGAFFADQFNNPANPLAHEC
                     GTGPELWAQTGHDLDAVVVGVGSSGTLTGLTRFFQKVQPDLEMVLADPQGSIMAEYSR
                     SGTLGTPGSWAVEGIGEDFVPAIADLSSVRHAYSIGDEESFAMARELLRVEGIPGGSS
                     TGTLLAAALRYCREQTEPKRVVSFVCDTGTRYLSKIYNDQWMTDQGLLQRKHYGDLRD
                     IIARRFEEGRVISVGPDDTLLTAFQRMRLADVSQLPVLDNGKLVGVIDESDILLGVHA
                     DAPRFRDAVSSAMNAAPETLAPGASLGELQAVLDRGLVAIVADASGFHGLITRFDLLN
                     HLRRKLT"
     gene            508424..509608
                     /locus_tag="PSPA7_RS02380"
                     /old_locus_tag="PSPA7_0500"
     CDS             508424..509608
                     /locus_tag="PSPA7_RS02380"
                     /old_locus_tag="PSPA7_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="WP_012073996.1"
                     /db_xref="GI:501021328"
                     /translation="MSQHDQNPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYI
                     QESPGVHKGLDYGRSHNPTRWALERCVADLEGGAQAFAFASGLAAISSVLELLDAGSH
                     IVSGNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLSAFEAALTPETRMIWVETPSNPL
                     LRLTDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIG
                     GIAIVGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQW
                     LERQPQVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSL
                     AESLGGVESLIEHPAIMTHASIPAETRAELGIGDSLIRLSVGVEALEDLQADLAQALA
                     KI"
     gene            complement(509855..511126)
                     /locus_tag="PSPA7_RS02385"
                     /old_locus_tag="PSPA7_0501"
     CDS             complement(509855..511126)
                     /locus_tag="PSPA7_RS02385"
                     /old_locus_tag="PSPA7_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004365041.1"
                     /note="Catalyzes the reversible hydrolysis of the amide
                     bond within dihydroorotate. This metabolic intermediate is
                     required for the biosynthesis of pyrimidine nucleotides;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_012073997.1"
                     /db_xref="GI:501021329"
                     /translation="MTISIRGARVIDPASGLDQVGDLHIEAGRIVAIGAAPAGFSAQK
                     TLDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDT
                     PAVAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASN
                     RILRRALEYAATFDLTVIFTSQDPDLAEGGLAHEGPTASFLGLAGIPETAETVALARN
                     LLLVEQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLY
                     HVQPPLRTRADREALREAVKSGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLP
                     LALTLVQDGLLDLPTLLARLAHGPAQALRLPAGRLAVGQTADLVLFDPQGSTLAGESW
                     YSKGQNSPFIGHCLPGRVRYTLVDGHLTHEG"
     gene            complement(511123..512127)
                     /gene="pyrB"
                     /locus_tag="PSPA7_RS02390"
                     /old_locus_tag="PSPA7_0502"
     CDS             complement(511123..512127)
                     /gene="pyrB"
                     /locus_tag="PSPA7_RS02390"
                     /old_locus_tag="PSPA7_0502"
                     /EC_number="2.1.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004346615.1"
                     /note="catalyzes the transfer of the carbamoyl moiety from
                     carbamoyl phosphate to L- aspartate in pyrimidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_003157750.1"
                     /db_xref="GI:489249633"
                     /translation="MPTDAKRPLQLNDQGQLRHFISLDGLPRELLTEILDTADSFLEV
                     GARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETL
                     TDTLRNLEAMAADMFVVRHSDSGAAHFIAEHVSPNVAVINGGDGRHAHPTQGMLDMLT
                     IRRHKGNFEQLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPRTLLPVGLEEQYG
                     VRVFTNADEGLKDVDVVIMLRLQRERMQGGLLPSEGEFFRLYGLTEKRLKLARPDAIV
                     MHPGPINRGVEIESAVADGAQSVILNQVTYGIAIRMAVLSMAMSGQNTQRQLEQEDAE
                     "
     gene            complement(512151..512663)
                     /locus_tag="PSPA7_RS02395"
                     /old_locus_tag="PSPA7_0503"
     CDS             complement(512151..512663)
                     /locus_tag="PSPA7_RS02395"
                     /old_locus_tag="PSPA7_0503"
                     /EC_number="2.4.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UYL3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein PyrR"
                     /protein_id="WP_003157749.1"
                     /db_xref="GI:489249632"
                     /translation="MSLPNPAELLPRMASDLRAHLAERGIERPRYVGIHTGGIWVAEA
                     LLKALGNEEPLGTLDVSFYRDDFTRNGLHPQVRPSALPFEIDGQHLVLVDDVLMSGRT
                     IRAALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVKLVGPAPLA
                     LERKVLSPAS"
     gene            complement(512764..513198)
                     /locus_tag="PSPA7_RS02400"
                     /old_locus_tag="PSPA7_0504"
     CDS             complement(512764..513198)
                     /locus_tag="PSPA7_RS02400"
                     /old_locus_tag="PSPA7_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UYL4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase"
                     /protein_id="WP_003157748.1"
                     /db_xref="GI:489249631"
                     /translation="MAADKPLRLLLGFDYGTRQIGVAVGQAVTGQARELCVLKAQNGV
                     PDWNRVEALIKEWQPDAIVVGLPLNMDGSPSEMSERAEKFGRRLNGRFNLPVFTHDER
                     LTTYAAKGERLAQGQRDGYRERPVDALAAALLLEGWLAEHPN"
     gene            complement(513198..513767)
                     /locus_tag="PSPA7_RS02405"
                     /old_locus_tag="PSPA7_0505"
     CDS             complement(513198..513767)
                     /locus_tag="PSPA7_RS02405"
                     /old_locus_tag="PSPA7_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UYL5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012073998.1"
                     /db_xref="GI:501021330"
                     /translation="MKQSSPTYLKHHFLIAMPHMADPNFAQTVTYLVEHNDQGAMGLV
                     INRPSGLNLAEVLEQLKPDVLPPARCQHIEIYNGGPVQTDRGFVLHPSGLAYQSTLEL
                     GELAMSTSQDVLFAIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPADPAILF
                     DLPAEERLSAAAACLGVNLSLLTAQAGHA"
     gene            complement(513816..514709)
                     /locus_tag="PSPA7_RS02410"
                     /old_locus_tag="PSPA7_0506"
     CDS             complement(513816..514709)
                     /locus_tag="PSPA7_RS02410"
                     /old_locus_tag="PSPA7_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003162015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein TonB"
                     /protein_id="WP_003157746.1"
                     /db_xref="GI:489249629"
                     /translation="MNAAVLKSPSAVAGVRPADRLGFTLFIAAILHVALILGVGFSMP
                     APSQISKTLEITLATFKSDKTPEKADYLAQMNQQGSGTLEHKAAPKTTEVAPFQDNQV
                     KKVAPPATPKQARSEEAPKAAVTTTRQRQQKAPSKTQAQKAEQVAKPAPQFDSSQLSA
                     EIASLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKEDWRKKIERIGNLNYPDEA
                     RRQKLYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQRIVRLAAPYAPFSGDLAD
                     IDRLEIIRTWRFERGDRLSSK"
     gene            complement(514845..515798)
                     /locus_tag="PSPA7_RS02415"
                     /old_locus_tag="PSPA7_0507"
     CDS             complement(514845..515798)
                     /locus_tag="PSPA7_RS02415"
                     /old_locus_tag="PSPA7_0507"
                     /EC_number="6.3.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthetase"
                     /protein_id="WP_012073999.1"
                     /db_xref="GI:501021331"
                     /translation="MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDL
                     YQKAGVARGRMRPLKVFNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYL
                     LEQAERAGALVVNRPQSLRDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIIL
                     KPLDGMGGSSIFRHREGDPNLSVILETLTRHGSQQIMAQRYLPEIKDGDKRILMIDGE
                     AVPYCLARIPAQGETRGNLAAGGRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVI
                     GDYLTEINVTSPTCIREIDQAFDTRIGDKLMDAIAAQLAAR"
     gene            516053..516460
                     /locus_tag="PSPA7_RS02420"
                     /old_locus_tag="PSPA7_0508"
     CDS             516053..516460
                     /locus_tag="PSPA7_RS02420"
                     /old_locus_tag="PSPA7_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003148848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003148848.1"
                     /db_xref="GI:489240626"
                     /translation="MEQQSDGLKVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDAL
                     AKIADTHPNIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIV
                     GSDQYLTKPFSKEELLGAIKAHVPSFTPLDAAS"
     gene            516507..516872
                     /locus_tag="PSPA7_RS02425"
                     /old_locus_tag="PSPA7_0509"
     CDS             516507..516872
                     /locus_tag="PSPA7_RS02425"
                     /old_locus_tag="PSPA7_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010795388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein PilH"
                     /protein_id="WP_003084587.1"
                     /db_xref="GI:489175059"
                     /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQE
                     KPDVVLMDIVMPGLNGFQATRQLTKDAETSAIPVIIVTTKDQETDKVWGKRQGARDYL
                     TKPVDEETLLKTINAVLAG"
     gene            516922..517458
                     /locus_tag="PSPA7_RS02430"
                     /old_locus_tag="PSPA7_0510"
     CDS             516922..517458
                     /locus_tag="PSPA7_RS02430"
                     /old_locus_tag="PSPA7_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003148849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein PilI"
                     /protein_id="WP_003148849.1"
                     /db_xref="GI:489240627"
                     /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGG
                     RFFVAPMGEVGEVLHEPRYTQLPGVKTWVRGVANVRGRLLPIMDLCGFLGTELSPLRK
                     QRRVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWL
                     VFSPHALAQHQGFLDVAI"
     gene            517544..519592
                     /locus_tag="PSPA7_RS02435"
                     /old_locus_tag="PSPA7_0511"
     CDS             517544..519592
                     /locus_tag="PSPA7_RS02435"
                     /old_locus_tag="PSPA7_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P42257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012074000.1"
                     /db_xref="GI:501021332"
                     /translation="MKKINAGNLFAGMRSSSVIAGLFIVLIVSIVLLFANFAYLNTQS
                     NHDKQYIGHAGELRVLSQRIAKNATEAAAGKGEAFKLLKDARNDFEKRWNILVNGDES
                     TSLPPSPEAVKPQMDVVQQDWDGLRKNADSILASEQTVLSLHQVASTLAETIPQLQVE
                     YEEVVDILLENGAPADQVAVAQRQSLLAERILGSVNKVLAGDENSVQAADSFGRDASL
                     FGRVLKGMQEGNAAMSISKVTNAEAVDRLNEIAELFEFVSGSVDEILETSPDLFQVRE
                     AANHIFSVSQTLLDKASRLADGFENLAGGRSINLFAGYVLGALALASIILIGLVMVRE
                     TNRRLAETAEKNDRNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQ
                     LRELVETINQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMAVSIDQVS
                     ANASESSAVAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDI
                     VSLINDIADQTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVK
                     TIQTDTNEAVISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQ
                     ASSAGHISNTMNVIQEITSQTSAGTTATARSIGNLAKMASEMRNSVSGFKLPEGVEQA
                     "
     gene            519653..520528
                     /locus_tag="PSPA7_RS02440"
                     /old_locus_tag="PSPA7_0512"
     CDS             519653..520528
                     /locus_tag="PSPA7_RS02440"
                     /old_locus_tag="PSPA7_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016252883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_003148852.1"
                     /db_xref="GI:489240630"
                     /translation="MQANGVWSLQPLADMSAAEFRDWQVLLENRTGVVLNEQRRTFLQ
                     TSLTARMRELGIGDYHSYYRQVTDGPRGAVEWAILLDRLTVQETRFFRHPPSFELLER
                     YLGERLGREGMPRPWALWSVGCSSGEEPYSMAMCAAQALRGWQRGDFFGVTGTDISLH
                     ALQRARAANYPARKLEQLPAEMVERYCERQADGSFSVKTILTGRVCCARLNVLDLAKA
                     PWSGMDVIFCQNLLIYFRRWRRREILNRLAERLAPGGLLVIGVGEVVDWSHPELEPVA
                     DERVLAFTRKGYSGT"
     gene            520540..527916
                     /locus_tag="PSPA7_RS02445"
                     /old_locus_tag="PSPA7_0513"
     CDS             520540..527916
                     /locus_tag="PSPA7_RS02445"
                     /old_locus_tag="PSPA7_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="WP_012074001.1"
                     /db_xref="GI:501021333"
                     /translation="MGDRHDYVALEWVKGEIAETLKQARQALEAFVENPQDPTRMRFC
                     LTYVHQGQGTLQMVEFYGAALLAEEMEQLVQALLDGRVPNQGEALEVLMQAILQLPVY
                     LDRIQTARRDLPMVVLPLLNDLRAARGEKLLSETSLFAPDLSRRQPQLDGEAIAQLRT
                     DELGGLLRKLRQTQQMALVGLLRNQDVATSLGYLARVYARLEGLCREAPLGPLWSIAS
                     GLVEGLANGSVVNSASVRTLLRQLDRELKRLVEQGADGLNQAAPDELIKNLLFYVAKA
                     PSQSPRIRALKEQYRLDEALPDHETVDAERARLAGPDRDAMRSVVGALCEELVRIKDS
                     LDLFVRSDRAHPAELDALLAPLKQIADTLAVLGFGQPRKVILDQLDVVHALAQGRREP
                     SDATLMDVAGALLYVEATLAGMAGPGDERNSEESRLPTTDVAQIHQLVIKEARNGLEQ
                     AKDAIIEFIASQWNHEHLARVPELLTQVRGGLAMIPLERAASLLETCNRYIQEQLLAR
                     RAVPDWQSLDTLADAITSVEYYLERLSEDHESQSDLILDVAEDSLANLGYTLKPHSSA
                     PAEPSLSEPGAVESPIAEPEMPEVIAEAAEAPLQPPADTASAEATREDAPQLASDDNR
                     TLGEVAPDAGEASLDLALDLSLDGSSDVPPALPEVVEESGQSQSTPAPARSLEDFNLD
                     EIDLSGLDLPADAAPASEPAPLADWSLPEQWGLGDDLAQPALVFDAPLESLEPLPAPE
                     PFDGPAEQELALDSFDPLPLDVALPEAEVEVSAWEGSSLEELDLSDLDLPEVQLPEVE
                     TPPAAEALASEAPALSLAEVMAAPVQPINPPAQNVPVSLLPPPADEEPVDEELREVFI
                     EEAGEVLETIGQYLPAWKADQDDREALTEVRRAFHTLKGSGRMVRALVIGELAWSIEN
                     LFNRVLDRSIAASEPVRSVVDQVVALLPELVEEFAANAQRQRDDVDLLAATAHALARG
                     EPLPEPPAPDDRGVPPEVEAQQPVAPEDGAPALPLADAPQAAAEAESDVELLDPQLLE
                     IFTNEAETHLEALVGFLADCARELPQPVTDALQRALHTLKGSAHMAGILPIAEIATPL
                     EKLVKEYKSNLLAFDLREAELLHDAEQLFRIGLEQVGERRPLNPIPGSVALLERIEAL
                     HQERIASLEADRYSDAGERRDPLLIEAFLAEGMDILLDAEDLLERWHEHPQERQELSA
                     LREELSALGRGAQHAELPQVEELCQALLTLYEAVEQGRLAVSPAFFEEARQAHEALIG
                     MMDQVAAGLQVTPRPERVAALQELLETPAAETVPFIDPESLDADDFPPEDQESTLPGA
                     VFEETGVPVEETVSAAPAPAPGRELDEEMVSIFLEEAVDILESAGQALAQWQAEPGAL
                     SSLNALQRDLHTLKGGARMAQIAEIGDLAHELESLYEGLVDRRYQHSPRLSELLQACH
                     DRLAEQLEQLSAGRALADPEDLILAIRQFRQGPLAEAAQGEAQSPAEEPVAPAGEEPA
                     ETPQPAAEAFEERDPELVEIFLEEGFDILDSAAAALQRWIDDVDNTIELEALQRDLHT
                     LKGGARMAEIAEIGDLAHELEFLYEGLCGGRLRASPPLFGLLQRCHDELAEMLEAVRG
                     QRELPDGQALIAEIRRLRSDPEEQLSVPTSVSLKPLAGKGAAADESEILDIFLEEADD
                     LLENLELALGRWDGGSGDAQPLDDLLRILHTLKGGARLAGQTELGNLAHDLEQHLTDA
                     QQQGAPWPDSLLLDAQSGLEGLQRQVDLLRERLAEDDEAGERPEAAQAPVQADDTDRA
                     VASALAELTRLAPAAGAIMAAEAAPPAAPATTLPFVRKAREAAQEAASRRAPQELVKV
                     PAELLENLVNLAGETSIFRGRVEQQVSDVGFTLGEMESTIERVRDQLRRLDTETQAQI
                     LSRHQADAERAGYEEFDPLEMDRYSQLQQLSRALFESASDLLDLKETLAAKNRDAETL
                     LLQQARVNTELQEGLMRTRMVPFDRLVPRLRRIVRQVAGELGKQVEFVVGNADGEMDR
                     TVLERIVAPLEHMLRNAVDHGIESGETRRAAGKPEHGTIRLNIGREGGDILLTLSDDG
                     AGIRLDAVRRKAIERGLMSADSDLSDHEVLQFVLESGFSTAEKVTQISGRGVGLDVAN
                     SEVKQLGGSVSIQTEPGQGTRFNVRLPFTVSVNRALMVLSGEDLYAVPLNTIEGIVRV
                     SPYELEALYEQRGEAGLDTPSFEYAGQSYELKYLGELLNNGQEPKLVGQSLPLPVILV
                     RSSEHAVAVQVDSLAGSREIVVKSLGPQFAGVAGISGATLLGDGRVVVILDLLATIRS
                     RHALLGQESRRERLALRQETAASESEQQRPPLVMVVDDSVTVRKVTTRLLERNGMNVL
                     TAKDGVDAIAQLQEHRPDILLLDIEMPRMDGFEVATLVRHDERLGNLPIIMITSRTGE
                     KHRERALGIGVNQYLGKPYQETELLEAIQSLVGQHD"
     gene            527909..528940
                     /locus_tag="PSPA7_RS02450"
                     /old_locus_tag="PSPA7_0514"
     CDS             527909..528940
                     /locus_tag="PSPA7_RS02450"
                     /old_locus_tag="PSPA7_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheB"
                     /protein_id="WP_012074002.1"
                     /db_xref="GI:501021334"
                     /translation="MTERATPRVAVIADTSLQRHVLQQALLGHGYEVVLNADPARVDD
                     AALECAPDLWLVDLTQQDDSPLLDSLLEQDRAPVLFGEGHAPERHTEHYPRWERRLIA
                     KLKRLIGDPSDGVGDSLGALLDEERPARLEIPGDLAAMPLQAGEPAREVWLLAASLGG
                     PAAVKAFLDALPGGLPIAFLYAQHIDASFEQSLPQAVGRHSQWHVKNVRDGEALRCGE
                     VQVVPVLHELGFHHDGRLKCSQRPWPEPYTPSIDQMMLNLAQQFGPDCGVIVFSGMGS
                     DGSAAAAYVRRQGGEVWTQRADSCVCSSMPDSLREAGYSSFNASPRELAEALVKHLAA
                     RCAPTGVET"
     gene            528937..529443
                     /locus_tag="PSPA7_RS02455"
                     /old_locus_tag="PSPA7_0515"
     CDS             528937..529443
                     /locus_tag="PSPA7_RS02455"
                     /old_locus_tag="PSPA7_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015649760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012074003.1"
                     /db_xref="GI:501021335"
                     /translation="MNQAVIEQDGMSRKPLAAPTPDSLTGLLLPLSDRTLLLPNVAVA
                     ELIAYRNPQVAAGLPQWYLGQVAWRDLRLPLLSFETASSGERQPVLGSSARVVVINAL
                     GGRPHVKFLALLVQGIPRSVRLDANLAATAAPLAALELAAVDIGGETARIPDLAGLEE
                     KLADAGLI"
     gene            529451..530245
                     /locus_tag="PSPA7_RS02460"
                     /old_locus_tag="PSPA7_0516"
     CDS             529451..530245
                     /locus_tag="PSPA7_RS02460"
                     /old_locus_tag="PSPA7_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003111539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012074004.1"
                     /db_xref="GI:501021336"
                     /translation="MAGLQHARIGASLEVACASLAGHRFEKHSHDEFVISANLCGLEE
                     IWLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELANSLDLSSVEFD
                     RPLLRSPALGRELAASIEALLASDRFARERGEERLLEFLGRLLAASGTRLPRRADPGR
                     PAVVRLQALLAEHLAEPPDLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRA
                     LGLLRRGLAVGEVAHALGFADQSHLTRYFSSAYGISPGRYQRAVRG"
     gene            530322..530933
                     /locus_tag="PSPA7_RS02465"
                     /old_locus_tag="PSPA7_0517"
     CDS             530322..530933
                     /locus_tag="PSPA7_RS02465"
                     /old_locus_tag="PSPA7_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotactic transduction protein ChpE"
                     /protein_id="WP_012074005.1"
                     /db_xref="GI:501021337"
                     /translation="MLAIFLAALLFGFAFNISPGAVFSETLRRGLTGGFRPALLVQLG
                     SLIGDAVWALLGLTGLALLLGYEQVRMPLTLVCAVYLAWLGVQGLRDAWNPPLAAENV
                     GEQGRNAFGAGAAISLSNPKNLVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLI
                     WCFCCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
     gene            complement(530938..532311)
                     /locus_tag="PSPA7_RS02470"
                     /old_locus_tag="PSPA7_0518"
     CDS             complement(530938..532311)
                     /locus_tag="PSPA7_RS02470"
                     /old_locus_tag="PSPA7_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074006.1"
                     /db_xref="GI:501021338"
                     /translation="MDTPVTFDWKIRLPDVLGVLRRDYAGRFPQLASAALETLLERLR
                     DDLPEDFLPALGQELESLGLALVERLDEDDSLNLYVIGAPHSQRLLDALAAQGHNART
                     LRQEDAAEGAPATLPAATPAGLAAASAYICLERTEHLAPGLATGRLPGEDSSDLLDLR
                     QWPRLRRLPDGAEETRGALLCRASSADGLHAWVRMTGSGSPYAWLQRSRDLASLTPEL
                     PPLPLPPAQSLRQRRTPELAIGLAGEDLLLVDRGLVFLYPGFARGNGEPRLLFEVPQA
                     RRSIENPPAVFTTPDERVCLLSRGQFFEWREARIQPLPFPVGKDLPADPAQPTSVAPG
                     SIVWLERETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLEPHRSRDL
                     AQLWHPESGRALRIRYGELDLEGGLQHWAKLPDGRIVVGDHARHVDLGTFESLRQRLL
                     RRRPALA"
     gene            complement(532388..533110)
                     /locus_tag="PSPA7_RS02475"
                     /old_locus_tag="PSPA7_0519"
     CDS             complement(532388..533110)
                     /locus_tag="PSPA7_RS02475"
                     /old_locus_tag="PSPA7_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_012074007.1"
                     /db_xref="GI:501021339"
                     /translation="MRLSRFFVDQPLALGQHDLPEAQAHYIGRVLRHATGDAVQLFDG
                     SGREYLGELIEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELG
                     VAEITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPRIHPPLALEDWLR
                     QRDDELRLVLHPVAAPLASHARPASLAFLVGPEGGLGDAEVEQAQAAGFHSARLGPRV
                     LRTETAPVVALAVAQQLWGDFA"
     gene            complement(533203..534606)
                     /locus_tag="PSPA7_RS02480"
                     /old_locus_tag="PSPA7_0520"
     CDS             complement(533203..534606)
                     /locus_tag="PSPA7_RS02480"
                     /old_locus_tag="PSPA7_0520"
                     /EC_number="2.6.1.62"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine--8-amino-7-oxononanoate
                     aminotransferase BioA"
                     /protein_id="WP_012074008.1"
                     /db_xref="GI:501021340"
                     /translation="MGLNADWMQRDLNVLWHPCTQMKDHERLPVIPIRRGEGVWLEDF
                     EGKRYIDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKI
                     TPPGLDRVFYADSGSAGIEVALKMSYHFWLNSGRPRKKRFVTLTNSYHGETIAAMSVG
                     DVALFTETYKSLLLDTIKVPSPDCFLRPDGMCWEEHSRNMFAHMERTLAEGHDEIAAV
                     IVEPLIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIA
                     PDFLCLSKALTGGYLPMSAVLTTETVYRGFYDDYQTLRAFLHSHTYTGNPLACAAALA
                     TLDIFEEDKVIEANRALSTRMARATAHLADHPHVAEVRQTGMVLAIEMVQDKASRTPY
                     PWQERRGLKVFQHGLERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRD
                     AVSVAVSDFHPDHRDPG"
     gene            534781..536271
                     /locus_tag="PSPA7_RS02485"
                     /old_locus_tag="PSPA7_0521"
     CDS             534781..536271
                     /locus_tag="PSPA7_RS02485"
                     /old_locus_tag="PSPA7_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020751112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="WP_012074009.1"
                     /db_xref="GI:501021341"
                     /translation="MSLRWLRAAAFLVLGVFSAVALGKDKQPTAIVVGAGLAGLSAAY
                     ELQKDGWQVTVLEARPQVGGRSGLATSEWVGNQKVQPNLNGYLDTFKLKSVPAPDFVR
                     TPSYLIDGLYYSSSDLALKQPNVAADLKRFEQTLDDLSASISDPLNPASNNTLFALDQ
                     MNAARWLDKLNLSPTARLLVNQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAAR
                     LPGGSQVLAEAFVKQLKTIKTKAKVSSIVQARDGVTVKAGSQTYKADYVVLAVPLKAL
                     AQIQMTPALSGTQMSALKGTNYGWRDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWV
                     EPALKGGANVLINLSGDNARVLQAFGDRQMVDQVLIRMNKFYPKMRGAFAGYEIRRYS
                     ADPGTGGSYLAYGPGQVTRFWRIWEQPLARVAFAGEHTDALYPGTIEGALRSGKRAAS
                     QVRDLYAGKTPVIEGAPMVAKAEKVAAPKADGEKKNPFAWFTRLFD"
     gene            536453..537022
                     /locus_tag="PSPA7_RS02490"
                     /old_locus_tag="PSPA7_0522"
     CDS             536453..537022
                     /locus_tag="PSPA7_RS02490"
                     /old_locus_tag="PSPA7_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003111544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_012074010.1"
                     /db_xref="GI:501021342"
                     /translation="MQWRNTSSRYGVFSLFLHWGSALVVFGLFGLGLWMRELSYYDPW
                     YHPAPALHKSIGILLAIALLVRIVWRFVSPPPPAPANHGPATRVASKLGHLALYALLV
                     AVIVAGYLISTADGEPISVFGWFSVPATLSGLPDQADVAGEIHLYLAWALVVFAVLHA
                     FAALKHHFVDRDPTLKRMLGRSSNEQQPR"
     gene            537034..537609
                     /locus_tag="PSPA7_RS02495"
                     /old_locus_tag="PSPA7_0523"
     CDS             537034..537609
                     /locus_tag="PSPA7_RS02495"
                     /old_locus_tag="PSPA7_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003155469.1"
                     /db_xref="GI:489247313"
                     /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHL
                     GYSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVGK
                     NPTATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLLGQGNDPWGGYRAGFEGSA
                     TLKLKDFGIKMDLGPASQEVELLLSVEGIRQ"
     gene            complement(537679..538122)
                     /locus_tag="PSPA7_RS02500"
                     /old_locus_tag="PSPA7_0524"
     CDS             complement(537679..538122)
                     /locus_tag="PSPA7_RS02500"
                     /old_locus_tag="PSPA7_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003128991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_003153084.1"
                     /db_xref="GI:489244903"
                     /translation="MNYPVNPDLMPALMAVFQHVRTRIQSELDRQRLDLTPPDVHVLK
                     LIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRSLVRRERNPSDQRSFQLFLTDEGL
                     AIHRHAEAIMSCVHDELFAPLTPEEQATLVHLLDQCLAAQPLEDI"
     gene            538397..539548
                     /locus_tag="PSPA7_RS02505"
                     /old_locus_tag="PSPA7_0525"
     CDS             538397..539548
                     /locus_tag="PSPA7_RS02505"
                     /old_locus_tag="PSPA7_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004346590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MexA family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="WP_033999646.1"
                     /db_xref="GI:730363577"
                     /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLE
                     AQTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEAD
                     YQSAQANLASTQEQAQRFKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKV
                     LSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQ
                     LERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGM
                     FVHAQLQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLV
                     TEGLNAGDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
     gene            539564..542704
                     /locus_tag="PSPA7_RS02510"
                     /old_locus_tag="PSPA7_0526"
     CDS             539564..542704
                     /locus_tag="PSPA7_RS02510"
                     /old_locus_tag="PSPA7_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003121760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_003153085.1"
                     /db_xref="GI:489244904"
                     /translation="MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIA
                     VQVSYPGASAETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDI
                     AQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVS
                     NIQDPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSAAIQAQNVQISSGQ
                     LGGLPAVKGQQLNATIIGKTRLQTAEQFEKILLKVNPDGSQVRLKDVADVGLGGQDYS
                     INAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVS
                     ASIHEVVKTLGEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINT
                     LTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLS
                     AVFLPMAFFGGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEH
                     KGGFFGWFNRMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPD
                     EDQGVLFAQVQTPPGSTAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSS
                     GMAFIMLKPWEERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVLELGNATGFDL
                     FLQDQAGVGHEVLLQARNKFLMLASQNPALQRVRPNGMSDEPQYKLEIDDEKASALGV
                     SLADINSTISIAWGSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMV
                     PFNAFATGKWEYGSPKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVKQLPKGVGY
                     SWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLA
                     TSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRP
                     IVMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVSTL
                     FKDEASKQQAEAEKGQ"
     gene            542706..544163
                     /locus_tag="PSPA7_RS02515"
                     /old_locus_tag="PSPA7_0527"
     CDS             542706..544163
                     /locus_tag="PSPA7_RS02515"
                     /old_locus_tag="PSPA7_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003117905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adeC/adeK/oprM family multidrug efflux complex
                     outer membrane factor"
                     /protein_id="WP_012074012.1"
                     /db_xref="GI:501021344"
                     /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQN
                     TGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLF
                     PRIGVDGSGTRQRLPGDLSTTGNPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQY
                     LATEQAQRSAQTTLVASVATAYLTLKADQAQLQLTRDTLGTYQKSFDLTQRSYDVGVA
                     SALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTE
                     VPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLF
                     DAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAA
                     RGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRL
                     NQLTSEVNLYKALGGGWNQQTVTQQQTAKKEDPQA"
     gene            complement(544256..546163)
                     /locus_tag="PSPA7_RS02520"
                     /old_locus_tag="PSPA7_0528"
     CDS             complement(544256..546163)
                     /locus_tag="PSPA7_RS02520"
                     /old_locus_tag="PSPA7_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_012074013.1"
                     /db_xref="GI:501021345"
                     /translation="MSFSSLGLSEALARAVEAAGYSQPTPVQQRAIPAVLQGRDLMVA
                     AQTGTGKTGGFALPVLERLFPAGHPDREHRHGPRQARVLVLTPTRELAAQVHDSFKVY
                     ARDLPLNSTCIFGGVGMNPQIQALAKGVDVLVACPGRLLDLAGQNKVDLSHVEILVLD
                     EADRMLDMGFIHDVKKVLAKLPPKRQNLLFSATFSKDIVDLANKLLHNPERIEVTPPN
                     TTVERIEQRVFRLPAPQKRALLAHLVTVGAWEQVLVFTRTKHGANRLAEYLTKHGLPA
                     AAIHGNKSQNARTKALADFKANDVRILVATDIAARGLDIDQLPHVVNYELPNVEEDYV
                     HRIGRTGRAGRSGEAISLVAPDEEKLLKAIEKMTRQRIPDGDPQGFDPEAVLPEVAQP
                     EPREAPQKQPRRDKERRSRERKPKEAQAPAENAAVAGQDGAEKPAGKRRRRGGKNKEN
                     REAGQAQQPRQSREARPAKPNRPPEIDGNRDPEEFLDDDFDNFGNRADYVSPYQGQEN
                     KGRGRRGGQQKSQGGAGQQGRGQGQGRGKSQGSAQGGARGQGAGQGKAKKPRAGKPRG
                     QGRDNPSRMSDAPLREPSEYGVGKQPSRQPVVINKRDLVRMDRFPTAEQLDELEPRRK
                     GERPALLTRNR"
     gene            complement(546414..547484)
                     /locus_tag="PSPA7_RS02525"
                     /old_locus_tag="PSPA7_0529"
     CDS             complement(546414..547484)
                     /locus_tag="PSPA7_RS02525"
                     /old_locus_tag="PSPA7_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014604100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074014.1"
                     /db_xref="GI:501021346"
                     /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDEPAHGLTVR
                     VYTDDPSPYAGLPVQVRPLTAEELVAWCQPHGYHFRAKHVALREALEDADQALLIDTD
                     TFFHSSPLRLFERIQPGRLLCNAIGARYGEHRNFPLYRDLSAYLFERGWADDEMHQLN
                     SGVIGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHH
                     YWSRKQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLP
                     APMRQFSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPREPIAEQIEDWLNHSL
                     LRNLLGSRANEIRQHLRQRDLL"
     gene            complement(547555..548403)
                     /locus_tag="PSPA7_RS02530"
                     /old_locus_tag="PSPA7_0530"
     CDS             complement(547555..548403)
                     /locus_tag="PSPA7_RS02530"
                     /old_locus_tag="PSPA7_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="WP_003151226.1"
                     /db_xref="GI:489243023"
                     /translation="MSQSERRFSFEFFPAKTEAGHEKLLATARNLAGYKPDFFSCTYG
                     AGGSTRDRTLHTVLQLDGEVKVPTAPHLSCVGDSKAELRELLGQYRAAGIRRIVALRG
                     DLPSGMGMASGELRYANELVEFIRAETGDHFHIEVAAYPEVHPQARSFEDDLANFVRK
                     VKAGASSAITQYFFNADAYFYFVERVAKLGVDIPVVPGIMPITNYSKLARFSDACGAE
                     LPRWIRKQLEAYGDDSRSIQAFGEQVISEMCERLLQGGAPGLHFYTLNQADPSLAIWK
                     NLQLPR"
     gene            complement(548468..549007)
                     /locus_tag="PSPA7_RS02535"
                     /old_locus_tag="PSPA7_0531"
     CDS             complement(548468..549007)
                     /locus_tag="PSPA7_RS02535"
                     /old_locus_tag="PSPA7_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016254319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074015.1"
                     /db_xref="GI:501021347"
                     /translation="MSTHLADRYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVANELL
                     AADRQGAVERLAETLQIAVLHDTLEDTATSPEELRQQFGEFVHDGVLALSKRVGDGPK
                     RSPDDYFQALAEGPAQYALVKLCDRITNLQPPPQTWNPDKIADYHQESRLILARLGHA
                     HAATARRLREKIEHYRQYY"
     gene            complement(549062..550471)
                     /locus_tag="PSPA7_RS02540"
                     /old_locus_tag="PSPA7_0532"
     CDS             complement(549062..550471)
                     /locus_tag="PSPA7_RS02540"
                     /old_locus_tag="PSPA7_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q02TY0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="WP_041025277.1"
                     /db_xref="GI:751334179"
                     /translation="MSAVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRK
                     YAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAG
                     IPVFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHKKYPQMLERIHG
                     ITEETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHL
                     LSGKQALVIGYGDVGKGSSQSLRQEGMIVKVSEVDPICAMQACMDGFEVVSPYKNGIN
                     DGTEASIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMR
                     KNWAWEEVKPQVHKIHRTGKDGFDAHNDDYLILLAEGRLVNLGNATGHPSRIMDGSFA
                     NQVLAQIHLFEQKYADLPAAEKAKRLTVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQ
                     AEYIGVSVEGPFKPDAYRY"
     gene            550760..551194
                     /locus_tag="PSPA7_RS02545"
                     /old_locus_tag="PSPA7_0534"
     CDS             550760..551194
                     /locus_tag="PSPA7_RS02545"
                     /old_locus_tag="PSPA7_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003142653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033999641.1"
                     /db_xref="GI:730363559"
                     /translation="MLECAVMRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQAL
                     GVGSDKGQKASVGLFCVAGASQWLSLDPDDGSAGDPVPVNPQLPVSCPMCSALVLFVA
                     LGVIWSWRLQRQRQARFRPPATREPVPPRYVWPPANPRASPA"
     gene            551320..553512
                     /locus_tag="PSPA7_RS02550"
                     /old_locus_tag="PSPA7_0535"
     CDS             551320..553512
                     /locus_tag="PSPA7_RS02550"
                     /old_locus_tag="PSPA7_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003151233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_012074019.1"
                     /db_xref="GI:501021351"
                     /translation="MKKHSTARRVLALGLNLTLAGVPALLWADEEPTELPALTVSAGA
                     AGETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVN
                     ASAPPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLN
                     GAGAVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRLD
                     VSRSGGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPY
                     AGELKIDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRN
                     LETYRYNADNSGVVRSNAFLQRHDQQLDGNRFELQHSQPLFGLASDWALGFDYSINKQ
                     TRFPSTASGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDE
                     LSLVTGLRYDHLDLDVRNHRVPDKDNPAHFERRWDVLTGRAGLVYQFTPHANVYLQYS
                     TAADPPGGVLTSASFAQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSV
                     ADPNDPNLSVPVGQQTSRGIEAAASLRITPKLLVEGNFAWVDAQYDEFTENVGGVAVS
                     RKGKTPPNVPERVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFL
                     SYRLDERTRITGRVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
     gene            553523..555001
                     /locus_tag="PSPA7_RS02555"
                     /old_locus_tag="PSPA7_0536"
     CDS             553523..555001
                     /locus_tag="PSPA7_RS02555"
                     /old_locus_tag="PSPA7_0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004365060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proline symporter"
                     /protein_id="WP_012074020.1"
                     /db_xref="GI:501021352"
                     /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERL
                     AHLPGLEGCEACMPLRTALADGAGKAPRSIRLASVGGLPTYLLDDADGRTRALAARNG
                     RPLAVDADRVLASARAFSGEVPMQLQGRIEEDAWTHTRNLDPHRPLWRVQTADAEGRL
                     LYLSSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLAT
                     VLGILVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPW
                     NLFGRGTPLDLAAYQGASWDQALPAGLEADAALRRFRGAGLRVRELEWRMLGGAPYVV
                     GRSGSGASLLLTADGETLRELPEERLLASARALLPGVPMQAERLDRYDFHYYPREEHS
                     MMGYLERRLPVWRLRFDDSRHTWVHLDPYSGAVVGVLDDARRGSRWLFSLLHSWDWLP
                     LLTRRPLWDLWMLGGSLGGLVVCASGCWIGWRRLRGRRPKRR"
     gene            555085..555705
                     /locus_tag="PSPA7_RS02560"
                     /old_locus_tag="PSPA7_0537"
     CDS             555085..555705
                     /locus_tag="PSPA7_RS02560"
                     /old_locus_tag="PSPA7_0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_003157297.1"
                     /db_xref="GI:489249169"
                     /translation="MGTHKIEIRRRNVEKILLAAEKVFAEKGYAGTSMGNIAEEAELP
                     RSNLHYYFSTKDELYRDVLLGLLEVWKQDALCFEMFDDPRVVLTSYIRAKMNHSRTRP
                     HGSKVWANEIMHGAPLLGATLDDSLYEWAKMKEAKIRQWVEEKRILPIEPSSLLYLIW
                     ASTQHYADFGYQVEVLNGHQPLSDMQFERAVQTVTSVVLRGIGLEP"
     gene            complement(555743..557014)
                     /locus_tag="PSPA7_RS02565"
                     /old_locus_tag="PSPA7_0538"
     CDS             complement(555743..557014)
                     /locus_tag="PSPA7_RS02565"
                     /old_locus_tag="PSPA7_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074021.1"
                     /note="Catalyzes the deamination of cytosine to uracil and
                     ammonia; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_012074021.1"
                     /db_xref="GI:501021353"
                     /translation="MLIDNLRLRGREGLWQLRVADGRIAALVPMEQAADDAGERLDGA
                     GGLAVPPFIEPHIHLDTTQTAGQPEWNRSGTLFEGIERWAQRKALLSHEDVKQRAWQT
                     LKWQIANGVQHVRSHVDVSDPTLTALKAMLEVRGEVAPWVDLQIVAFPQEGILSYPNG
                     LELLEESLRLGADVVGAIPHFEFTRELGVESLHKAIDLARRYDLPVDVHCDEIDDEQS
                     RFLETLAMLAHRDGLGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVANPLVNIH
                     LQGRFDDYPKRRGITRVKELLGAGINTCFGHDDVFDPWYPLGTANMLQVLHMGLHVTQ
                     MMGYDEIDGGLDLITRNSARTLGLREYGIEVGHPANLLVLPARDGFDAVRRQVPVRYS
                     IRGGRLLAETLPAQTTVFLEQAEAVDFTRAS"
     gene            complement(557004..558254)
                     /gene="codB"
                     /locus_tag="PSPA7_RS02570"
                     /old_locus_tag="PSPA7_0539"
     CDS             complement(557004..558254)
                     /gene="codB"
                     /locus_tag="PSPA7_RS02570"
                     /old_locus_tag="PSPA7_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016252893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine permease"
                     /protein_id="WP_012074022.1"
                     /db_xref="GI:501021354"
                     /translation="MSADSNYSQQPVPLAARKSALALSVVMLGLTFFSASMWTGGTLG
                     TGLSYDDFFLAVLLGNLMLGLYTAILGFIGARTGLSTHLLAHYSFGSKGSWLPSALLG
                     GTQVGWFGVGVAMFAIPVAKASGLDVNLLILVSGALMTLTVFFGIAGLTLLSAIAVPA
                     IVVLGSYSVWLAVRDAGGLAALQQVTPSAPLSLSAAIALVVGSFVSAGTLTADFVRFG
                     RSARTAVVVCLVAFFLGNSLMFIFGAAGAAAVGKSDISDVMIAQGLLIPAILVLGLNI
                     WTTNDNALYASGLGFANITGLSSRFLAMLNGALGTLAALWLYNHFVGWLTFLSAAIPP
                     IGGVIIADYLSRRRRYRQHPCADIQAINWAAILAVACGTAAGHWLPGIVPVNAVLGAA
                     IAYLLLNPLLSRSPNKPEEVLHAD"
     gene            complement(558436..559710)
                     /locus_tag="PSPA7_RS02575"
                     /old_locus_tag="PSPA7_0540"
     CDS             complement(558436..559710)
                     /locus_tag="PSPA7_RS02575"
                     /old_locus_tag="PSPA7_0540"
                     /EC_number="1.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118829.1"
                     /note="NADH-dependent; catalyzes the conversion of
                     pyrimidines to 5,6-dihydro compounds in pyrimidine
                     degradation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase subunit B"
                     /protein_id="WP_003157339.1"
                     /db_xref="GI:489249212"
                     /translation="MADLSIEFAGIKSPNPFWLASAPPTDKAYNVVRAYEAGWGGVVW
                     KTLGEDPAAVNVSSRYSAHFGPNRQVQGINNIELITDRSLEINLREIAQVKKDWPDRA
                     LIVSLMVPCVEESWKYILPLVEATGADGIELNFGCPHGMPERGMGAAVGQVPEYVEMV
                     TRWCKTHCSLPVIVKLTPNITDIRQSARAAQRGGADAVSLINTINSITSVDLERMVAL
                     PVVGTQSTHGGYCGSAVKPIALNMVAEIARDPQTRGLPICGIGGIGSWRDAAEFVALG
                     CGAVQVCTAAMLHGFRIVEDMQDGLARWMDSQGYQRLADFSGAAVGNTTDWKYLDINY
                     QVIARIDQDACIGCGRCHIACEDTSHQAIASLPRADGTHRYEVIDAECVGCNLCQITC
                     PVENCIEMVPQDTGKPYLNWTQDPRNPYREAS"
     gene            complement(559710..561077)
                     /locus_tag="PSPA7_RS02580"
                     /old_locus_tag="PSPA7_0542"
     CDS             complement(559710..561077)
                     /locus_tag="PSPA7_RS02580"
                     /old_locus_tag="PSPA7_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase subunit A"
                     /protein_id="WP_012074023.1"
                     /db_xref="GI:501021355"
                     /translation="MIDSLNHLPRPDAGADTLAERFADLAPPLNARQADLESARCLYC
                     YDAPCVNACPTGIDIPGFIRSIAQENVQGAAQKILSANILGGSCARVCPTEILCQQAC
                     VRNNAQECAPVLIGQLQRYALDHAGFSEHPFKRSPATGKRIAVVGAGPAGLSCAHRLA
                     MHGHEVVLFEARAKAGGLNEYGIARYKLVDDFARREVEFLLQIGGIELRHGQRLGDNL
                     ALGALHEEYDAVFLGIGLAASKRLGLEDEDAPGLLAATDYIRELRQSDDLLDLPVADR
                     CIVIGAGNTAIDMAVQMSRLGARDVNLVYRRGFEEMGATGHEQEIAKASQVRLLTWAR
                     PERVLLDEHGRVRGMRFARTRLENGRLGDTGDHFELAADAIFKAIGQAFDDASLGDPL
                     AAQLRRDGGRIQVDGQMRTSIPGIYAGGDCVALGEDLTVQAVQHGKLAAEAIHAQLML
                     NVEAA"
     gene            complement(561172..562611)
                     /locus_tag="PSPA7_RS02585"
                     /old_locus_tag="PSPA7_0543"
     CDS             complement(561172..562611)
                     /locus_tag="PSPA7_RS02585"
                     /old_locus_tag="PSPA7_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylhydantoinase"
                     /protein_id="WP_041025278.1"
                     /db_xref="GI:751334180"
                     /translation="MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLDPPSGCDVL
                     DGGGQYLMPGGIDPHTHMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPQQSL
                     LEAFHTWRGWAQKSAADYGFHVAITWWSDEVAREMGELVAQHGVNSFKHFMAYKNAIM
                     AADDTLVASFERCLELGAVPTVHAENGELVFHLQRKLLAQGLTGPEAHPLSRPPQVEG
                     EAASRAIRIAETLGTPLYLVHISSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYR
                     HPDWATAAGYVMSPPFRPVEHQEALWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSK
                     IPNGTAGIEDRLALLWDAGVNSGRLSMHEFVALTSTNTAKIFNLFPRKGAIRVGADAD
                     LVLWDPQGSRTLSAATHHQRVDFNIFEGRTVRGVPSHTISQGKLLWAAGDLRAEPGAG
                     RYVERPAYPSVYEVLGRRAERQRPVAVER"
     gene            complement(562718..562834)
                     /locus_tag="PSPA7_RS02590"
                     /old_locus_tag="PSPA7_0544"
     CDS             complement(562718..562834)
                     /locus_tag="PSPA7_RS02590"
                     /old_locus_tag="PSPA7_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074025.1"
                     /db_xref="GI:501021357"
                     /translation="MVRTLTILVIFIFIHSKSISYKLKQPFENNLAQSMISI"
     gene            563227..564717
                     /locus_tag="PSPA7_RS02595"
                     /old_locus_tag="PSPA7_0546"
     CDS             563227..564717
                     /locus_tag="PSPA7_RS02595"
                     /old_locus_tag="PSPA7_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_012074027.1"
                     /db_xref="GI:501021359"
                     /translation="MQQSRSEVTERDGLVELSAGSDVLDSPRYNHDIAPTRVEQRTWN
                     KWHITALWIGMSICVPTYTLGGVLTAYFGLSVGEALLAILLANLVVLIPLTLNAFAGT
                     RYGIPFPVLLRASFGIIGSNVPCLIRAVVACGWLGIQTLFGGLAIHLFLGSLFPAWKA
                     LGGTGEVIGFLLFWGLNLWVVLRGAESIKWLETLSAPLLVLVGLGLLVWALPHISVSE
                     LLAQPPKRPEGASVTGYFMAGLTAMVGFWATLSLNIPDFSRYARSQKDQILGQIFGLP
                     LTMFLFAALGVVMTAASASLVGETVSDPVSLIGHIPSPGWVAVAMALIIVATLSTNTA
                     ANIVSPTNDFQNIAPKLIGRTRAVWLTGFIGLALMAHELLKKLGWIVSDLSLESVYSN
                     WLLGYSSLLGPIAGIMVVDYFLVRRQRLDLAGLYRDDVYPAWNWPGFAAFAVPVALTV
                     MAIGNRQFHWFYDYGWFTGSLLGGALYYGLCGRRARSPAALAKPLP"
     gene            564776..566059
                     /locus_tag="PSPA7_RS02600"
                     /old_locus_tag="PSPA7_0547"
     CDS             564776..566059
                     /locus_tag="PSPA7_RS02600"
                     /old_locus_tag="PSPA7_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074028.1"
                     /note="allantoate amidohydrolase and N-carbamoyl-L-amino
                     acid amidohydrolase are very similar; the allantoate
                     amidohydrolase from Escherichia coli forms a dimer and
                     binds zinc ions for catalytic activity and catalyzes the
                     conversion of allantoate to (S)-ureidoglycolate and
                     ammonia; carbamoyl amidohydrolase from Bacillus sp.
                     converts N-carbamoyl amino acids to amino acids, ammonia,
                     and carbon dioxide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="WP_012074028.1"
                     /db_xref="GI:501021360"
                     /translation="MSTARNVLQSTQRHIDGQRLWQSLMDLARLGATAKGGVCRLALT
                     DLDRQARDLFVQWCEAAGCTVSVDRVGNIFARRPGRNPELPPVMTGSHIDTQPTGGKF
                     DGCFGVMAGLEVIRTLNDLGVETEAPLEVVVWTNEEGSRFAPCMMGSGVFAGKFTLEE
                     TLAKRDADGVSVGEALDAIGYAGARDCLGHPVGAYFEAHIEQGPILEDEEKTIGVVLG
                     ALGQKWFDLSLRGVEAHAGPTPMHLRKDALVGAAAVVEAVNRAALGHQPHACGTVGCL
                     HAYPGSRNVIPGEVKMTLDFRHLQPERLDAMIAEVRQVIAATCEKHGLQYELVPTADF
                     PPLYFDQGCVGAVREAAQALGMPHMDIVSGAGHDAIFLAELGPAGMIFVPCENGISHN
                     EIENASLDDLAAGCAVLLRAMLKASEAIAGGRLAA"
     gene            complement(566259..567482)
                     /locus_tag="PSPA7_RS02605"
                     /old_locus_tag="PSPA7_0548"
     CDS             complement(566259..567482)
                     /locus_tag="PSPA7_RS02605"
                     /old_locus_tag="PSPA7_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_012074029.1"
                     /db_xref="GI:501021361"
                     /translation="MPGALSHIRVLDLSRVLAGPWAGQILADLGAEVIKIERPGSGDD
                     TRAWGPPFLKDAEGNDTGEAAYYLSANRNKKSVTVDFTQPEGQRIVRELAAKADILLE
                     NFKVGGLKAYGLDYESLKQVNPKLIYCSITGFGQSGPYAKRAGYDFMIQGLGGLMSLT
                     GRADNEEGAGPVKVGVALTDILTGLYSSTAVLAALAHRDVSGIGQHIDMALLDVQVAC
                     LANQTLNYLTTGVPPRRLGNAHPNIVPYQDFPTADGDMILTVGNDSQFRKFAELADHP
                     EWADDPRFATNKARVANREVLIPLIRQATVLHSTAEWILSLERAGVPCGPINDLAQVF
                     ADPQVQARGLRVELPHPLGGTVPQVASPIRLSETPVEYRNPPPTLGQHTDDVLETLLG
                     LDAAALERLRDGKVI"
     gene            complement(567602..568783)
                     /locus_tag="PSPA7_RS02610"
                     /old_locus_tag="PSPA7_0549"
     CDS             complement(567602..568783)
                     /locus_tag="PSPA7_RS02610"
                     /old_locus_tag="PSPA7_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_012074030.1"
                     /db_xref="GI:501021362"
                     /translation="MATKASFNWEDPLLLDQQLTEEERMVRDSAQQFAQAKLAPRVLE
                     AFRHEQTDPKIFREMGETGLLGATIPEAYGGSGLNYVCYGLIAREVERVDSGYRSMMS
                     VQSSLVMVPIHEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKVDG
                     GYRLSGSKMWITNSPIADVFVVWAKDDEGQIRGFVLEKGWEGLSAPAIHGKVGLRASI
                     TGEIVMDNVFVPEENAFPEVRGLRGPFTCLNSARYGISWGALGAAEFCWHTARQYVLD
                     RQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
                     KALDIARLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAF
                     F"
     gene            569004..569912
                     /locus_tag="PSPA7_RS02615"
                     /old_locus_tag="PSPA7_0550"
     CDS             569004..569912
                     /locus_tag="PSPA7_RS02615"
                     /old_locus_tag="PSPA7_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017001574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_003154941.1"
                     /db_xref="GI:489246779"
                     /translation="MRRKIPSTAALVSFESAARHESFTKAAEELSLTQSAICRQIATL
                     EEFLGVELFRRSRRGVKLTEAGLSYSRRVAVRLDAVERDTLAVMGHQGGGAIELAVVP
                     TFGTQWLLPRLKRFQRLHPEVTVNLTNRTRPFLFADTEFDAALYFGDADWSGTVSHFL
                     MRENPVPVCSPELLGGRRTLSAEQIAGLPLMQQSTRPYGWRQWFHSQGLNVAHDMSGP
                     RYELFSMLAQAAMHGMGVALVPPFLIQEELADGRLIVPMQHAYLSENAYYLIIPERRV
                     ESAMLNAFRDWLVEEARQYREANGLG"
     gene            570064..570468
                     /locus_tag="PSPA7_RS02620"
                     /old_locus_tag="PSPA7_0551"
     CDS             570064..570468
                     /locus_tag="PSPA7_RS02620"
                     /old_locus_tag="PSPA7_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_012074031.1"
                     /db_xref="GI:501021363"
                     /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQ
                     RVVTKYVSEINFVSSARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMV
                     FVNLGPDGLPAPHGKTEITYIKDQFKEDEVLP"
     gene            complement(570511..572121)
                     /locus_tag="PSPA7_RS02625"
                     /old_locus_tag="PSPA7_0552"
     CDS             complement(570511..572121)
                     /locus_tag="PSPA7_RS02625"
                     /old_locus_tag="PSPA7_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease PIN"
                     /protein_id="WP_012074032.1"
                     /db_xref="GI:501021364"
                     /translation="MTTDVLPADAIASAGKPQLEHKPGRLAAIVFFAALAIGLLFSAY
                     SLVQDIDDVGSAVTTWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPHF
                     AVVWSGCFNFLGVLLSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAILWNLG
                     TWWLGLPASSSHTLIGSIIGVGVANALMHGRDGTSGVDWGQASKVGYSLLLSPLIGFA
                     CAALLLLALRLLVKNRALYKAPKGKAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGL
                     IMLILVGTLPMAYALNRTMPADQAVQFAAVAEVTRQALVKSAPQPAPADPRQVLSEYV
                     RSKQASPELIPALAALTGSIGREVKGYGAFSRVPAEAMGNVRNDMYLTSEAIRLMDQD
                     GVGRFDADTRGKLQAFKQKIDDATKFIPLWVKIAVAIALGLGTMVGWKRIVVTVGEKI
                     GKTHLTYAQGASAETVAMLTIGAADLYGLPVSTTHVLSSGVAGTMAANGSGLQWRTIR
                     NLLMAWVLTLPAAILLSASLYWLLTRLF"
     gene            572506..573831
                     /locus_tag="PSPA7_RS02630"
                     /old_locus_tag="PSPA7_0553"
     CDS             572506..573831
                     /locus_tag="PSPA7_RS02630"
                     /old_locus_tag="PSPA7_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003129031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_041025449.1"
                     /db_xref="GI:751334351"
                     /translation="MPWRLALALWLCLAGQACLAASATVRVLSVDGAIGPASADYLVR
                     GIQRAAEDGAQLVVLEMDTPGGLDPSMRRIVKAILASRVPVAGFVAPAGARAASAGTY
                     ILYACHVAAMAPGTNLGAATPVALGAPDEAEGKPPARGAGPMARKQVNDAAAYIRGLA
                     QLRGRNAEWAERAVREAVSLAASEAAAQKVIDLQARDLPDLLRQLDGRSLRVGERALT
                     LATTGATVERQAPDWRARLLAVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGI
                     CLLLGLYALQMLPVNYAGLALIALGLAFMVGEAFVASFGVLGIGGIVSFVAGALILID
                     TEVPGYGIPPGLVVALALLSAALIVGLLGMALRARRQAVVSGTAGLVGSLATVAAVDP
                     EQPCAGWVLLQGERWRVLATRPLAVGQPVWVLARKGLLLEVALADEGGG"
     gene            573828..574622
                     /locus_tag="PSPA7_RS02635"
                     /old_locus_tag="PSPA7_0554"
     CDS             573828..574622
                     /locus_tag="PSPA7_RS02635"
                     /old_locus_tag="PSPA7_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074034.1"
                     /db_xref="GI:501021367"
                     /translation="MMGISYGLAMLLAFLALLLFSALRILREYERGVVFQLGRFWKVK
                     GPGLVLVIPALQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQ
                     VENYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVE
                     IKHVDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLR
                     YMQTLGAIAGDKSTTIVFPMPIELFGGKYPGAAPRNEKAAGEDQER"
     gene            574731..575462
                     /locus_tag="PSPA7_RS02640"
                     /old_locus_tag="PSPA7_0556"
     CDS             574731..575462
                     /locus_tag="PSPA7_RS02640"
                     /old_locus_tag="PSPA7_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_034080840.1"
                     /db_xref="GI:730720908"
                     /translation="MLRCALLLLSLLLSCASPAANLRLVGDAWPPFVDARLPGNGLAV
                     ELVTTALKRAGFDASFQQVPWSRALYGVRSGDYDIALSAWYEPARSLYGQFSRAYLTN
                     RIRLLQRKGRGIEFTRLSDLRPYRIAVVRDYAYAPEFDRDSGLQKVNVTSFANAARML
                     EAGRVDLAVEDELALGFALNGELAYLRDKLEVLPTPLGENGLHLLVSLRNPRHEEIVD
                     GFDLAIRGMRDDGSYQRLLQRYGAR"
     gene            complement(575459..577660)
                     /locus_tag="PSPA7_RS02645"
                     /old_locus_tag="PSPA7_0555"
     CDS             complement(575459..577660)
                     /locus_tag="PSPA7_RS02645"
                     /old_locus_tag="PSPA7_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074036.1"
                     /db_xref="GI:501021369"
                     /translation="MPPTSLTHTLRRLWALDKFAYSLRVFLALAGAMLLCWWQGRIEL
                     LIPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPYPWLFVSGMALS
                     AFGMILLGALGERYAAIASATLILSIYTMIGVDQRGGEVADVWHEPLLLVAGAAWYGL
                     LSVLWNALFSNQPVQQSLARLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKV
                     VVALNQAKETILNRLGHGRPGPKVSRYLKLYFIAQDVHERASSSHYPYNRLAEAFFHS
                     DVLFRCQRLLNQQGKACQALARAIRLRQPFDYDDSEQALEDLQASLEHLRQQSNPAWK
                     GLLRSLGALAANLATLDRKLAGASNPDAIADEQDSALLDRSPRSLKDAFERLRQQLTP
                     TSLLFRHGLRMALALTAGYGVLHWIHPTQGYWILLTTVFVCQPNYGATRLRLVQRILG
                     TLVGLVAGWALIDLFPNPLVQSLFAVAAGVAFFATRSSRYTLATAAITLLVLFCFNQV
                     GDGYGLILPRLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLRQIMQQ
                     YATGKRDDLDYRTARRNAHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLTHTLLS
                     YLSGLGAHRENLPEDASDGLLQRAAERLSASLEEIAACLEQKRPVAIYSEEEEALAKE
                     LEQMPEEMDDGHRLVQTQLAHICRQLAPLRTLAAHLLKKELAGEQPLPGQP"
     gene            complement(577878..579254)
                     /locus_tag="PSPA7_RS02650"
                     /old_locus_tag="PSPA7_0558"
     CDS             complement(577878..579254)
                     /locus_tag="PSPA7_RS02650"
                     /old_locus_tag="PSPA7_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="WP_012074038.1"
                     /db_xref="GI:501021371"
                     /translation="MTSTVFSSLPLSADLLANLDSLGYREMTPIQAQSLPLILQGRDL
                     IAQAKTGSGKTAAFGLGLLAPLNPRYFGCQALVLCPTRELADQVAKEIRRLARAADNI
                     KVLTLCGGVPYGPQVASLEHGAHVVVGTPGRIQEHLRKGTLVLDGLNTLVLDEADRML
                     DMGFYDSIAEIIGQLPERRQTLLFSATYPDGIEKLAKAFMRDPQQVKVESLHTDSQIE
                     QRFFEIDPKQRMDAVVRLLQHFRPQSCVAFCQTRQQCQELADALKAHRISALALHGDL
                     EQRERDQVLTVFANRSCTVLVATDVAARGLDIAALETVINVELARDPEVHIHRIGRSG
                     RAGEKGLALSLVAPAEASRAQAIEDLQKQPLAWYALGQLKANPEPLLPPMSTLCIAGG
                     RKDKVRPGDLLGALTGDAGLPGSAVGKIAIFDFQAFVAIERGLAHQALKRLSEGRIKG
                     RSFKVRLL"
     gene            579602..579811
                     /locus_tag="PSPA7_RS02655"
                     /old_locus_tag="PSPA7_0559"
     CDS             579602..579811
                     /locus_tag="PSPA7_RS02655"
                     /old_locus_tag="PSPA7_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_003084710.1"
                     /db_xref="GI:489175182"
                     /translation="MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLA
                     EGQKVSFEVVQGQKGMQAERVQVIN"
     gene            579961..580485
                     /locus_tag="PSPA7_RS02660"
                     /old_locus_tag="PSPA7_0561"
     CDS             579961..580485
                     /locus_tag="PSPA7_RS02660"
                     /old_locus_tag="PSPA7_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074039.1"
                     /db_xref="GI:501021372"
                     /translation="MKPVQSRRLAFAALLSLSFSSASCHAAAEHWGWIEQSWLMPERM
                     QAKAKLDTGALTSSLDAKNIHRYKKDGERWVRFEVVLPTAGSKAPVSVTFERKVLRVI
                     KVRGAGGSDSRPVVAMDICLGDKLLREQFSLRDRGNMNYPVLLGRRTLDHLGAVDVSR
                     TFTRKPSCGALAAQ"
     gene            complement(580479..580853)
                     /locus_tag="PSPA7_RS02665"
                     /old_locus_tag="PSPA7_0560"
     CDS             complement(580479..580853)
                     /locus_tag="PSPA7_RS02665"
                     /old_locus_tag="PSPA7_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014602402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074040.1"
                     /db_xref="GI:501021373"
                     /translation="MAWLATLRRWARGLKTEVIALWLCSRHPHMPWPARLVALLVVAY
                     ALSPIDLIPDFIPLLGYLDDLLLVPLGIWLAIRLTPPALLAECRARAREVEARPRNPW
                     MTALIVLLWLALAAGLLRWFFY"
     gene            complement(580855..582288)
                     /locus_tag="PSPA7_RS02670"
                     /old_locus_tag="PSPA7_0562"
     CDS             complement(580855..582288)
                     /locus_tag="PSPA7_RS02670"
                     /old_locus_tag="PSPA7_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_003154664.1"
                     /db_xref="GI:489246499"
                     /translation="MSEPFQLTPRIARQLPWLVAVAFFMQALDGTILNTALPSMATSL
                     NENPLRMQAVVIAYLLTVALLIPASGWIADRFGTRRVFLGAVLLFSLGSLLCALSPSL
                     ELLVGARIVQGVGGALMMPVGRLVILRVYPRQDLVRVLSFVTIPGLLGPLAGPTLGGW
                     LVEYASWHWIFLINLPVGLLGCLVAMKLMPDLRSPLPSRFDSIGFLLFGGSMVLISIA
                     LEGLGELHLSHLRVVLLLVGGLVLLTAYWLRALRIDKPLFPPSLFQARTFAVGILGNL
                     FARLGSGALPFLTPLLLQVGLGYPPSTAGMTMIPLALFAMVAKPLAKPLLDFFGYRKL
                     LVGNTLILGCLIAGFGLVDQDTPYVWLLLHLSLLGAVNSLQFTAMNTLTLIDLQDSNA
                     SSGNSLMSVVVQLSISLGVACAAALLGGFQTDLDTGQDTVLGAFHATYVSVGLMSMLA
                     AAIFFQLGSEDGRTSPRRVDPEKDPDL"
     gene            582664..585462
                     /locus_tag="PSPA7_RS02675"
                     /old_locus_tag="PSPA7_0564"
     CDS             582664..585462
                     /locus_tag="PSPA7_RS02675"
                     /old_locus_tag="PSPA7_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ClpC"
                     /protein_id="WP_003154666.1"
                     /db_xref="GI:489246501"
                     /translation="MAQELCAICHERPAVARVSLVQNGQRRELALCELHYRQLMRQQR
                     MRSPLESLFGGGSPFDEIFSGFGEQSPVSPVRAREPEAVDIAEYFSKQTTEYLQRAAQ
                     VAAEFGKREVDTEHLLYALADADVVQAVLKQFGLSPADLKQYIEANAVRGAGKGEASE
                     DMTISPRVKSALQHAFGLSRELGHSYVGPEHLLLGLAAVPDSFAGTLLKKYGLTEQAL
                     RQKAVKVVGKGAEDGRVDGPSSTPQLDKFSRDLTRLAREGKLDPVIGRSKEVETTIEV
                     LARRKKNNPVLIGEPGVGKTAIVEGLAQRMVQGEVPEVLRDKRLVELNINAMVAGAKY
                     RGEFEERLKQVMDELQAAQSEIILFIDEVHTIVGAGQGGGEGGLDVANVLKPAMARGE
                     MNLIGATTLNEYQKYIEKDAALERRFQPVFVPEPTVEQTISILRGLRDKLEGHHKVTI
                     RDEAFVAAAELSDRYIGNRFLPDKAIDLIDQAAARVRIASTSRPAEIQELEAELAQLK
                     REQDYAASRKWYDEAKVFEKRIQERKEHLEQITERWQQTQGSKTEEVRVEDIAEIISR
                     LTGIPVTELTAEEREKLLRMEERLHQRVIGQQEAITAVSDAVRLARAGLRQGSRPIAT
                     FLFLGPTGVGKTELAKALAEVVFGDEDAMIRIDMSEYMERHAVSRLIGAPPGYVGYEE
                     GGQLTERVRRRPYSVILLDEIEKAHADVNNILLQVFDDGRLTDGKGRVVDFTNTIIIA
                     TSNLGSDLIMKNAQAGEFAQPPEKLKRELMNTLRGHFRPEFLNRLDEVIVFESLSKAQ
                     IEDIVRLQLERVKRAAHAQDIHLHIDDSLVGHLAEEAYQPEFGARELKRQIRQQLETR
                     LATAMLKGDVKEGETITFFHDARDGVGYRKGAAPKPAARKKAGAGETSKGRATATRKP
                     AAKKGAAAKGKADKPKAK"
     gene            585564..586142
                     /locus_tag="PSPA7_RS02680"
                     /old_locus_tag="PSPA7_0565"
     CDS             585564..586142
                     /locus_tag="PSPA7_RS02680"
                     /old_locus_tag="PSPA7_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074042.1"
                     /db_xref="GI:501021375"
                     /translation="MRVTTHATLAAALLLSAASAFAFNLGDAAKAVAGASQGDSAQVA
                     TTPQTSGLLGALTGQLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLSG
                     NNALAGLGGLGNMLGKNAGADKGLGSLLGNADSMGDVDKAFNTLGMDSGMTEKFAQVL
                     VDYFGKQGANSELLGSLSNLWGVSKAGGSSLL"
     gene            complement(586372..587259)
                     /locus_tag="PSPA7_RS02685"
                     /old_locus_tag="PSPA7_0566"
     CDS             complement(586372..587259)
                     /locus_tag="PSPA7_RS02685"
                     /old_locus_tag="PSPA7_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_003099939.1"
                     /db_xref="GI:489190573"
                     /translation="MRELLTGLTSSLLLLLNTLILIGPMMLIALLKLVLPGQRLKDLC
                     SRGVMWIAETWAEIDKWIFATCTPTVWDVRGAGDLRQDTSYLVVSNHQSWVDIPALIQ
                     VFNRRTPYFKFFLKKELIWVPFLGLAWWALEYPFMKRYSKAFLEKHPELKGKDLEITK
                     AACEKFKRIPVTVVNYLEGTRFSEQKKARQQSPYRHLLKPKAGGVAFVLAALGEQLDA
                     LLDVTVVYPSDKVPGFWDLLCGRVPKVIVDIQTRPIDPALWQGDYENDPVFRQYVQEW
                     VSRMWEEKDERIARLRQLR"
     gene            587402..587911
                     /locus_tag="PSPA7_RS02690"
                     /old_locus_tag="PSPA7_0567"
     CDS             587402..587911
                     /locus_tag="PSPA7_RS02690"
                     /old_locus_tag="PSPA7_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008095917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003154670.1"
                     /db_xref="GI:489246505"
                     /translation="MKRVLALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQAKMDT
                     GAYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNRSGED
                     EDEDRLSERPVIDLQVCLGGEMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDPAER
                     FVAGKPACK"
     gene            587996..588685
                     /locus_tag="PSPA7_RS02695"
                     /old_locus_tag="PSPA7_0568"
     CDS             587996..588685
                     /locus_tag="PSPA7_RS02695"
                     /old_locus_tag="PSPA7_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004365157.1"
                     /note="response regulator in two-component regulatory
                     system with CreC; CreB protein is phosphorylated by sensor
                     protein phospho-CreC; involved in catabolic regulation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012074043.1"
                     /db_xref="GI:501021376"
                     /translation="MPHILIVEDEAAIADTLLYALQAEGFATTWVPLAGEALALQERQ
                     PADLLILDVGLPDISGFEACKRLRRFSEVPVIFLTARDAEIDRVVGLEIGADDYVVKP
                     FSPREVAARVKAILKRMAPRPAPLEEAALHGPFQVDAERVRIHYHGAPLNLTRHEFRL
                     LQTLLGQPERVFSREQLLDALGVASEAGYERNIDSHIKSLRAKLRQVNARGEAIQTHR
                     GLGYSYSPDHA"
     gene            588685..590109
                     /locus_tag="PSPA7_RS02700"
                     /old_locus_tag="PSPA7_0569"
     CDS             588685..590109
                     /locus_tag="PSPA7_RS02700"
                     /old_locus_tag="PSPA7_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315077.1"
                     /note="part of a two-component regulatory system with CreB
                     or PhoB; involved in catabolic regulation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012074044.1"
                     /db_xref="GI:501021377"
                     /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVD
                     TANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASG
                     KVLLDSTGIAVGQDYSRWNDVYRTLRGQYGARSSREDPDDPDSSVMYVAAPIKDAGKI
                     IGVVSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTRYAQ
                     AISEGRRAELPRYRGGEMAQLAGAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRG
                     AAELLDGEMPAEQRARFVANIAGESERLQQLIERLLSLAQVEQRQGLEEVGPVDLREV
                     AEALLEGQAARIQRQGLTVEKRLDGPCAIRGERFLVRQALANLLDNALDFTPPGGRLR
                     LSAEVDGKGVALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQ
                     LHGGRLQVGNHEDGVEALLWLPRG"
     gene            590210..591568
                     /locus_tag="PSPA7_RS02705"
                     /old_locus_tag="PSPA7_0570"
     CDS             590210..591568
                     /locus_tag="PSPA7_RS02705"
                     /old_locus_tag="PSPA7_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074045.1"
                     /db_xref="GI:501021378"
                     /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEARDGVLQDI
                     ARSSSYSQRLTGPLLVVPYRRTVREWVTEEKTQKRVLQEREQRGELYFLPDRFALDGQ
                     MRTELRYRGIYQARLYHVDNKVGGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGI
                     ENALRLSLNGAGVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLTLLGSERLD
                     IVPVGRDSQVILKADWPHPSFGGEFLPSEREITAEGFTARWQTSFFATNMEEALRSCV
                     QEQRCDGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHP
                     IQYALVGLALAFFYLLLLSLAEHVGFELAYLASAGACVGLIGFYLCFVLRSVTRGLGF
                     SAGLAGLYGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDLPAVPA
                     KA"
     gene            591618..591920
                     /locus_tag="PSPA7_RS02710"
                     /old_locus_tag="PSPA7_0571"
     CDS             591618..591920
                     /locus_tag="PSPA7_RS02710"
                     /old_locus_tag="PSPA7_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003123893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003154248.1"
                     /db_xref="GI:489246079"
                     /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPL
                     AHAMLVLMPGGFWEGLSGIEDAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
     gene            591917..592102
                     /locus_tag="PSPA7_RS02715"
                     /old_locus_tag="PSPA7_0573"
     CDS             591917..592102
                     /locus_tag="PSPA7_RS02715"
                     /old_locus_tag="PSPA7_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074046.1"
                     /db_xref="GI:501021379"
                     /translation="MNGYVGLRDDRRDGERLAARIGLLFPGPSAAWLQRAERLRRQQA
                     SAGPGVRRGSPASTGAG"
     gene            complement(592065..592685)
                     /locus_tag="PSPA7_RS02720"
                     /old_locus_tag="PSPA7_0572"
     CDS             complement(592065..592685)
                     /locus_tag="PSPA7_RS02720"
                     /old_locus_tag="PSPA7_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_012074047.1"
                     /db_xref="GI:501021380"
                     /translation="MNATHTLFYAAASPFVRKVLVLLHETGQRERVVLEEAMPTPVAP
                     IRQLNASNPAGKIPALRLPDGQVLHDSRVICDYFDQQHVGEPLIPREGSARWRRLTIA
                     SLADAILDAAVLVRYEAFVRPEEKRWDAWLDAQREKIARSLAWLESDCIAELRARFDI
                     AAIGVACALGYLDLRQPEWDWRGHYPQLAAWFAEVSQRPSMQATRA"
     gene            complement(592704..593654)
                     /locus_tag="PSPA7_RS02725"
                     /old_locus_tag="PSPA7_0574"
     CDS             complement(592704..593654)
                     /locus_tag="PSPA7_RS02725"
                     /old_locus_tag="PSPA7_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lyase"
                     /protein_id="WP_012074048.1"
                     /db_xref="GI:501021381"
                     /translation="MRCLSSPLLGLLVGLSLNGAALAGEQYYPLDKGSAPYAVAPTAQ
                     GPVWFGAAGGHALGRLDPTSGASVQVPLGEGARPRAIVSDESGNAWVLDSGLDAILRV
                     GGERLGSERFALPAKAAPVGLEAAAFDDDGRLWFTGSRGFHGRLDPQRRVVEVWPAPQ
                     GKAASGICVTPDGEVWYAQDDALVHVDPLDGSAERLPAPEGTKALRGLGADSIGRLWA
                     SDSGGARLYRYDPSDASWQSWPLPDSQARPDSLRVDAMDRVWLHDAASGALLRFDSEQ
                     ATFRVLPSDRPAPGNALLGGRPGETWSAEPATDRLRVVRD"
     gene            593740..594597
                     /locus_tag="PSPA7_RS02730"
                     /old_locus_tag="PSPA7_0575"
     CDS             593740..594597
                     /locus_tag="PSPA7_RS02730"
                     /old_locus_tag="PSPA7_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074049.1"
                     /db_xref="GI:501021382"
                     /translation="MPTVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLG
                     VESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMP
                     AACLSLLRIRGGEVELLNIGDSRILVEGADGQVRSFGESALHELDRQSLAHFCRMREE
                     HPQWDHAELFKASRPRVRQNRQLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVL
                     MTDGFDRLVEPFRRYTDEQLLRRLEEVGVSALLDELRQIEQGDDQALAFPRFKIHDDA
                     SALWGRIAG"
     gene            complement(594767..597187)
                     /locus_tag="PSPA7_RS02735"
                     /old_locus_tag="PSPA7_0576"
     CDS             complement(594767..597187)
                     /locus_tag="PSPA7_RS02735"
                     /old_locus_tag="PSPA7_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012074050.1"
                     /db_xref="GI:501021383"
                     /translation="MPRPTFRPGLLAIAIAIALAVPAPFLHAAPAEQASVRDYRIAAG
                     PLAGTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALRGSGLELVENAG
                     GTYSLRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISV
                     ATRQQMADRAVHNLDDAVRYMPGVVASSFGSDTRSDWLKVRGFKPTQFLDGLPMAVGV
                     YNNPKLETWNLERVALLRGPASSVYGQTPPGGMLDMVSLRPQNVASHEVKAEVGNYNH
                     KQVSFDSTGPLDDEGRFLYRLSGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTF
                     LGQFNRDDTAATSQFLPLRGTKYDAPFGKISHHKNLGDPDWDFYDRTYYWLGYSFERR
                     INDVWQFRQNLRYLRNDLSFQTLTPTSSIDAASADGTLQRMTTSVDEDVSQFVVDNNF
                     QADFETGALRHTLLLGIDHNRTRTDYTSIYNFTGVPPTNVNNPIYGQPIPKPSRSSAF
                     YDYRQKTYQTGLYLQDQIALDNWRLTLGGREDWVHAGATFYNQNDATNTSRDKKFSAN
                     AALSYIFDNGLAPYLSYAESFQPSTGADDIGSNKMFKPTEGKQWELGVKYQPVGSDSL
                     FTAAVYDLRQENVRVTDNINGTPTTSQAGEVKVSGIELEATSNVTENLKMIGAYSYTD
                     TEVKKGQYAGNRLQQAPRNQASLWADYTWHEGALNGFSVGAGARYVGSTYGDQANTYD
                     GYAGSYTLYDAAVRYDLGQLNGSLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSV
                     VGSVSYKW"
     gene            complement(597290..598261)
                     /locus_tag="PSPA7_RS02740"
                     /old_locus_tag="PSPA7_0577"
     CDS             complement(597290..598261)
                     /locus_tag="PSPA7_RS02740"
                     /old_locus_tag="PSPA7_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012074051.1"
                     /db_xref="GI:501021384"
                     /translation="MNPDERQTAVHARVLDEAIAWQLLLDSGEAHPDDHRAFHRWYAA
                     HPEHERAWEQLGGLDRHLARAANGPARNALLSGNARFKRRLRRLGGSALGLLLALGVG
                     LGVANRYVPVRYLLADAYSATGEQRELTLPDATHVRLNSRSAIDVRFDGERRQVVLLA
                     GEILVETAHGDPRPFVVSSADGDMRALGTRFLVRREEPGTRLTVLQSAVAARAETLSE
                     ERVIKEGQQVLILPQGLQASAAAPALAGAWAQGMLVVENARLADLVAELGRYSPALLR
                     VDPSIADLRVTGSFPLKDTRLALQALEPSLPVRSVRHNAWWFEVVPR"
     gene            complement(598258..598776)
                     /locus_tag="PSPA7_RS02745"
                     /old_locus_tag="PSPA7_0578"
     CDS             complement(598258..598776)
                     /locus_tag="PSPA7_RS02745"
                     /old_locus_tag="PSPA7_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_012074052.1"
                     /db_xref="GI:501021385"
                     /translation="MAAGEVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDT
                     FVRLLGRPELPGLREPRAFLAKVARGLLIDHFRRAALEQAYLAELALVPEAEQPSAEE
                     RYLILEDLREIDRLLGTLSLKARSAFLYNRLDGMPHAEIAERLGVSVPRVRQYLAQGL
                     RQCYIALYGEPR"
     gene            598945..599694
                     /locus_tag="PSPA7_RS02750"
                     /old_locus_tag="PSPA7_0579"
     CDS             598945..599694
                     /locus_tag="PSPA7_RS02750"
                     /old_locus_tag="PSPA7_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003105233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_012074053.1"
                     /db_xref="GI:501021386"
                     /translation="MAEPLLIIGSYLSPYVRKVLVLLELKGVAYRIDPIVPFFGDEAF
                     ERLSPLRQIPVLVDGDFVLNDSSVICQYLEERYPQPSLYPADLGQRAQARWLEEYADS
                     RLGQVIIWQLFHQQVINRGIWKREPDQAVLQRTYDEDLPSVCAYLEGRTPERGWLLGE
                     LSIADVAIACLFRNAQLARYQVDGERWPRLARLLADAFALPVFQRLARFENASAQTPV
                     AEQRKVLGEAGAPLSATSHGREQPVRGPMSR"
     gene            599836..600237
                     /locus_tag="PSPA7_RS02755"
                     /old_locus_tag="PSPA7_0580"
     CDS             599836..600237
                     /locus_tag="PSPA7_RS02755"
                     /old_locus_tag="PSPA7_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003111102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_023442668.1"
                     /db_xref="GI:557744427"
                     /translation="MNVPEGFQPLFRSSPLLDLLGPFFCRRDAQRQLVVALRIEEKHC
                     NHGGSAHGGLLSTLADVGLGYAMAFSREPPQPMVTVGLRLDFCGVARVGDWLEVHTRV
                     DKLGQRMAFASARLHSGERLVASASGVFHLP"
     gene            600287..600856
                     /locus_tag="PSPA7_RS02760"
                     /old_locus_tag="PSPA7_0581"
     CDS             600287..600856
                     /locus_tag="PSPA7_RS02760"
                     /old_locus_tag="PSPA7_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_012074054.1"
                     /db_xref="GI:501021387"
                     /translation="MPKKSNAAERIVHATASLLASRGYFGTGLSDIIARAEAPKGSLY
                     HYFPQGKPQIASAAIGFVGAEVETFLDRAGATAPHARNVLREFTATLRGWLERSAFEE
                     ACPVFSTTLSIDAELAPVHAECRRALRAWHAGIERALRADGMAEKAAGSRAWLILAAL
                     EGAVGVARAERSVDALDAIEEELRALLPA"
     gene            complement(600882..602429)
                     /locus_tag="PSPA7_RS02765"
                     /old_locus_tag="PSPA7_0582"
     CDS             complement(600882..602429)
                     /locus_tag="PSPA7_RS02765"
                     /old_locus_tag="PSPA7_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017001561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_034080885.1"
                     /db_xref="GI:730721015"
                     /translation="MRAAEFSAARLDLGTPASLDCLPRASHHAGSELPPLSPRLYSAD
                     LAPSKAEGRRWGRYSLFALWTNDVHNIANYSFAIGLFALGMSGAQILAALALGALMVY
                     GLMNLSGYMGQKTGLPYPVMCRIAFGIHGAQLPALIRAVIAIAWFGIQTYLASIVLRV
                     LLTAIWPGLAAYDQDAILGLSSLGWATFVAIWCVQLLIFAYGMEMVRRYESFAGPVIL
                     LTVAALAAWMYLRAGASIAWSSGEPMSGSQMWLKIFGGAAFWVTLYGTMILNFCDFAR
                     GCPDKRTISVGNFWGLPVNILLFGLFAVVLAGAQFRIDGQLIQSPTDIVAAIPDTAFL
                     VLASLALLIVTVAVNIMANFVAPAYVLTNLAPNLLNFRRAGLISATIAVLILPWHLYN
                     SPGVILYFLGGLGALLGPLYGIIMVDYYLVRKGRVNLPELYTESRAGAYHYARGVNPR
                     AIAAFVPAAIISTLLALLPAFAELSPFSWFFGAGLAGLIHYALANRRAAYREVSGEAI
                     AVDSVQH"
     gene            complement(602957..603883)
                     /locus_tag="PSPA7_RS02770"
                     /old_locus_tag="PSPA7_0583"
     CDS             complement(602957..603883)
                     /locus_tag="PSPA7_RS02770"
                     /old_locus_tag="PSPA7_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004365171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041025279.1"
                     /db_xref="GI:751334181"
                     /translation="MHPLLRRLDLNLLLVFDSLYRHRNVGTAAGELAISASAFSHALG
                     RLRQGLDDELFLRQGNRMQPTQRAEHLAGAVAAALRALGEGLEEWRPFVPGQSQRTFV
                     FATTDYTAFALLPPLMDRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHE
                     RLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLL
                     ARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAAQALAEAAGLALYPAPFDIPPY
                     VLRLYSHVQHAGRDAHAWMIGQLKGLDISRTG"
     gene            603971..604447
                     /locus_tag="PSPA7_RS02775"
                     /old_locus_tag="PSPA7_0584"
     CDS             603971..604447
                     /locus_tag="PSPA7_RS02775"
                     /old_locus_tag="PSPA7_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_003152524.1"
                     /db_xref="GI:489244337"
                     /translation="MTLEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSL
                     FAEGSPTRALMCLSEGRPIGYAVYFYSYSTWLGRNGIYLEDLYVTPECRGVGAGRRLL
                     RELAREAVANDCGRLEWSVLDWNQPAIDFYRSIGALPQDEWVRYRLDGEALRRMAQ"
     gene            complement(604713..606890)
                     /locus_tag="PSPA7_RS02780"
                     /old_locus_tag="PSPA7_0585"
     CDS             complement(604713..606890)
                     /locus_tag="PSPA7_RS02780"
                     /old_locus_tag="PSPA7_0585"
                     /EC_number="2.3.3.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016490408.1"
                     /note="catalyzes the formation of malate from glyoxylate
                     and acetyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase G"
                     /protein_id="WP_012074057.1"
                     /db_xref="GI:501021390"
                     /translation="MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADSFWTGAEAVIN
                     DLAPKNKALLAKRDDLQAKINGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGT
                     QNVDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGY
                     NKVRGDKVIAFARAFLDEAAPLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQF
                     LAFQGDAAKPQAVLLKHNGLHFEIQIDPSSPIGQTDAAGVKDVLMEAALTTIMDCEDS
                     VAAVDADDKVVIYRNWLGLMKGNLAEEVSKGGTTFTRTMNPDRVYTGADGSELTLHGR
                     SLLFVRNVGHLMTNDAILDKHGNEVPEGIQDGLFTSLIAIHNLNGNTSRKNSRTGSVY
                     IVKPKMHGPEEAAFTNELFGRVEDVLGLPRNTLKVGIMDEERRTTVNLKACIKAAKDR
                     VVFINTGFLDRTGDEIHTSMEAGAVVRKGAMKSEKWIGAYENNNVDVGLATGLQGKAQ
                     IGKGMWAMPDLMAAMLEQKIGHPLAGANTAWVPSPTAATLHALHYHKVDVFARQAELA
                     KRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNAQGILGYVVRWIDQGVGCSKVPDIN
                     DVGLMEDRATLRISSQLLANWLRHGVISQEQVVESLKRMAVVVDRQNASDPSYRPMAP
                     DFDDNVAFQAALELVVEGTKQPNGYTEPVLHRRRREFKAKNGL"
     gene            607197..607640
                     /locus_tag="PSPA7_RS02785"
                     /old_locus_tag="PSPA7_0586"
     CDS             607197..607640
                     /locus_tag="PSPA7_RS02785"
                     /old_locus_tag="PSPA7_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003105215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_012074058.1"
                     /db_xref="GI:501021391"
                     /translation="MPVHAASLADLADLVPLFSAYLDFYEVPAPEEQVRAFLAERLRQ
                     GDSTLFLARDAEARALGFVQLYPLFASLALRPSWLLSDLFVRPEARRQGVGEALMNQA
                     RRFAESMGACGLQLETAKTNHAGQSLYERLGYVRDEQFYTYWLQL"
     gene            607672..608187
                     /locus_tag="PSPA7_RS02790"
                     /old_locus_tag="PSPA7_0587"
     CDS             607672..608187
                     /locus_tag="PSPA7_RS02790"
                     /old_locus_tag="PSPA7_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein R"
                     /protein_id="WP_012074059.1"
                     /db_xref="GI:501021392"
                     /translation="MDHLVLTVIATDHPGLVERIAQCIASHGGNWLESRMSRMAGQFA
                     GILRVAVPAEGYDELVEGLQGLSKHGIRVLLAESGIEPVCSWKPIRLDLVGNDRPGIV
                     RDITRLLAEHGVNLESLATEVRPAPMSSEPLFHAEALLAVPLTLPLDTLRERLEDLAD
                     DLMVELVLEAS"
     gene            complement(608876..609772)
                     /locus_tag="PSPA7_RS02795"
                     /old_locus_tag="PSPA7_0588"
     CDS             complement(608876..609772)
                     /locus_tag="PSPA7_RS02795"
                     /old_locus_tag="PSPA7_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074060.1"
                     /db_xref="GI:501021393"
                     /translation="MATANLRRGYVLGLTAYVIWGLFPLYFKLLERIPAVEIIVQRAV
                     WSALFGAVLLLFWKHPGWWRELRQNPRRFVVLAASGLLIASNWMTYVWAVNNGHMLEA
                     SLGYYINPLINVMLGMLLLKERLRPLQWLAVALASLGVAQQVWQLGSLPWVSLVLALT
                     FGFYGLIRKQAPVAALPGLVVETWLLLPLALVWLLLFADGPTSEAAFWSTPEALWVVA
                     AGPVTLVPLVCFNAAARHLPYATLGFLQYLAPTLVLLQAILLFGEHLDSSRLTAFAFI
                     WLALAVYSLDAWRSLRRLPQPG"
     gene            complement(609983..610957)
                     /locus_tag="PSPA7_RS02800"
                     /old_locus_tag="PSPA7_0589"
     CDS             complement(609983..610957)
                     /locus_tag="PSPA7_RS02800"
                     /old_locus_tag="PSPA7_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074061.1"
                     /note="catalyzes the phosphorylation of protein substrates
                     at serine and threonine residues in vitro; specific
                     substrate in vivo has not been identified yet; plays a
                     role in long-term cell survival and expression of surface
                     appendages; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_012074061.1"
                     /db_xref="GI:501021394"
                     /translation="MSHPFDSLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIE
                     DDEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLTREGESLFGFAGFRFAL
                     FPRRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALTVDNFGHASLATLLEG
                     DFIPRSLLPAYESVARDLLRRVDALFAEVPYQPIRLHGDCHPGNLLCRDEVYHMVDLD
                     DCRMGPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHY
                     SAWLARRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
     gene            complement(611019..611777)
                     /locus_tag="PSPA7_RS02805"
                     /old_locus_tag="PSPA7_0590"
     CDS             complement(611019..611777)
                     /locus_tag="PSPA7_RS02805"
                     /old_locus_tag="PSPA7_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003103305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ModE family transcriptional regulator"
                     /protein_id="WP_012074062.1"
                     /db_xref="GI:501021395"
                     /translation="MSALSTLAQHVTRRPQRIALLAQIAELGSITRAAKAVGISYKGA
                     WDAIDELNNLADRPLVERSVGGKGGGGARLTAEGERLLALYRRLEALQAQVLQAAEDA
                     EDLNLIGRLMLRTSARNQLHGRVLSIHGEGFHDRIAIELPGQQRIEALITRTSTEQLE
                     LGRGRPVLALIKAGWLEVDLEPRDDQPNQLHGTLEEILAAKAGPSEVRIGLGSGLTLC
                     ALLSGERLASLGLKKGRKVVVSVDPAQVLLGTPL"
     gene            complement(611845..612165)
                     /locus_tag="PSPA7_RS02810"
                     /old_locus_tag="PSPA7_0591"
     CDS             complement(611845..612165)
                     /locus_tag="PSPA7_RS02810"
                     /old_locus_tag="PSPA7_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074063.1"
                     /note="required for high salt suppression of motility;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074063.1"
                     /db_xref="GI:501021396"
                     /translation="MRALLVAACLSLGGCSHFAEDDWLGQDKALHFASSAALAAAGMQ
                     AAHERGLRGGRQARFGLSFSLAFGIGKELHDSRAAGSGWSWKDLAWDVAGSAAGYSLY
                     RAAD"
     gene            complement(612207..612932)
                     /locus_tag="PSPA7_RS02815"
                     /old_locus_tag="PSPA7_0592"
     CDS             complement(612207..612932)
                     /locus_tag="PSPA7_RS02815"
                     /old_locus_tag="PSPA7_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_012074064.1"
                     /db_xref="GI:501021397"
                     /translation="MSLPLQYLPRWLAPAPACLLCAARSDQPPRPLCRACATELPWSR
                     RQCRRCALPLPLDGQLCGECLRRPPAYEQVIAPWRYAFPLDSLINRFKHQAAWPLGRL
                     LGELLAEHLRQRYAEGLPRPVRLLPVPLAPRRERRRGFNQARLLADWLAGELRLRCAP
                     HLLRRVLDTPAQQGLDAALRRRNLRHAFALAPGKEVRGLHLALVDDVLTTGATAECLA
                     RLLRRAGAARVDVYCLARTPKPG"
     gene            complement(613071..613364)
                     /locus_tag="PSPA7_RS02820"
                     /old_locus_tag="PSPA7_0593"
     CDS             complement(613071..613364)
                     /locus_tag="PSPA7_RS02820"
                     /old_locus_tag="PSPA7_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016252903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_003157986.1"
                     /db_xref="GI:489249878"
                     /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWSAMDDFLHGLA
                     RAIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIIGGIIWTVLGLIVMSWLIH"
     gene            complement(613418..614335)
                     /locus_tag="PSPA7_RS02825"
                     /old_locus_tag="PSPA7_0594"
     CDS             complement(613418..614335)
                     /locus_tag="PSPA7_RS02825"
                     /old_locus_tag="PSPA7_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012074065.1"
                     /db_xref="GI:501021398"
                     /translation="MALTLRQVRYFIATAEFGQISQAAVHLNISQSAVTSAIQELEAM
                     LGVALFTRTAQGMNLTDSGRHFLNHAYSIQRSVDDALASPLPDTRVGGSLKVAASYTV
                     MGYFLPHHLQRLAQWYPELRLQLFEDERASIERGLLDGRYDIAVLLTGNLTDPGIAAE
                     TLFNSERRLWLPSRHPLGEKANLGLADVAGEPYIMLTVDEAGQSALRYWERSGHRPRV
                     ILHTSSVEAVRSMVANGSGVAILSDLVYRPWSLEGKRIETLSLVDPVPSMSVGLAWRR
                     DAEPSAGMRALRENFRQSFLAPQQSSSRR"
     gene            614464..615222
                     /locus_tag="PSPA7_RS02830"
                     /old_locus_tag="PSPA7_0595"
     CDS             614464..615222
                     /locus_tag="PSPA7_RS02830"
                     /old_locus_tag="PSPA7_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157984.1"
                     /db_xref="GI:489249876"
                     /translation="MTEVDLNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGD
                     PSSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIQAPAIELVNDMLYQLGALREFAR
                     LEGLALQHVKPHGALYMHLARDEAAARLFVETLQRLEPELLLYCMPGSATWRIGRELG
                     QPLVREFYADRDYDRSGSIVFTRRVAALDPRQVADKVLRACREGKVRTVEGEDLDIAF
                     DSVCIHSDTPGALELVAGTRAHLEAAGIRIKAPR"
     gene            615287..615535
                     /locus_tag="PSPA7_RS02835"
                     /old_locus_tag="PSPA7_0596"
     CDS             615287..615535
                     /locus_tag="PSPA7_RS02835"
                     /old_locus_tag="PSPA7_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157983.1"
                     /db_xref="GI:489249875"
                     /translation="MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVM
                     KQFSEVQAGQAGVLQAFRVADGEAIEPGQVLAVIASAE"
     gene            615546..616919
                     /locus_tag="PSPA7_RS02840"
                     /old_locus_tag="PSPA7_0597"
     CDS             615546..616919
                     /locus_tag="PSPA7_RS02840"
                     /old_locus_tag="PSPA7_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074066.1"
                     /note="an AccC homodimer forms the biotin carboxylase
                     subunit of the acetyl CoA carboxylase, an enzyme that
                     catalyzes the formation of malonyl-CoA, which in turn
                     controls the rate of fatty acid metabolism; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxylase"
                     /protein_id="WP_012074066.1"
                     /db_xref="GI:501021399"
                     /translation="MHKRLNKLLVANRGEIAVRIVRAAQALGIPTVAVCSEADRDSLA
                     ARLADEVRLIGPARADQSYLDSEAILAAARETGADSIHPGYGFLSENPAFAEAVQAAG
                     LVFVGPDAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELDDLDAALACAEEVGYPLLV
                     KASAGGGGRGIRIARDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILG
                     DGERVVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTL
                     EYLFDAHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEEIRLN
                     GAALEMRINAEDPARNFFPSPGTVERLAWPKGEGVRVDSHLYPGYRVPPYYDSLLAKL
                     IVHGRDRSEAFTRARQALERTELAGMATTLPLHRWLLADARVQAAQFDTGTLETWLAE
                     RAVALET"
     gene            616921..617799
                     /locus_tag="PSPA7_RS02845"
                     /old_locus_tag="PSPA7_0598"
     CDS             616921..617799
                     /locus_tag="PSPA7_RS02845"
                     /old_locus_tag="PSPA7_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="WP_012074067.1"
                     /db_xref="GI:501021400"
                     /translation="MHANIRYSFGGDEHLFAEVAESMSLEAFFRGMAISRAIESLQLP
                     GVLDVCLANASFQVRFDPDRLAPQALLETVRGLEAEAVAARSIETRIVEVPVLYNDPW
                     THETLMRFRDRHQDPTSTDLEYAARINGYADVQAFIQAHSGTPWFVSMVGFVAGLPFM
                     YQMVERERQLQVPKYLRPRIDTPKLTLGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDP
                     RQGLPYLAESMVFFRAGDIVQFRPIERTEYERMAAEVEAGTFDLRIRPVSFDLDAFLA
                     DPRGCTQRLQEVLYVD"
     gene            617789..618766
                     /locus_tag="PSPA7_RS02850"
                     /old_locus_tag="PSPA7_0599"
     CDS             617789..618766
                     /locus_tag="PSPA7_RS02850"
                     /old_locus_tag="PSPA7_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="WP_012074068.1"
                     /db_xref="GI:501021401"
                     /translation="MSIKVLKPGLASSVQDAGREGYYHLGIPPSGALDQYALRVANRL
                     VGNSADAAVLEFALMGPQLEFQRDALVAVSGARMQPRLDGQDMPLDTSFRVRAGQVLE
                     FGYPTAGARGYLAVAGGIDVPLVLGSRSTYGLGAIGGYLGRRLQTDDLLPLGEPQAQA
                     REGLALPPSLGLALEKEVILRVVPGLYYHRLTAEAAERFFADTWTVGSEADRTGYRYK
                     GGQPLAFEPREQPFGAGSDPSNIVDACYPIGSIQVPGGLEPIVLHRDAVSGGGYAMIG
                     TVISADLDLIGQLQPNNRARFVAVTLEQAMQARAQYRQRLRRLELMGQG"
     gene            618955..620013
                     /locus_tag="PSPA7_RS02855"
                     /old_locus_tag="PSPA7_0600"
     CDS             618955..620013
                     /locus_tag="PSPA7_RS02855"
                     /old_locus_tag="PSPA7_0600"
                     /EC_number="2.8.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_012074069.1"
                     /db_xref="GI:501021402"
                     /translation="MSASAAVATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAYFDPN
                     RVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRF
                     CMGAAWKHPSAKDMPYVLEMVKGVKRLGLETCMTLGRLTQEQTQALADAGLDYYNHNL
                     DTSPEFYGNIITTRTYGERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANL
                     PEHPESVPINMLVKVKGTPLAEEKDVDPFDFIRTLAVARIMMPKSHVRLSAGREQMNE
                     QMQALAFMAGANSIFYGEKLLTTKNPQAEKDMQLFARLGIKPEEREEHADEVHQAAIE
                     QALVEQRDSQLFYNAASA"
     gene            620119..621324
                     /locus_tag="PSPA7_RS02860"
                     /old_locus_tag="PSPA7_0601"
     CDS             620119..621324
                     /locus_tag="PSPA7_RS02860"
                     /old_locus_tag="PSPA7_0601"
                     /EC_number="2.3.1.47"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_012074070.1"
                     /db_xref="GI:501021403"
                     /translation="MSFDLASRLAARRAEDLYRQRPLLQSAQGPDVVVDGQPLLAFCS
                     NDYLGLASHPEVIAALRAGAERWGVGGGASHLVVGHSGPHHELELALAEFTGRPRALL
                     FSTGYMANLGAVTALVGKGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDPASLAARL
                     DKAEGNTLVVTDGVFSMDGNLADLPALAAVAQARGAWLMVDDAHGFGPLGAAGGGIVE
                     HFGLGQEQVPVLIGTLGKGFGTAGAFVAGSEELIETLVQYARPYIYTTSQPPAVACAT
                     LKSLELLRRESWRREHLAALIARFRRGAEALGLTLMDSFTPIQPILVGGSRQAVALAD
                     MLRARGIMVGAIRPPTVPANSARLRVTLSAAHSEAQVDRLLEALGESWRQLSSSLLAE
                     IEAEEGDDA"
     gene            621317..622039
                     /locus_tag="PSPA7_RS02865"
                     /old_locus_tag="PSPA7_0602"
     CDS             621317..622039
                     /locus_tag="PSPA7_RS02865"
                     /old_locus_tag="PSPA7_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012074071.1"
                     /db_xref="GI:501021404"
                     /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLAD
                     AADWLDELDDNLPRDSWLAGWSLGGMLASELAARRGDDCRGLLTLASNPCFRVREDWP
                     NAMPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVA
                     GLQLLGQLDTRAALENFRGPQLHLFAGADALVPVAAAEALLEWLPDVEVATLAASHGL
                     PLECPDEVAGAILRFLREGDDA"
     gene            622032..622856
                     /locus_tag="PSPA7_RS02870"
                     /old_locus_tag="PSPA7_0603"
     CDS             622032..622856
                     /locus_tag="PSPA7_RS02870"
                     /old_locus_tag="PSPA7_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-ACP O-methyltransferase"
                     /protein_id="WP_012074072.1"
                     /db_xref="GI:501021405"
                     /translation="MPDLSAPLLAPHGVAALPDKRQVAASFSRAAASYDAVAELQRGV
                     GESLLAALPEGFAPRRWVDLGCGTGYFSRALAQRFGGGEGLAVDIAEGMLRHARARGG
                     ASHFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCV
                     GTLGELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLVLRHEDRVLHFPDLRSLT
                     HELKALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPGGLPATYRVVFGVLRKDS"
     gene            622860..623546
                     /locus_tag="PSPA7_RS02875"
                     /old_locus_tag="PSPA7_0604"
     CDS             622860..623546
                     /locus_tag="PSPA7_RS02875"
                     /old_locus_tag="PSPA7_0604"
                     /EC_number="6.3.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent dethiobiotin synthetase BioD"
                     /protein_id="WP_012074073.1"
                     /db_xref="GI:501021406"
                     /translation="MPAFFVTGTDTEIGKTTIAAGLLHAARSAGLSTAAAKPVASGCE
                     ATAQGLRNGDALALLGECSLALAYEQVNPLAFEPAIAPHLAAREAGVELSAARLHDAV
                     REVLALRADFTLVEGAGGWRVPLQGRENLSDLARLLGLPVVLVVGVRLGCINHALLSA
                     EAILGDGLALAGWVANIVDPATSRLEENLATLAERLPAPCLGRVPRLADAGPAAVAAH
                     LDLRPLGIGL"
     gene            623656..623886
                     /locus_tag="PSPA7_RS02880"
                     /old_locus_tag="PSPA7_0605"
     CDS             623656..623886
                     /locus_tag="PSPA7_RS02880"
                     /old_locus_tag="PSPA7_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015649735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003153351.1"
                     /db_xref="GI:489245174"
                     /translation="MEISGNAFVSGLNTLQSGSARVAQAGSEIARNAVEARSPQAEQM
                     LELTRGKLEAQSGARVIEVADETLGTLIDTHA"
     gene            624224..626029
                     /locus_tag="PSPA7_RS02885"
                     /old_locus_tag="PSPA7_0606"
     CDS             624224..626029
                     /locus_tag="PSPA7_RS02885"
                     /old_locus_tag="PSPA7_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019339899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_003153352.1"
                     /db_xref="GI:489245175"
                     /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGAEDATPDMVNAILE
                     EGAKFCEQVIAPLNRVGDLEGCTWSAEGVKTPSGFKEAYQQFVEGGWPSLAHDVEHGG
                     QGLPESLGLAISEMVGQANWSWGMYPGLSHGAMNTLHAHGTAEQQATYLTKLVSGEWT
                     GTMCLTEPHCGTDLGMLRTKAEPQADGSYKVTGTKIFISAGEHDMADNIVHIVLARLP
                     DAPQGTKGISLFIVPKFLPNAEGNAGERNAVSCGSIEHKMGIHGNATCVMNFDAATGF
                     LIGPPNKGLNCMFTFMNTARLGTALQGLAHAEVGFQGGIAYARERLQMRSLTGPKAPE
                     KPADPIIVHPDVRRMLLTMKAFAEGNRAMLYFAAKQVDIVQRSQDEEQKKAADSMLAF
                     LTPIAKAFMTEVGFESANHGVQIYGGHGFIAEHGMEQNVRDSRISMLYEGTTGVQALD
                     LLGRKVLMTQGEALKGFTKIVHKFCQANEANEAVKEFVAPLAQLNKEWGDLTMKVGMA
                     AMKDREEVGAASVDYLMYSGYACLAYFWADMARLAAEKLAAGTGEEAFYKAKLQTARF
                     YFQRILPRTRAHVAAMLSGANNLMEMAEEDFALGY"
     gene            626242..628038
                     /locus_tag="PSPA7_RS02890"
                     /old_locus_tag="PSPA7_0607"
     CDS             626242..628038
                     /locus_tag="PSPA7_RS02890"
                     /old_locus_tag="PSPA7_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019484657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_012074074.1"
                     /db_xref="GI:501021407"
                     /translation="MPEYKAPLRDVRFLIDDVFDFHGHYQALGASDATPDMVAAILEE
                     GSKFCEQVLAPLNRSGDEEGCHFDNGAVTTPKGFKEAYAQYVEGGWNGVASDPAYGGQ
                     GLPHSLGLLLSEMIGASNVSWGMYPGLTRGAMSAIHAHGSQAQKDTYLPRMTAGTWTG
                     TMCLTEPHCGTDLGIIKTRAVPNADGSHSISGTKIFISAGEHDLSENIVHLVLAKLPD
                     APAGTKGISLFIVPKFLPDAEGNVGARNAVSCGSIEHKMGIKASATCVMNFDGATGYL
                     IGEPNKGLHCMFTMMNHARLGTGMQGLCLGETSYQGAVRYARERLQMRSLSGPKAPDK
                     PADPIIVHPDVRRMLLTMKAFNEGNRALAYFTAQLLDTEHLSQDAAERERAADLLAFL
                     TPICKAFMTETGQEVTNLGMQVYGGHGYIREWGMEQLVRDCRIAQIYEGTNGIQALDL
                     LGRKVLGSQGKLLRGFTKLVHQLCQAQAGHPQLKGQVAQLAALNAQWGELTQQVGLAA
                     MKNADEVGAASVDYLMFSGYVTLAYFWLRIALVAREKLDAGSGEAAFHEAKLATADFY
                     FSRLLPRTAAHAAAIQAGAAGLMSLSAEQFSL"
     gene            628310..630088
                     /locus_tag="PSPA7_RS02895"
                     /old_locus_tag="PSPA7_0609"
     CDS             628310..630088
                     /locus_tag="PSPA7_RS02895"
                     /old_locus_tag="PSPA7_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019484658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_012074076.1"
                     /db_xref="GI:501021409"
                     /translation="MADYKAPLRDMRFVLNEVFEVSRLWTQLPALADVVDAETAAAIL
                     EEAGKVTAGTIAPLNRPGDEEGCQWNAGAVSTPAGFPEAYRTYAEGGWVGVGGDPAYG
                     GMGMPKVISAQVEELVNSANLSFGLYPMLTAGACLALNAHASDELKDKYLPNMYAGTW
                     AGSMCLTEPHAGTDLGIIRTRAEPQADGSYKISGTKIFITGGEHDLTENIIHLVLAKL
                     PDAPAGPKGISLFLVPKVLVNADGSLGERNSLGCGSIEHKMGIKASATCVMNFDGATG
                     WLVGEVNKGLAAMFTMMNYERLGVGIQGLATGERSYQSAIEYARERIQSRAPTGPVAK
                     DKAADPIIVHPDVRRMLLTMKALNEGGRAFSSYVAMQLDTAKYSEDAVTRKRAEELVA
                     LLTPVAKAFLTDMGLETTLHGQQIFGGHGFIREWGQEQLVRDCRITQIYEGTNGIQAL
                     DLVGRKVIGSGGAFSRHFTDEIKAFVASADETLGEFSKPLAAAVENLEELTAWLLDRA
                     KGNPNEIGAASVEYLHVFGYTAYAYMWALMARTALAKQGEDDFYASKLGTARFYFARL
                     LPRIHSLSASVRAGSESLYLLDAEQF"
     repeat_region   629285..629405
     gene            complement(630333..631814)
                     /locus_tag="PSPA7_RS02900"
                     /old_locus_tag="PSPA7_0610"
     CDS             complement(630333..631814)
                     /locus_tag="PSPA7_RS02900"
                     /old_locus_tag="PSPA7_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003117933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome CBB3"
                     /protein_id="WP_012074077.1"
                     /db_xref="GI:501021410"
                     /translation="MRLTGLALGLLLLPLAQAAEPRGEALYRQHCQACHGAERLGGSG
                     PTLLPESLSRLKPAQAREVILHGRPATQMAGFAGQLDETGADALVAYLYQAPSHAPRW
                     SAEDIRASRVQPHPLATLPAAPRFQADPLNLFVVVESGDHHVSILDGDRFAPIARFPS
                     RYALHGGPKFSPDGRLVYFASRDGWVTLYDLYNLEVVAEVRAGLNTRNLAVSDDGRWV
                     LVGNYLPGNLVLLDARDLSLVAVLPAADAQGQPSRVSAVYTAPPRHSFVVALKDVHEL
                     WELPYANGKPVAPKRLAVADYLDDFSFSPDYRYLLGSSRQARGGEVIELDSGARVASI
                     PLSGMPHLGSGIYWKRDGRWVFATPNISRGVISVIDLQNWKPLKEIATDGPGFFMRSH
                     ADSPYAWTDTFLGKKHDEILLIDKQTLEIAHRLRPSPGKVAGHVEFTRDGRYALLSVW
                     DRDGALVVYDAHSLEEVKRLPMNKPSGKYNVGNKIGYAEGTSH"
     gene            complement(631805..632644)
                     /locus_tag="PSPA7_RS02905"
                     /old_locus_tag="PSPA7_0611"
     CDS             complement(631805..632644)
                     /locus_tag="PSPA7_RS02905"
                     /old_locus_tag="PSPA7_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="WP_012074078.1"
                     /db_xref="GI:501021411"
                     /translation="MNTTVIPPSLVEVDFPAGSVALVGAGPGDPGLLTLRAWALLQQA
                     EVVVYDRLVARELVALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLK
                     GGDPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTG
                     HLQNDGHLDLDWTGLARGRQTLVFYMGLGNLAEIAARLVEHGLPGDNPAALVSQGTQA
                     RQQVTRGPLAELPALARRYQLQPPTLIVVGQVVGLFAEREMPRPSCLNAAPASSGEAS
                     ACA"
     gene            complement(632655..633818)
                     /locus_tag="PSPA7_RS02910"
                     /old_locus_tag="PSPA7_0612"
     CDS             complement(632655..633818)
                     /locus_tag="PSPA7_RS02910"
                     /old_locus_tag="PSPA7_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003459326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme d1 biosynthesis radical SAM protein NirJ"
                     /protein_id="WP_012074079.1"
                     /db_xref="GI:501021412"
                     /translation="MLRISHYLRSLAGDAPAPRRAGGRRAPVVIWNLLRRCNLTCKHC
                     YSTSADSDFRGELETAEILRGIDDLRTAGVRVLILSGGEPLMHPDLFEIAAHARQAGM
                     FVALSSNGTLIDEGNIQRVAEARFDYVGISLDGLRETHDRFRQKQGSFDAALAAMRLC
                     READIRVGMRTTLTEENATQLPALLDLMRELDVQKFYLSHLNYSGRGRRSRALDAHHR
                     RTREALALLFERADEDIRQGRDSDFVTGNNDADAILLLDWVRRRRPQRLARLCELLLD
                     WGGNASGEGIANIDNTGEVHPDSYWWHHSVGNIRRQRFADFWFEHPDPLLLQLRQHPR
                     PVGGRCTQCRWLDICNGNTRTRAWASGDLWGEDPGCYLSDQEIGLERIALHAV"
     gene            complement(633812..634327)
                     /locus_tag="PSPA7_RS02915"
                     /old_locus_tag="PSPA7_0613"
     CDS             complement(633812..634327)
                     /locus_tag="PSPA7_RS02915"
                     /old_locus_tag="PSPA7_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P95415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nirH"
                     /protein_id="WP_012074080.1"
                     /db_xref="GI:501021413"
                     /translation="MSACISPSDALLARRLVELTQAGLPLVADPWAWIAAQLQLSETE
                     TLALLRRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSH
                     CYRRPRRLPQWRYNLFAMVHGRSEAQIEGYRQQIRLLLGEDCRADEMLVSSRILKKTG
                     LRLAQKEERPC"
     gene            complement(634302..634745)
                     /locus_tag="PSPA7_RS02920"
                     /old_locus_tag="PSPA7_0614"
     CDS             complement(634302..634745)
                     /locus_tag="PSPA7_RS02920"
                     /old_locus_tag="PSPA7_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nirG"
                     /protein_id="WP_003157620.1"
                     /db_xref="GI:489249502"
                     /translation="MDEFDRRLLNRLQHGLPLEPHPYALLAGELDCREEDILRRLDDL
                     LDDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEELAALLAGWPQVAHNYRREHALN
                     MWFVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
     gene            complement(634738..635262)
                     /locus_tag="PSPA7_RS02925"
                     /old_locus_tag="PSPA7_0615"
     CDS             complement(634738..635262)
                     /locus_tag="PSPA7_RS02925"
                     /old_locus_tag="PSPA7_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nirL"
                     /protein_id="WP_003157621.1"
                     /db_xref="GI:489249503"
                     /translation="MKPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEV
                     LEQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDAVGRALAHESIVSLC
                     YRRPRRLPMWPYNLFCMIHGRERCEVERQIAALLERHDLRQAPHRWLFSLRAYKQCGG
                     RYTAPPSGLERRHG"
     gene            complement(635259..635711)
                     /locus_tag="PSPA7_RS02930"
                     /old_locus_tag="PSPA7_0616"
     CDS             complement(635259..635711)
                     /locus_tag="PSPA7_RS02930"
                     /old_locus_tag="PSPA7_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003142724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_003157622.1"
                     /db_xref="GI:489249504"
                     /translation="MDDLSRRLLARYQKGLPICAEPYRRMAETLGCSEAEVLERLRRL
                     EADGALSRVGPVLRHQRAGASTLAALAVPEERLQRVAERISQYAEVNHNYQREHHYNL
                     WFVLTAGDRAQLDRVLAEIAADTGLQPLDLPMQEAYCIDLAFPLEASR"
     gene            complement(635720..636898)
                     /locus_tag="PSPA7_RS02935"
                     /old_locus_tag="PSPA7_0617"
     CDS             complement(635720..636898)
                     /locus_tag="PSPA7_RS02935"
                     /old_locus_tag="PSPA7_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003111533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nirF"
                     /protein_id="WP_012074081.1"
                     /db_xref="GI:501021414"
                     /translation="MNLRPLAPLFLALLAGCSQQPPLRGSGDLGVLIERADGSVQILD
                     GTAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTRLDLLAQRIDKRLIQGGN
                     SIGGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAP
                     GQRFVFSLFDSGEIWIADFSQGDTPRLTRFRDVGKQPYDALISPDGRYYMAGLFGEDG
                     MAQLDLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVL
                     DARDWKQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPG
                     PGVLHMEFSGRGDQVWISVRDADQVQVWDPYRLERIGSLPARSPSGIFFSHRAQHIGL
                     "
     gene            complement(636895..637254)
                     /locus_tag="PSPA7_RS02940"
                     /old_locus_tag="PSPA7_0618"
     CDS             complement(636895..637254)
                     /locus_tag="PSPA7_RS02940"
                     /old_locus_tag="PSPA7_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q51479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein DsbD"
                     /protein_id="WP_012074082.1"
                     /db_xref="GI:501021415"
                     /translation="MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLR
                     HLLLQDCGSCHGLRLTGGLGPALTPEALRGKPREPLVATVLMGRPQTPMPPWAGLLSE
                     DDAGWLVDRLIEGEIAP"
     gene            complement(637251..637565)
                     /locus_tag="PSPA7_RS02945"
                     /old_locus_tag="PSPA7_0619"
     CDS             complement(637251..637565)
                     /locus_tag="PSPA7_RS02945"
                     /old_locus_tag="PSPA7_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcsA"
                     /protein_id="WP_012074083.1"
                     /db_xref="GI:501021416"
                     /translation="MKPYALLSLLATGTLLAQGAWAEAPEVLFKNKGCVACHAIDTKM
                     VGPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLS
                     QK"
     gene            complement(637616..639322)
                     /locus_tag="PSPA7_RS02950"
                     /old_locus_tag="PSPA7_0620"
     CDS             complement(637616..639322)
                     /locus_tag="PSPA7_RS02950"
                     /old_locus_tag="PSPA7_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009315122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_012074084.1"
                     /db_xref="GI:501021417"
                     /translation="MPFGKPLAGTLLASLTLLGLATAHAKDDMQAAAQYQGAASAVDP
                     AHVVRTNGAPDMSESEFNEAKQIYFQRCAGCHGVLRKGATGKPLTPDITQQRGQQYLE
                     ALITYGTPLGMPNWGSSGELSKEQITLMAKYIQHTPPQPPEWGMPEMRESWKVLVKPE
                     DRPKKQLNDLDLPNLFSVTLRDAGQIALVDGDSKKIVKVIDTGYAVHISRMSASGRYL
                     LVIGRDARIDMIDLWAKEPTKVAEIKIGIEARSVESSKFKGYEDRYTIAGAYWPPQFA
                     IMDGETLEPKQIVSTRGMTVDTQTYHPEPRVAAIIASHEHPEFIVNVKETGKVLLVNY
                     KDIDNLTITSIGAAPFLHDGGWDSSHRYFMTAANNSNKVAVIDSRDRRLSALVDVGKT
                     PHPGRGANFVHPKYGPVWSTSHLGDGSISLIGTDPKNHPQYAWKKVAELQGQGGGSLF
                     IKTHPKSSHLYVDTTFNPDARISQSVAVFDLKNLDAKYQVLPIAEWADLGEGAKRVVQ
                     PEYNKRGDEVWFSVWNGKNDSSALVVVDDKTLKLKAVVKDPRLITPTGKFNVYNTQHD
                     VY"
     gene            639538..640320
                     /locus_tag="PSPA7_RS02955"
                     /old_locus_tag="PSPA7_0621"
     CDS             639538..640320
                     /locus_tag="PSPA7_RS02955"
                     /old_locus_tag="PSPA7_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_012074085.1"
                     /db_xref="GI:501021418"
                     /translation="MRDAIPFYEATGHEIDVFERAWRHGLPVLLKGPTGCGKTRFVQH
                     MARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVE
                     ARQDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQR
                     FVALRFDYPAAQQEARILVGESGCAEVLAQRLVQLGQALRRLEQHDLEEVASTRLLIF
                     AARLIGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVG"
     gene            640304..640882
                     /locus_tag="PSPA7_RS02960"
                     /old_locus_tag="PSPA7_0622"
     CDS             640304..640882
                     /locus_tag="PSPA7_RS02960"
                     /old_locus_tag="PSPA7_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase"
                     /protein_id="WP_041025280.1"
                     /db_xref="GI:751334182"
                     /translation="MSMSADTVERRLPGDLAMWFFILAELSVFSLLLLAFAGAQAWQP
                     ELFRAGRGQLDSRWGLMLTVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVY
                     VGLKLHEYGRLADLGLDIEHDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRRHT
                     PQACSGLESGVLYWHMVDLVWVLLFPLVYVLQ"
     gene            640890..641147
                     /locus_tag="PSPA7_RS02965"
                     /old_locus_tag="PSPA7_0623"
     CDS             640890..641147
                     /locus_tag="PSPA7_RS02965"
                     /old_locus_tag="PSPA7_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019395928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084879.1"
                     /db_xref="GI:489175353"
                     /translation="MRTLTLCWLALLALAVAGVLLGGAGDSPWLLAAVLACAVAKGWL
                     IGERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
     gene            641237..641677
                     /locus_tag="PSPA7_RS02970"
                     /old_locus_tag="PSPA7_0624"
     CDS             641237..641677
                     /locus_tag="PSPA7_RS02970"
                     /old_locus_tag="PSPA7_0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_003157079.1"
                     /db_xref="GI:489248944"
                     /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAA
                     MSEAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQ
                     PLNVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
     gene            641677..643074
                     /locus_tag="PSPA7_RS02975"
                     /old_locus_tag="PSPA7_0625"
     CDS             641677..643074
                     /locus_tag="PSPA7_RS02975"
                     /old_locus_tag="PSPA7_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003137320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide reductase"
                     /protein_id="WP_003157077.1"
                     /db_xref="GI:489248942"
                     /translation="MMSPNGSLKFASQAVAKPYFVFALVLFVGQILFGLIMGLQYVVG
                     DFLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPRLAWILFWVFA
                     AAGVLTVLGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGM
                     TVLRGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIM
                     GAILAFVLVKITGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVF
                     SALEPLPFFAMVLFAFNTINRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPV
                     NYYTHGTQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWL
                     MTVAMVFITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIG
                     LVAYLLSFRRGKAAA"
     gene            643076..644914
                     /locus_tag="PSPA7_RS02980"
                     /old_locus_tag="PSPA7_0626"
     CDS             643076..644914
                     /locus_tag="PSPA7_RS02980"
                     /old_locus_tag="PSPA7_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide reductase activation protein NorD"
                     /protein_id="WP_012074087.1"
                     /db_xref="GI:501021420"
                     /translation="MAFAVELEEWVGAHWHRFITRHASGEFEAARVTLESMRRPLGML
                     FRALGGAPGVALEATPARRLLLRRTWLQRVAGTCEQAPVSWFNGDSLRLPESLAVYPQ
                     AELNRELYRWLALLAASAGPLRHWAQDNQRWARQLLDAYPALRPRYARLVAAHLRQRP
                     SLDDCSAADAELEIALRRALAEPGSVERFPRVERAPWPVPLWLYPGERWTPSASAEDG
                     EEAAAGAGKRQVARSGARKRAERVEERDSERNLLLFRLESLLSWSEHLALDRCSDDED
                     DPDGARVAEDLDYLSLSRQRTRKGGGLRLDLDLPAADYDDLPLGPGLKLPEWDYRQQR
                     LLADHVLLQPLRPRGAASAGLPAHLEKTALHLRRQFACLRDGRQRLRQRPQGDEIDLD
                     AWLDFQVERRRGGSTQPGLFLEQRPRRRDLACLLLADLSMSTEAYLDDQRRVIDSIVD
                     SLLLFGEALQALGDPFALYGFSSVRRQQVRWQVLKDFDEGYGGEVRGRVLALSPGYYT
                     RMGAAIRRASQVLGGQPQKRRLLLLLSDGKPNDLDRYEGRYGIEDTRQAVIEARSQGL
                     VPFCITIDREAADYLPYLFGADGFALVGRAGQLPERLLQLYRRLRR"
     gene            complement(644921..645115)
                     /locus_tag="PSPA7_RS02985"
                     /old_locus_tag="PSPA7_0627"
     CDS             complement(644921..645115)
                     /locus_tag="PSPA7_RS02985"
                     /old_locus_tag="PSPA7_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074088.1"
                     /db_xref="GI:501021421"
                     /translation="MRQCLYCLHETEGAESACEQCGMPLPSASQRQLQRRRQRRFAWF
                     CAGLALFCLGMMLWLPRDVP"
     gene            complement(645199..645882)
                     /locus_tag="PSPA7_RS02990"
                     /old_locus_tag="PSPA7_0628"
     CDS             complement(645199..645882)
                     /locus_tag="PSPA7_RS02990"
                     /old_locus_tag="PSPA7_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription factor"
                     /protein_id="WP_003157327.1"
                     /db_xref="GI:489249200"
                     /translation="MEFQRVHQQLLQSHHLFEPLSPAQLQELLASSDLVNLDKGAYVF
                     RQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTSERNTFAEAMMFMDTPNYVATAQA
                     VVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRY
                     LLTLAAHAPGQNCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIRLDGREISIL
                     DRERLECFE"
     gene            complement(646235..647113)
                     /locus_tag="PSPA7_RS02995"
                     /old_locus_tag="PSPA7_0629"
     CDS             complement(646235..647113)
                     /locus_tag="PSPA7_RS02995"
                     /old_locus_tag="PSPA7_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012074089.1"
                     /db_xref="GI:501021422"
                     /translation="MDFRQLRYFVALYEEGHVGRAAERLALSQPALSQQIRQLEQNLD
                     VSLFQRSGKRLLPTVAAHTLYNHALPLLEGLERAREAMRVFRGQTPRSLAIGVLQTVN
                     ASLVPYMVERLHAAQPHLRVQIYELSGIDIERRLLTGNLDIGIGFLPPRQPGLHSVEL
                     YEDELQLVIPEEHPLKEFRKVSLAQAAELPMLLLGEEFRARQIWQEQLAAIGRRPRVQ
                     AELNHMSGILDSLPQTRFATVLPGKARQMHSNQRLLWKPLSEPRIPLKVGLVYRDAQR
                     QHASVELLRSLLEGVV"
     gene            647215..647916
                     /locus_tag="PSPA7_RS03000"
                     /old_locus_tag="PSPA7_0630"
     CDS             647215..647916
                     /locus_tag="PSPA7_RS03000"
                     /old_locus_tag="PSPA7_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurase"
                     /protein_id="WP_012074090.1"
                     /db_xref="GI:501021423"
                     /translation="MEQIVVNGVFIGKVEETWGGLVSAIDRLPLEREFWLGHDGLPGD
                     EQADIRHHGGLERALHHYPAEHYRYWRKRHPLHKWQQPAFGENISTYGVTEAEVCIGD
                     QFHWGDALLEVSQPRSPCYRQGQRWNLPELPDELQSGGRCGWFYRVLRSGMVTPRDEL
                     KLVQRHYPELTVARLLQCYFGDPLEPLGLRQMMACDALSQRWRKTAAKRLSSGRVEDW
                     GPRLRGPASCQEHAS"
     gene            647913..648149
                     /locus_tag="PSPA7_RS03005"
                     /old_locus_tag="PSPA7_0631"
     CDS             647913..648149
                     /locus_tag="PSPA7_RS03005"
                     /old_locus_tag="PSPA7_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157330.1"
                     /db_xref="GI:489249203"
                     /translation="MNDYLITLSQAGRLLARMEVSAARFAEVRELMRRRFPSEDGFEL
                     RFETRRESRRVLEQGPRGVRLLAVEYATEELIDG"
     gene            648142..649338
                     /locus_tag="PSPA7_RS03010"
                     /old_locus_tag="PSPA7_0632"
     CDS             648142..649338
                     /locus_tag="PSPA7_RS03010"
                     /old_locus_tag="PSPA7_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase"
                     /protein_id="WP_012074091.1"
                     /db_xref="GI:501021424"
                     /translation="MADALDSLRLMRTQERPGQVFVRGQGSWLWDSDGRAFLDFTQGL
                     AVNCLGHSPSVLVQALARQARELVSAGPGLLNQPVLALAQRLCLATGSDQAYFLTSGA
                     EANEAAIALARKWGRLHRGGAQRIVTTTNGIHGRTLGALPASGKPALQAPQEPGLAGF
                     ARVPFNDLDAMAGAIDEQTVAVMLEPVQGDAGVIPATLDYLRGIERLCRQRGVLLILD
                     EVQTGIGRCGALLAEELYGVRADIVTLGKGLGAGVPLSALLARGNACCFEPGDQLGTH
                     HGNALMTAAGLAVLNTVLEPGFLEQVREQGTHLRDGLARVARRYGHGPLRGQGLFWGL
                     PLIGQRAPAVVRAAFGEGLLINAPQPHCLRFSPALTVSRANVDEMLRRLERALARVAN
                     RHEEVA"
     gene            649338..650055
                     /locus_tag="PSPA7_RS03015"
                     /pseudo
     CDS             649338..650055
                     /locus_tag="PSPA7_RS03015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157099.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
     gene            complement(650130..650393)
                     /locus_tag="PSPA7_RS03020"
                     /old_locus_tag="PSPA7_0635"
     CDS             complement(650130..650393)
                     /locus_tag="PSPA7_RS03020"
                     /old_locus_tag="PSPA7_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074094.1"
                     /db_xref="GI:501021427"
                     /translation="MSKNKHPDLGEIQRTLNQALDGYDCQCRMHYDGTVSINVSAREH
                     DETFTFVGIQPGELDNPTRLHLFAESLRRDLALLEPWLGKHAA"
     gene            650679..652169
                     /locus_tag="PSPA7_RS03025"
                     /old_locus_tag="PSPA7_0636"
     CDS             650679..652169
                     /locus_tag="PSPA7_RS03025"
                     /old_locus_tag="PSPA7_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003121801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_012074095.1"
                     /db_xref="GI:501021428"
                     /translation="MNDQVLRTQTDRRQLQQIIAGLTEGVILVEPDQRILWANEAALA
                     MHGVDSLAGLGADIGEYRERFRLRYRNNHPLQEGQYPAERLVAGECFSDVVVEVFPAD
                     AEDTRWVHRVRGLVLTTPEDKPDCLVLILHDATEWASAEQRFEKTFNANPAPAVICRL
                     GDYRYVKVNVGFLEMTGYARDQVIGRSVYELDVLDQAERRDLAVERLSAGETIPQMEA
                     SLRVAEGGRKCVVVAGQPIEVGEEACMLFTFTDLEPRKKAEEALRKSEERFAKAFRMA
                     PVPSLVLGGDDLQALDVNQAFGETFGYPAEELLGESTIAGGLWLDGGGERLRELLGHS
                     GSVRNVQLRLQHKDRNGLDCLVSAEAVSLNEQDCVLVALLDISDRRRTEMELVHAIET
                     VMQDTSWFSRTLIEKLANVRRANAPGTGAELADLTAREREVFDLICQGLADKEIAKEL
                     GLAPNTVRNHVATIYAKLDVHSRGEAIVWARERGFAPEPRNGNGRK"
     gene            652502..653791
                     /locus_tag="PSPA7_RS03030"
                     /old_locus_tag="PSPA7_0637"
     CDS             652502..653791
                     /locus_tag="PSPA7_RS03030"
                     /old_locus_tag="PSPA7_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_012074096.1"
                     /db_xref="GI:501021429"
                     /translation="MFLQSHEHVGTYYAAANPELIQPRTALEGDLDCEVLVVGAGFSG
                     LHTALRLVEGGRKVCVIEASRVAWAASGRNGGQALPGWSSDLPPLEADLGYEGARRLW
                     DGMLWAAGEMRELPRRHGFDCDYRVGHLWTAILPRRVGLLYDWQAEANRRWGYEGLRF
                     VPKAELPEWIASERYLAGLYDPHAAHLNPLKLAFGLAAAIERAGGRLHERTRALSYRE
                     EGDGYRVRTERGEIRCAALVLACNAYIDGLDRELSQRMLPVGTYQVATAPLGEERAKS
                     LLPRNCCVTDNQFVLDYFRLTPDHRLLFGGGCTYLGGMPDDIRAATRPYLERVFPQLR
                     GVELEYAWGGHIDCSMRRTPDIGRQGNRYWLQGYSGHGVLPSLAAARAVSDALLGDDE
                     TLALYQRLRNPKFPGGQRFAAPLEALGKAYYRLRDLF"
     gene            653810..654364
                     /locus_tag="PSPA7_RS03035"
                     /old_locus_tag="PSPA7_0638"
     CDS             653810..654364
                     /locus_tag="PSPA7_RS03035"
                     /old_locus_tag="PSPA7_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_012074097.1"
                     /db_xref="GI:501021430"
                     /translation="MTEVADDLAQIASLVRELRKRKGMTLQALADGIRRSVGFVSQVE
                     RGLSRPAVDDLVAISQVLGVPATYFFCSPKTQASPWVTRPDERRTLAYARGASDNLVS
                     PRLGGAFFMLETCLEPGADSGERDLLDSSEQGGYVLEGELTLWLEDEELRLRAGDGFQ
                     LPSRMRSRYANRSQAPVRVLWVYA"
     gene            complement(654513..655544)
                     /locus_tag="PSPA7_RS03040"
                     /old_locus_tag="PSPA7_0639"
     CDS             complement(654513..655544)
                     /locus_tag="PSPA7_RS03040"
                     /old_locus_tag="PSPA7_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_012074098.1"
                     /db_xref="GI:501021431"
                     /translation="MRRLLLAAGLLLASLVAWADVPPIPALTARVTDLTATLSGDQRQ
                     HLEQQLAALETKSGAQVAVLLVPTTGDESIEEYAVRTFEKWKLGQKKVDDGVLLLVAK
                     NDRALRIEVGYGLEGAITDVQAGRIISEQITPQFRQGNFYGGIQAGVDSLVQLIDAEK
                     NPDSAASAPLDALPAIPEATPPRALPKPIEEGSMYDSTPAQPKKKSGLSGQLWDNPVY
                     LGVYVAVLLAVALLGRLLPLQWMRRRSIGRFLLCSAAVAGLAWLLSMGLWQNVDRAAD
                     DSLGVLAPTLFIYALFLLPGEVLMAILSAILSSRGGGGGSGGSGGGGGGIFRGGGGSS
                     GGGGASGRW"
     gene            complement(655548..656156)
                     /locus_tag="PSPA7_RS03045"
                     /old_locus_tag="PSPA7_0640"
     CDS             complement(655548..656156)
                     /locus_tag="PSPA7_RS03045"
                     /old_locus_tag="PSPA7_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003157094.1"
                     /db_xref="GI:489248959"
                     /translation="MPRFLRNALLPFLALLLSGCGYNAMQAGDEQVKAAWSEVLNQYQ
                     RRADLVPNLVSTVKGYASHEASVLTQVTEARAKVGSVQLNADQLDDEQAVQRFQKAQG
                     ELSSALSRLLVVTENYPQLKADGLFKDLLTQLEGTENRITVARGRYVKSVQEYNVLLR
                     QFPGVITAKLFGYKPKANFSVENEAAISTAPKVDFGNPQPAQ"
     gene            complement(656244..656753)
                     /locus_tag="PSPA7_RS03050"
                     /old_locus_tag="PSPA7_0641"
     CDS             complement(656244..656753)
                     /locus_tag="PSPA7_RS03050"
                     /old_locus_tag="PSPA7_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P57701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="WP_003157093.1"
                     /db_xref="GI:489248958"
                     /translation="MSALLKPFDNRLFWPAVAVGGLLILAFVLYLQHVRGFAPCSLCI
                     FIRLDVLGLVFAGIVGSLAPRSRFAGGVAALGMFAASLGGIYHAWSLVAEEKLAAQGM
                     GSCKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLALAA
                     KLVLGRRTA"
     gene            656980..657810
                     /locus_tag="PSPA7_RS03055"
                     /old_locus_tag="PSPA7_0642"
     CDS             656980..657810
                     /locus_tag="PSPA7_RS03055"
                     /old_locus_tag="PSPA7_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_003157092.1"
                     /db_xref="GI:489248957"
                     /translation="MLATSLVLCAAVLHATWNTLVKFSSDRLLVVACMDVVGVLCAVL
                     LLPFVSLPPAEVWPWLLGATVLQLLYRVLLIEAYKVGDLGLVYPLMRGLSPLVVLGLT
                     LAFGGEQLGGRQILGILLIPFGMLCLLWGGGGSRLPWRTLPVVLLIGLCIGGYTWSDG
                     NALKRWPLALDYLVWLTLLSGLPFPLLAAGARTRAFVRFWALEWKLGLAVGVCVLASY
                     GLVLWAMQLGSIAEAAALRETSVLLAVLFGMRFLKEPFGLPRLLACGLVLAGMLLMKL
                     "
     gene            657876..658262
                     /locus_tag="PSPA7_RS03060"
                     /old_locus_tag="PSPA7_0643"
     CDS             657876..658262
                     /locus_tag="PSPA7_RS03060"
                     /old_locus_tag="PSPA7_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003157091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003157091.1"
                     /db_xref="GI:489248956"
                     /translation="MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGARANADPRAFLGSL
                     AGFRRRANNAQLNAFEVTPAFAAAVIIAHLVGNASQATLDSLAIAWITSRLLYVICYL
                     ADWGPLRSLVWFAGMLLIAAFFVVSA"
     gene            658375..658833
                     /locus_tag="PSPA7_RS03065"
                     /old_locus_tag="PSPA7_0644"
     CDS             658375..658833
                     /locus_tag="PSPA7_RS03065"
                     /old_locus_tag="PSPA7_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019395926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_003157090.1"
                     /db_xref="GI:489248955"
                     /translation="MKLKSLLVVLLAGVALSGCHRMDPNSPEAKRQAIFKEMLRTSED
                     MGGMLRGRLPFDAEKFRAGSAKLHELADQPWQYFPSPKAGEEGEDTRAKDEVWQRQQE
                     FKGATQVFIDAMNRLQDNTRQATPTPDGVRKDFAAVEDACEACHKKFRAL"
     gene            complement(658949..659368)
                     /locus_tag="PSPA7_RS03070"
                     /old_locus_tag="PSPA7_0645"
     CDS             complement(658949..659368)
                     /locus_tag="PSPA7_RS03070"
                     /old_locus_tag="PSPA7_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015649728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074099.1"
                     /db_xref="GI:501021432"
                     /translation="MSIRPSLPLAGLLLAVSLPLFAAQPGAKGGAPLTGCAAKQAAIE
                     AKLETARSFANEGQVAGLEKALAEVKAHCTEAGLLRENKQKVIDSEREVSEREKDLRK
                     AMGKGDPEKIEKRKAKLAEARAELEEAKKGLEQAQAQ"
     gene            659617..660585
                     /locus_tag="PSPA7_RS03075"
                     /old_locus_tag="PSPA7_0646"
     CDS             659617..660585
                     /locus_tag="PSPA7_RS03075"
                     /old_locus_tag="PSPA7_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyhydroxybutyrate depolymerase"
                     /protein_id="WP_012074100.1"
                     /db_xref="GI:501021433"
                     /translation="MRTLIRLVRTLILLLVLALLAGAWWWLQDETLRTPALAGYSEDS
                     SLKVAGLRRHYLLYVPPGVPEGAPLLVVLHGSRGDGAQMRRISGYGFDRLAAQEGFLV
                     AYPDGFEGHWNDCRKAASYSARLRDVDDVAFLRALVARLAQEYRVDPQRVYVTGYSNG
                     GQMAFRLAAEAPGLPAAIAAVAASLPTMENDACRPLERPTAVLLINGTRDPINPYLGG
                     KVSLFGFGDRGAVRSTLDSARWWASLNGLAAQPDVAPLTRPGPVWTERQRWQEGGHPP
                     VELLSVHGGGHVLAQPDYRFPRILGKSDPELDAPAEIWRFFSQLPR"
     gene            complement(660589..661332)
                     /locus_tag="PSPA7_RS03080"
                     /old_locus_tag="PSPA7_0647"
     CDS             complement(660589..661332)
                     /locus_tag="PSPA7_RS03080"
                     /old_locus_tag="PSPA7_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016852398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074101.1"
                     /db_xref="GI:501021434"
                     /translation="MKIRLLSDLHHEHFDGRRQLPEVEADVVVLAGDIHSHLEGLHWA
                     RETFAHSEIVYVAGNHEFYSSEMTDLTQAMRNIARALEIHFLENDEVRIGPARFLGAT
                     LWTDFQLHGTAGYAPAHELALQSMPDFSCIDWFGGDFTPEQSIALHRASRDWLAEQLA
                     RPHAGPTLVVSHHAPSARSIPPQFVDSPLSPAFASNLDELVAQADYWLHGHVHDALDY
                     RIGEARVLANPGGYPHEKGGFRPEFVFEV"
     gene            661537..662841
                     /locus_tag="PSPA7_RS03085"
                     /old_locus_tag="PSPA7_0648"
     CDS             661537..662841
                     /locus_tag="PSPA7_RS03085"
                     /old_locus_tag="PSPA7_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="reductase"
                     /protein_id="WP_012074102.1"
                     /db_xref="GI:501021435"
                     /translation="MKLLWGVLAAALAAWGLTLAIDPPASLDIWVVRKQAILLTGVAS
                     FALMSLIMLLAVRPTWLEKPLDGLDRMYRLHKWAGILAIVLGLLHYLLELGGPLLASI
                     VAKPAKGPRVETFLDVFRGSAKDLGEWSAWILGGMLLITLWQRFPYHLWRHVHKALAL
                     VYLVLAFHSVVLAPASYWSQPAGWLVAACALLGSACALLSLSGRIGRARRHAGVVTAV
                     ERRGESLLEVTCRLQGDWSHRAGQFAFLTCDRLEGAHPFTIASADHGCGEVRFSIKAL
                     GDYTRRLQANLDVGARVEVEGPYGCFDFRRGLAGRQVWVAAGIGVTPFIAWLESLQAA
                     PESAPSVELHYCVRNSQEALFAGRLRELCERLPSVALHIRYSDEQGKPQAAQLGMLKN
                     AEGRWPSVWFCGPQGLADSLRRELRRQGMPLRLFHQEAFRMR"
     gene            complement(662899..664089)
                     /locus_tag="PSPA7_RS03090"
                     /old_locus_tag="PSPA7_0649"
     CDS             complement(662899..664089)
                     /locus_tag="PSPA7_RS03090"
                     /old_locus_tag="PSPA7_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016490314.1"
                     /note="catalyzes the formation of S-adenosylmethionine
                     from methionine and ATP; methionine adenosyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase"
                     /protein_id="WP_003084948.1"
                     /db_xref="GI:489175422"
                     /translation="MSEYSVFTSESVSEGHPDKIADQISDAVLDAIIAKDKYARVACE
                     TLVKTGVAIIAGEVTTSAWVDLEELVRKVIIDIGYDSSDVGFDGATCGVLNIIGKQSV
                     DINQGVDRAKPEDQGAGDQGLMFGYASNETDVLMPAPICFSHRLVERQAEARKSGLLP
                     WLRPDAKSQVTCRYEGGKVVGIDAVVLSTQHNPEVSYNDLRDGVMELIIKQVLPAELL
                     HKDTQFHINPTGNFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSA
                     AYAGRYVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKVSDEKIVQLVREH
                     FDLRPYAITKMLDLLHPMYQPTAAYGHFGRHPFELTVDGDTFTAFTWEKTDKAALLRD
                     AAGL"
     gene            complement(664105..665106)
                     /locus_tag="PSPA7_RS03095"
                     /old_locus_tag="PSPA7_0650"
     CDS             complement(664105..665106)
                     /locus_tag="PSPA7_RS03095"
                     /old_locus_tag="PSPA7_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003113231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_023443089.1"
                     /db_xref="GI:557744915"
                     /translation="MSLRVPSIRPDDYDPLAALCKAAGDSLRLNVLRALANDSFGVLE
                     LAQIFAIGQSGMSHHLKVLAQAGLVATRREGNAIFYRRSLPLVERTGGALHAALLEEV
                     DERVLPDDVRARIDAVHAQRAAVSQDFFARAADKFQAQQDLIAGLPQYRESVLALLDA
                     LAFAPGATALEVGPGDGGFLPELARRFRQVTALDNSAAMLELARQRCKEEGLGNVRLE
                     LADALQDSAEPADCVVLNMVLHHFAAPAEALKQLARLVHPGGSLLVTDLCRHDQGWAR
                     EACGDLWLGFEQEDLAQWADAAGLTPGESLYIGLRNGFQIQVRHFARDASESRLTHR"
     gene            665352..667349
                     /locus_tag="PSPA7_RS03100"
                     /old_locus_tag="PSPA7_0651"
     CDS             665352..667349
                     /locus_tag="PSPA7_RS03100"
                     /old_locus_tag="PSPA7_0651"
                     /EC_number="2.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875760.1"
                     /note="catalyzes the formation of ribose 5-phosphate and
                     xylulose 5-phosphate from sedoheptulose 7-phosphate and
                     glyceraldehyde 3-phosphate; can transfer ketol groups
                     between several groups; in Escherichia coli there are two
                     tkt genes, tktA expressed during exponential growth and
                     the tktB during stationary phase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_033999542.1"
                     /db_xref="GI:730363295"
                     /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDY
                     MQHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPE
                     YGYTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMME
                     GISHEVASLAGTLRLNKLIAFYDDNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDG
                     HDADEIKTAIDTARKSDQPTLICCKTVIGFGSPNKQGKEECHGAPLGADEIAATRAAL
                     GWEHGPFEIPAQIYAEWDARETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPA
                     DFAEKAAAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADLAGSNLTLWKGC
                     KGVSADDAAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSAL
                     MKQRVLYVFTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIE
                     RADGPSALIFSRQNLPHQARDVAQVTDIARGGYVLKDCAGEPELILIATGSEVGLAVQ
                     AYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVG
                     LDGRIIGMTSFGESAPAPALFEHFGFTLDNVLAVAEELLED"
     gene            667349..668413
                     /locus_tag="PSPA7_RS03105"
                     /old_locus_tag="PSPA7_0653"
     CDS             667349..668413
                     /locus_tag="PSPA7_RS03105"
                     /old_locus_tag="PSPA7_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074104.1"
                     /db_xref="GI:501021437"
                     /translation="MHRLYWRDLESPANGEWLGLAVQVEGAHRAPSCVHLQSGGQGRI
                     RLVRGDQPLLWGTQLPCHDGIWLVKSLAVASPEQASVPPIDSPTLESLRGLRGEARYK
                     AWSRHFVEALRASPGSCLEAGRWLLRLSLAEQAPAWQPSQSHDPRERVLERWRYRSVG
                     RDALLPDWRFHSLEKVLDDDWVQWLDWWGRDNDALIALRRVEDDEGRVKWWRKKAREG
                     ELPPVLALRLNCLDACVILDGHCRLRAGLLENVAPEILVLCAYDEQPMPVDTAQRERV
                     LQSLAQRVDAPVRRGRRPLSGEQLNEVLLRLFDDRPWPRVLTHARAVLKEEQWCAEVR
                     DWLAAHDRLDALEPIIRRVE"
     gene            complement(668394..669191)
                     /locus_tag="PSPA7_RS03110"
                     /old_locus_tag="PSPA7_0652"
     CDS             complement(668394..669191)
                     /locus_tag="PSPA7_RS03110"
                     /old_locus_tag="PSPA7_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="WP_012074105.1"
                     /db_xref="GI:501021438"
                     /translation="MPRFAANLSMLYPQHDFLERFAAAAADGFEGVEYLFPYAYPAAE
                     LKARLDHHGLRQVLFNAAPGDWDKGERGLASLPGREAEFRRAIAQAIDYAQVLGNRHI
                     HVMAGLLPAGAERIRHRETYLDNLAHAAREAAGAGLTVLIEPINNRDMPGFFLTRQDD
                     AQAICREVGADNLKVQFDCYHCQIVEGDLATTLRRDIGNVGHVQIAGVPDRHEPDGDN
                     EVNYPYLFELLDRLGYRGWIGCEYRPRGDTSAGLEWLRRWRATRRDG"
     gene            669405..670466
                     /gene="gapA"
                     /locus_tag="PSPA7_RS03115"
                     /old_locus_tag="PSPA7_0654"
     CDS             669405..670466
                     /gene="gapA"
                     /locus_tag="PSPA7_RS03115"
                     /old_locus_tag="PSPA7_0654"
                     /EC_number="1.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003154092.1"
                     /note="required for glycolysis; catalyzes the formation of
                     3-phospho-D-glyceroyl phosphate from D-glyceraldehyde
                     3-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-erythrose 4-phosphate dehydrogenase"
                     /protein_id="WP_012074106.1"
                     /db_xref="GI:501021439"
                     /translation="MSTPPFRVALNGYGRIGRCVLRALHERPEQLGFEIVALNDLADQ
                     ASVEYLTRFDSTHGRFPGEVRVDGDCLHINGDCVKVLRSPTPEAIDWQALRVDLVLEC
                     SGQYTNRAQAERFLRAGAPRVLFSQPMASEADIDATIVYGVNQQDLSGRETLVSNASC
                     TTNCGVPLLKLLNEAIGLEYVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVS
                     TGLARGIERLLPELAGRIQAKAIRVPTVNVSALDITLQTSRDTSAAEINRVLREAAES
                     GPLRGLLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLAWFDNEWGFANRML
                     DVAGHYLRAAVPDQQVPKD"
     gene            670472..671635
                     /locus_tag="PSPA7_RS03120"
                     /old_locus_tag="PSPA7_0655"
     CDS             670472..671635
                     /locus_tag="PSPA7_RS03120"
                     /old_locus_tag="PSPA7_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009613665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_012074107.1"
                     /db_xref="GI:501021440"
                     /translation="MTVLKMTDLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTI
                     RLALEKGAAVMVCSHLGRPSEGEFSAENSLKPVAEYLSKALGREVPLLADYLDGVEVK
                     AGDLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVARFAKV
                     AAAGPLLAAELDALGKALGNPARPMAAIVAGSKVSTKLDVLNSLAGICDQLIVGGGIA
                     NTFLAAAGHKVGKSLYEADLVETAKAIAAKVKVPLPVDVVVAKEFAESAVATVKAIAE
                     VADDDMILDIGPQTAAQFADLLKTSKTILWNGPVGVFEFDQFGEGTRTLANAIADSAA
                     FSIAGGGDTLAAIDKYGIAERISYISTGGGAFLEFVEGKVLPAVEILEQRAKG"
     gene            671708..671908
                     /locus_tag="PSPA7_RS03125"
                     /old_locus_tag="PSPA7_0656"
     CDS             671708..671908
                     /locus_tag="PSPA7_RS03125"
                     /old_locus_tag="PSPA7_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003155163.1"
                     /db_xref="GI:489247003"
                     /translation="MRTLTLPLLLFCLGLAACGGDGGRRPSTCEVISPPDVMVPTEEN
                     RQRVEQQSSGDPTAGQKPVECP"
     gene            672069..672410
                     /locus_tag="PSPA7_RS03130"
                     /old_locus_tag="PSPA7_0657"
     CDS             672069..672410
                     /locus_tag="PSPA7_RS03130"
                     /old_locus_tag="PSPA7_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003155165.1"
                     /db_xref="GI:489247005"
                     /translation="MNYPRFALFGGLAAAALLAGCSGSSGKPGGRDWTRWTCDSKAVI
                     EWRYIDGSKNIVDLRLKDEDDVVHHLEQEPAAVGAFYSDGRLGFHLENDEGLVYWVET
                     DDLIGRGCKAR"
     gene            672530..673594
                     /locus_tag="PSPA7_RS03135"
                     /old_locus_tag="PSPA7_0658"
     CDS             672530..673594
                     /locus_tag="PSPA7_RS03135"
                     /old_locus_tag="PSPA7_0658"
                     /EC_number="4.1.2.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I5Y1.1"
                     /note="class II aldolase; catalyzes the reversible aldol
                     condensation of dihydroxyacetonephosphate and
                     glyceraldehyde 3-phosphate in the Calvin cycle, glycolysis
                     and gluconeogenesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_003155167.1"
                     /db_xref="GI:489247007"
                     /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSP
                     VIVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSV
                     MMDGSLREDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGV
                     GAEGVLDHSQLLTDPEEAADFVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIK
                     EIHARIPDTHLVMHGSSSVPQDWLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNI
                     DTDLRLASTGAIRRFLAQNPSEFDPRKYFAKTVEAMRDICIARYEAFGTAGNASRIKP
                     ISLEGMFQRYARGELDPKVN"
     gene            673661..674143
                     /locus_tag="PSPA7_RS03140"
                     /old_locus_tag="PSPA7_0659"
     CDS             673661..674143
                     /locus_tag="PSPA7_RS03140"
                     /old_locus_tag="PSPA7_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074108.1"
                     /db_xref="GI:501021441"
                     /translation="MRRWILLLPFLLLAGCAGLHAPSRDAVEAPAPSVARDPADPQDC
                     LARSDCTTKTSRTLLFVFDYAEAGGELVVRDGRRLETPPAPPRSTWPALRIQLAEPVN
                     GRFEFASPCLRRSGKGCRYSQAMLLKVYRSYLAGKPCSLLSPRAVKRCVDPAATATRR
                     "
     gene            complement(674145..674570)
                     /locus_tag="PSPA7_RS03145"
                     /old_locus_tag="PSPA7_0660"
     CDS             complement(674145..674570)
                     /locus_tag="PSPA7_RS03145"
                     /old_locus_tag="PSPA7_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003155171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketosteroid isomerase"
                     /protein_id="WP_012074109.1"
                     /db_xref="GI:501021442"
                     /translation="MNNEVSAIRQLIEDWRTAVRASDVPRIVSYYAEDIVAFDAILQL
                     QFKGRDAYREHWQACTEMCKGPMTFDIAELQIHADQQVAFAHYLCHCGGTGPDGQPHS
                     SWMRVSAGYRKQDGQWRVVHEHFSAPFDMDGKALFDLQP"
     gene            674801..675568
                     /locus_tag="PSPA7_RS03150"
                     /old_locus_tag="PSPA7_0663"
     CDS             674801..675568
                     /locus_tag="PSPA7_RS03150"
                     /old_locus_tag="PSPA7_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_012074111.1"
                     /db_xref="GI:501021444"
                     /translation="MSSVHTAAQQGFSAEARRYAEGRPEYPEALSGWLRDALGLRPQT
                     VAVDLGAGTGKFTRLLAHTGARVVAVEPVDAMRAQLAEALPQVRALAGSAQSIPLANG
                     FADALVCAQAFHWFASEEALEEMRRVLTAEGRLGLVWNVRDESLDWVAEITRIITPYE
                     GDAPRFYKGDWRRPFERAPFGPLRLSTFVHEHVGPPEQVIVSRFLSVSFIAALAETEK
                     NAVATQLRELVASHPALKGKEQVALPYRTEAYLAEAR"
     gene            complement(675565..676743)
                     /locus_tag="PSPA7_RS03155"
                     /old_locus_tag="PSPA7_0662"
     CDS             complement(675565..676743)
                     /locus_tag="PSPA7_RS03155"
                     /old_locus_tag="PSPA7_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074112.1"
                     /db_xref="GI:501021445"
                     /translation="MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILM
                     SGGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLF
                     CDNKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYRLRTSAGEMRCESLVIASG
                     GLSIPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSC
                     NGQVFRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNS
                     ELKTLLAELFTKKLAGLLADRWFASKPMKQYTPAELASIAGQLSAWRVTPSGTEGYRT
                     AEVTLGGVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA
                     "
     gene            676856..677344
                     /locus_tag="PSPA7_RS03160"
                     /old_locus_tag="PSPA7_0664"
     CDS             676856..677344
                     /locus_tag="PSPA7_RS03160"
                     /old_locus_tag="PSPA7_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074113.1"
                     /db_xref="GI:501021446"
                     /translation="MTPLKYLQAYPASLQDQVRQLIAENRLGEYLERRYPGRHDVQSD
                     KALYAYTMSLKQEHLRNAPGLDKVLYDNKLDVVQRALGLHTAISRVQGGRLKAKKEIR
                     VASLFKDAAPEFLRMIVVHELAHLKESEHNKAFYQLCQYMLPDYHQLEFDLRVYLTWK
                     SL"
     gene            complement(677352..678047)
                     /locus_tag="PSPA7_RS03165"
                     /old_locus_tag="PSPA7_0665"
     CDS             complement(677352..678047)
                     /locus_tag="PSPA7_RS03165"
                     /old_locus_tag="PSPA7_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_003155176.1"
                     /db_xref="GI:489247016"
                     /translation="MPHPIDALISDCDGVLVDSEVIAERVMYEALSAYAPLDELQRLL
                     EGTFGLTSRDILDRVEKHFGLRIPDSFNREVRQRSEEMVAQVQPIPGARDALLALDLP
                     VAVASNSRRHSLERSLARAGLSELIGERLASADMVALPKPAPDVYLYAASLLGVAPER
                     CLVVEDSSTGTRAALAAGMRVIGFVGAGHIPAGHADVLRELGAIAIVEHMRELPETVA
                     RLRRESRVALGTP"
     gene            complement(678175..678528)
                     /locus_tag="PSPA7_RS03170"
                     /old_locus_tag="PSPA7_0666"
     CDS             complement(678175..678528)
                     /locus_tag="PSPA7_RS03170"
                     /old_locus_tag="PSPA7_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084974.1"
                     /db_xref="GI:489175448"
                     /translation="MEWFLKCVKEHYFDFNGRARRKEYWMFTLVNIIISVALSVVLGL
                     ISEKLLPIANLYSLAVLLPALGVTARRLHDINKSGWWMLIALIPIVGLYLIYLLAKDS
                     DAGQNQYGQNPKGIA"
     gene            complement(678706..679617)
                     /locus_tag="PSPA7_RS03175"
                     /old_locus_tag="PSPA7_0667"
     CDS             complement(678706..679617)
                     /locus_tag="PSPA7_RS03175"
                     /old_locus_tag="PSPA7_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_012074114.1"
                     /db_xref="GI:501021447"
                     /translation="MDPLDRLIQLANLQGRLDQRCQLQGSWALEHPQAVPGEATFHIV
                     MAGTCHCEFLDGSRLDLHPGDLILLPRGTPHLLRSDSPAPPCEPTVERQGSIPLYQLN
                     GPGEALDMLCGSYRYHAGASLFGALPERLLVHMDESTQQPLRALIALMRQEAESTRSG
                     ARSIIDALATALFALTLRAYLDRQPLGDGLFGLLGDARLGRALQVMLECPEQAWTVER
                     LAQQAAMSRASFVRAFSALAGTSPWSLLTRIRMEKARGLLRQTQMSLLDIAAETGYQS
                     EAAFSRNFRQAFGESPGRFRRQADASR"
     gene            679735..680073
                     /locus_tag="PSPA7_RS03180"
                     /old_locus_tag="PSPA7_0669"
     CDS             679735..680073
                     /locus_tag="PSPA7_RS03180"
                     /old_locus_tag="PSPA7_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004352218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084980.1"
                     /db_xref="GI:489175454"
                     /translation="MLNNWTEFVPAVKKAFGALGKQHPKMLAAYGALEEASAEGALDA
                     KTRELISIAVAITTRCDGCIGVHTEAALKAGASEAEIAQTLATAISLNAGAAYVYSLR
                     ALEAYDQFKK"
     gene            complement(680063..680578)
                     /locus_tag="PSPA7_RS03185"
                     /old_locus_tag="PSPA7_0668"
     CDS             complement(680063..680578)
                     /locus_tag="PSPA7_RS03185"
                     /old_locus_tag="PSPA7_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074115.1"
                     /db_xref="GI:501021448"
                     /translation="MSDLSPRPAFWPYLPGYALLLLSVLLCASGSYRFVTPLPLADGA
                     DLVYLSQGLALLPLGTGLVGLLAGFLLHVRGRWLGALLSLLPTALICAWNLYNYAAHG
                     DEALSPSFARYAQALLGTLLLGGVLGLIDLLHRRPSALLRRGLLVLGWLALAGWLALL
                     FYLQRLYGLTF"
     gene            680767..680925
                     /locus_tag="PSPA7_RS03190"
                     /old_locus_tag="PSPA7_0670"
     CDS             680767..680925
                     /locus_tag="PSPA7_RS03190"
                     /old_locus_tag="PSPA7_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003084988.1"
                     /db_xref="GI:489175462"
                     /translation="MDLIRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVH
                     AVYIIAKR"
     gene            complement(680935..681393)
                     /locus_tag="PSPA7_RS03195"
                     /old_locus_tag="PSPA7_0671"
     CDS             complement(680935..681393)
                     /locus_tag="PSPA7_RS03195"
                     /old_locus_tag="PSPA7_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003113223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074116.1"
                     /db_xref="GI:501021449"
                     /translation="MELIRNLDEANMGEVYWRLYRRYISLFIENEADDAYAWRCARAL
                     DELDDAVVERLCAASLRYRAARLERLGEPAEEVAPARAVLARVEPGELIVPDPEHGDE
                     PVIHLSLNCEWDREHGMEWIVRGGEVLYVGPFHGEDPWRDFTAKEPWNYA"
     gene            complement(681408..681878)
                     /locus_tag="PSPA7_RS03200"
                     /old_locus_tag="PSPA7_0672"
     CDS             complement(681408..681878)
                     /locus_tag="PSPA7_RS03200"
                     /old_locus_tag="PSPA7_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074117.1"
                     /db_xref="GI:501021450"
                     /translation="MIPFGLSPEQFRERYRRDLQRAAPGVIQRLRELLRQTLEEGVRD
                     GEVQLFLGEDGRDTPDAWLYLRGASNRVDASDPRLFPGKALDLALDLGALADFDEAYF
                     AAGFGGVDLLADTAKTWFAECWWKAGGWAWPVPLWLHVHDGFGDGRAIALTEHC"
     gene            complement(681892..682239)
                     /locus_tag="PSPA7_RS03205"
                     /old_locus_tag="PSPA7_0673"
     CDS             complement(681892..682239)
                     /locus_tag="PSPA7_RS03205"
                     /old_locus_tag="PSPA7_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003084996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074118.1"
                     /db_xref="GI:501021451"
                     /translation="MKPELDALEAWLGRPLPAAFVAALEQHGGRLVEPGLLLYAADEL
                     LERNRTFETDLYCPGYLAIGDDSGGRAVMMALDDHRQALFLVDQGALTPDCFESLAPS
                     LAAWLEAGPCLPE"
     gene            complement(682229..682843)
                     /locus_tag="PSPA7_RS03210"
                     /old_locus_tag="PSPA7_0674"
     CDS             complement(682229..682843)
                     /locus_tag="PSPA7_RS03210"
                     /old_locus_tag="PSPA7_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041025281.1"
                     /db_xref="GI:751334183"
                     /translation="MTDRLPCRACGHLILPTTAARNDGLCMPCKGGYRQNIEDGKRFH
                     EDRRRYLASPQTLCWSALVNRVYDGREGFAGLSPAERTYYAVSVLSGEVHNGGFDQYF
                     GNSSGDHYQAARAGLRELEAEDALALLERAAALLFGDAPVPVSQAERQLRMPTWADEP
                     DRNCEAALDALDTRFYALADALGERLLAHARRHALFAQDETDEA"
     gene            complement(683048..685774)
                     /locus_tag="PSPA7_RS03215"
                     /old_locus_tag="PSPA7_0675"
     CDS             complement(683048..685774)
                     /locus_tag="PSPA7_RS03215"
                     /old_locus_tag="PSPA7_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020750428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074120.1"
                     /db_xref="GI:501021453"
                     /translation="MSRSPTTRQRALLAGVCLAGALSAQAATQEEILDAALVSGDSSQ
                     LTDSHLVALRLQRQVEGIRQSRTQLLDGLYQDLSQAYAPGASSQWIVPANPDSTLPFL
                     VGDKGRVLASLSLEAGGRGLAYGSNVLTQLGGTNAAHAPLLKRAVQWLVNGDPDVATA
                     PDFKISVVGVDKTSTLNGLKSAGLQPADAACNALTDANCASSSKLLVLGNGASAGNLS
                     STVRARLQAGLPILFVHTSGWGQNATGQQILAGLGLQEGPYGGNYWDNDKVPGSRTRA
                     RSVELASAYGQDPALLQQIVDGSWRTDYDWSKCTTFVGRTSCDDVPGLNDFSKRVDVL
                     KGAFDTYNQKAQNLFAVPGTTSLRLWLLWADAVRQNVRYPMDKAADAARFQEAFVADA
                     IVGYVREAGAAQKELGSYAGQRQQSMPVSSSEETLTLTLPSAQGSTAIGRMAAPGKRL
                     SIRVEDAGQASLAVGLNTQRTGSTRLWNSRQYDRPRFLKSPDIKLPASQPVVLVSPYG
                     GLLQLVYSGATPGQTVTVKVSGAASQPFLDIKPGEDNSQAIADFIQALDADQADWLEI
                     RSGSVEVHAKVEKVRGSIDNDYGGDIQRFIRELNEVFIDDAYTLAGFAIPNQAKTPAI
                     RQECAARGWDCDSEALHKLPGTQHINVDQYAQCGGGCSGNPYDQTWGLNPRGWGESHE
                     LGHNLQVNRLKVYGGRSGEVSNQIFPLHKDWRVLREFGQNLEDTRVNYRNAYNLIVAG
                     RAEADPLEGVYKRLWNDPGTYSLNGERMAFYTQWVHYWADLKNDPLQGWDIWTLLYLH
                     QRQVDKANWDASKAALGYGTYAQRPGNSGDASSTDGNDNLLIGLSWLTQRDQRPTFAL
                     WGIRTSATAQAQVAAYGFAEQPAFFYANNRTNEYSTVKLLDMSQGSPAWPFP"
     gene            complement(686460..687581)
                     /locus_tag="PSPA7_RS03220"
                     /old_locus_tag="PSPA7_0677"
     CDS             complement(686460..687581)
                     /locus_tag="PSPA7_RS03220"
                     /old_locus_tag="PSPA7_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_012074122.1"
                     /db_xref="GI:501021455"
                     /translation="MNDPLWIWQQPDWPQFNWQAGALAPLLRSCSQAQGRLLGMLDAV
                     GSDTEVQSSLDAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLHEEGRTTSRSEGLAE
                     LLLDATHAHQEPLDEERLFTWHSWLFPTDDQLLARPLHIGALRGEEPMQVVSGRIDRP
                     TVYFEAPPRAGLEAQLADFLAWFESSRRDASLDPFLRAGIAHFWFVTLHPFDDGNGRL
                     TRAITDLALAQGEQQAIRFYAMSASILDDRAGYYHILEASQKGGLDITKWLQWFLETL
                     LKSLEQALARIDRVLVKARFWQAHRSQTLSTEQIKVLNRLLDGGEKGFENGISAAQYQ
                     AVAKVSKATATRHLSDLLEKGCIERLPGGGRSTRYQIAR"
     gene            complement(687843..687980)
                     /locus_tag="PSPA7_RS03225"
                     /old_locus_tag="PSPA7_0678"
     CDS             complement(687843..687980)
                     /locus_tag="PSPA7_RS03225"
                     /old_locus_tag="PSPA7_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003113217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041025450.1"
                     /db_xref="GI:751334352"
                     /translation="MVRKTGWPTNEKTFRTKRDAEDWARRTEDKMVRGVYIQHCGSER
                     M"
     repeat_region   689324..716180
     gene            complement(689348..690319)
                     /locus_tag="PSPA7_RS03230"
                     /old_locus_tag="PSPA7_0680"
     CDS             complement(689348..690319)
                     /locus_tag="PSPA7_RS03230"
                     /old_locus_tag="PSPA7_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012077228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074125.1"
                     /db_xref="GI:501021458"
                     /translation="MEEAVTRIVERQFPELSGGYHLPRFARVTAVADPPAANGICDEF
                     RPRYAVDLEVLDANGEPDPTLPPMPGVPLPLPNGGGERGFLAFPEEGTMVVLGFAYGM
                     PNKPFILQILPHGQSLPKLPKEDQLWQHSEAALQRVDGAGNWTRQTDGRIRDQAMERE
                     VEALENVERYQGSRVEIEDHATEQVGGVKRIEALGALKLLSGGSASLAAVDDLHLGTG
                     RDLNLVAGQSYNATIGADMDERIQGMRRSVAAVAQRLQAPTTWVGSAGVNVLQVLCDL
                     LDLVEQMNTQLAGHVHPPAGPPTNAGDFTADAAQAANLAAKLKPITA"
     gene            complement(690304..691002)
                     /locus_tag="PSPA7_RS03235"
                     /old_locus_tag="PSPA7_0681"
     CDS             complement(690304..691002)
                     /locus_tag="PSPA7_RS03235"
                     /old_locus_tag="PSPA7_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074126.1"
                     /db_xref="GI:501021459"
                     /translation="MKLHQVLTINGQAVPLVQSEVRLDLRTPGRASFTIKAPAAEPVR
                     GLVALDIGYNDRPLQRHFLGYVERCSAANATEQVLFCRELAAVLAQPLPMGLRHVDLR
                     EVLEDVCRQTGLSFRVPDADYSRTKAPYFYSLAAGYQAMDSLAQVFQIPDFVWHQQGN
                     GEVYAGSWTDSYWGARAPIQLEAELFDSYQGRQSAVIAALPGIRPGATINQGERITSV
                     TLTGTQMAIKWKKP"
     gene            complement(691002..691541)
                     /locus_tag="PSPA7_RS03240"
                     /old_locus_tag="PSPA7_0682"
     CDS             complement(691002..691541)
                     /locus_tag="PSPA7_RS03240"
                     /old_locus_tag="PSPA7_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_012074127.1"
                     /db_xref="GI:501021460"
                     /translation="MTLLLDGQQVHGKGLQVTANLRIESADLSGQTSNTAKAHKGFKP
                     KGLTVSLMIPYVDQVHLVELVRMAEATAGGGQLHTYRVVNQTAAAFGVRQVQFSDNLS
                     VREDDILRAWRIQFTLTEQLSNPERVETRRPGKPVQQQVGAGAPVADPAAGGDGKSGQ
                     ELTGFEKILQRVDDAIGGA"
     gene            complement(691538..692458)
                     /locus_tag="PSPA7_RS03245"
                     /old_locus_tag="PSPA7_0683"
     CDS             complement(691538..692458)
                     /locus_tag="PSPA7_RS03245"
                     /old_locus_tag="PSPA7_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074128.1"
                     /db_xref="GI:501021461"
                     /translation="MTWAPVTMRWPAQTTRWLDDLGAAQQLASGELAGTAERLRGLQD
                     LATTNPGPVAGAAKAAITAGRSAMASTLGEVPACLAVTPFLAGVGQGQGNQRFLSAPN
                     LLQQLADKLLQPQRDDQEQYALVLLFLGTRYDQLAATLARFNALLPVPDLQRAERRAA
                     SLARLELEKWIMPRTTPGPRWQDLPLDRCTITRAAQQSLSGQLAVLEGYTADSSPMAE
                     LGALAQRKQALQASKDNALQALREQLANGVADGTMQARLVGPGNAVELRRQLLQGEAP
                     GHEWVLCAGLALVGSLSGLAFVRELVGLDP"
     gene            complement(692455..693165)
                     /locus_tag="PSPA7_RS03250"
                     /old_locus_tag="PSPA7_0684"
     CDS             complement(692455..693165)
                     /locus_tag="PSPA7_RS03250"
                     /old_locus_tag="PSPA7_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019331948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber assembly protein"
                     /protein_id="WP_012074129.1"
                     /db_xref="GI:501021462"
                     /translation="MTTLTVYQTNALGLYVGPTDADESPLEPGVFLIPAGCVQLAPPK
                     EPKGKRARWTGSDWELVDWLDGVTTYSTRDGSPLVLQGLEPLPEGYTLQQPGPNQVWK
                     DGAWVDDLPGLLAAAHKRKTLEIRAAGQAFLDGGFYSSALGNPHFYASSLSDQMNVTS
                     LAALGISADYPCAAGGEQNREWRRHTANQLRQVGVDLVQHRQAGQQQVERLQDELDAA
                     LAAQDLERLEAITWSIPA"
     gene            complement(693179..695143)
                     /locus_tag="PSPA7_RS03255"
                     /old_locus_tag="PSPA7_0685"
     CDS             complement(693179..695143)
                     /locus_tag="PSPA7_RS03255"
                     /old_locus_tag="PSPA7_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012077225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_012074130.1"
                     /db_xref="GI:501021463"
                     /translation="MARITAAGERLIAQKLGEKKILEVSRFVLALVPGLDPTSPVDRD
                     AALPPAQQIVHTAPVTQAGYVNPNQVVYSLMMGSDVGDFDWNWIGLETAEKVLLAVAY
                     VPVQQKRKNRPPLQIGNNVTRNFLVAFDGAQELTGITIDASTWQHDFTVRLAGIDERE
                     RLANRDMFGRGTFFSTGLLLEKASTNYRLKAGLAYVEGIRVHAPEDVSIAAPSLPNTA
                     WLDVRLQRSQSDVVASWSIAWGTNQTDYTDSAGVRHYLVPLADLDAGGNLVADRRLPK
                     PITGPLVDHWAAQVGDYPKLRARATTKTDVGLDKIPNAISDDPALDRGDVLATTKATR
                     AVQLRAAQDLDDLAKSLGTAARRDVGTDAGDLLEVGAFGWGTNDSPVAASVNIYESSV
                     TKFTPATEYVPEIFGMSYGVVATFAYSERETRASQLFFGQSPENKLMFRSGNYTWAPF
                     LEIWHSGNLNPQAIVPAGAVVAFAMYSPPAGYLKANGAAVSRTAYAALFATIGTYYGA
                     GDGSTTFNLPDYRGEFLRALDDGRGLDLGRQLGTLQSSQNLAHTHGASSSGNGGHTHT
                     VTGTAAAAGAHSHSIASVNATALVSGTRLATLVGNASNSTTDVAGDHTHAVTGVAALE
                     GTHNHTIYVESSGGSEARPRNVSVLICIKY"
     gene            complement(695155..695679)
                     /locus_tag="PSPA7_RS03260"
                     /old_locus_tag="PSPA7_0686"
     CDS             complement(695155..695679)
                     /locus_tag="PSPA7_RS03260"
                     /old_locus_tag="PSPA7_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_012074131.1"
                     /db_xref="GI:501021464"
                     /translation="MIKLHLPFWLDGPELAKLRRAAQAWWERAEGWLRWPLLQLDAET
                     CHLTILDLLAWQRDISRFRGEPEPLYRLRVKHAFVNAVDAGSVAGVKRILQRLGVGYV
                     EIEERMPGRDWDVVLLTLTDSQLSANPELLRVLVQQYGRTCRRYDFQTITPVTLHVVA
                     VDFNDDQQTLVATL"
     gene            complement(695672..696844)
                     /locus_tag="PSPA7_RS03265"
                     /old_locus_tag="PSPA7_0687"
     CDS             complement(695672..696844)
                     /locus_tag="PSPA7_RS03265"
                     /old_locus_tag="PSPA7_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074132.1"
                     /db_xref="GI:501021465"
                     /translation="MTVDFKAALRDAGIPTTEAELRKAWEKEVEAQGSLLSNTSAYSP
                     FWRIVTALVTKPVLALLEFVAGTVLPNFFVQTAGGAWLDMLAWAVDVERKPATRALGS
                     LLFTRAAPASTLEVPAGTRVQSAAINGHVYELETTQPGLFNDGQTQVAIPVQAVEPGS
                     GFNLAPGYYAILPVPVPGIVQVVNPDGWLTQPGADSEPDSQLRLRVRNQFSAVNQYHT
                     DAVYRAMISGFQGVRPDGVYFEHGAPRGPGSANAFVLFDAGVPADEYLQQINAYIRDQ
                     GNHGHGDDLQVFVMPETLHQVRVEIWPRANLSIEQRAELKTQVEQFIRAAFRESTASD
                     YQPTLTYPQSRFSFSRLAEELHEQFPRLESLHFDNTDILSQLNIPRLQSLQVVAHD"
     gene            complement(696841..697161)
                     /locus_tag="PSPA7_RS03270"
                     /old_locus_tag="PSPA7_0688"
     CDS             complement(696841..697161)
                     /locus_tag="PSPA7_RS03270"
                     /old_locus_tag="PSPA7_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074133.1"
                     /db_xref="GI:501021466"
                     /translation="MTALYIDLLIVGNDLDLDPSHQPRLVDDRASIAQDIAHLIRESG
                     LLVTLVAERSRLRQRDCIQQLELLVESDERLVPGTVRIIEEGPGRYLVTATTVEFGAI
                     EVTL"
     gene            complement(697158..699212)
                     /locus_tag="PSPA7_RS03275"
                     /old_locus_tag="PSPA7_0689"
     CDS             complement(697158..699212)
                     /locus_tag="PSPA7_RS03275"
                     /old_locus_tag="PSPA7_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail tape measure protein"
                     /protein_id="WP_012074134.1"
                     /db_xref="GI:501021467"
                     /translation="MSTKSTAKLDFVLRLIDQVTAPAAKVSKSLMDVAEVGKRGFMQV
                     GAGIAGVVGSLMAFRQSLAPALEQTGALGEIQSLGVAQDALDELNQASMEFAANYGEH
                     ASAFVRSAYQVEGAIKGLVGSELASITSASNVLAKATKADADTMTTYIGTMYGLFQGQ
                     ADAMGRAKWVEQLTGQTARAVQLFRTSGAQMNDAFKAVGIGASAAGADLVEQMAVLGT
                     LSQTMEGGEAGGLYKAFFENVSAAQDKLGMKFTDAGGRLLPIMQILDKLQVKFGQLTK
                     QSDLDAITGAFGGEAARMIVTLLKDTGALANNLDQLGKVKGMERAEQMARAMVDPWQQ
                     LDSVIENIRISFGMVLLPVLNPLIEGLRDAGNTFQRWLVMFPNIARWLGYITLGVLGL
                     VAAAGMLTVLGGLLSLFSVLVSPVALLVLAFIALAAAVVGAIVYWDELRAAFGDTSWF
                     QAIVIMVTPVVLLFRILGALLGLLWDKFAQLWDMGVKFAQSLGLLSESTAGATDAWGG
                     LLKVLANLTPLGMLGKALRGLIQLLNLIPGVSIDAEFGDLPAAPQPAELPALQQSVAP
                     VLEHATAPRIPAQPLVLLPQVAPLPDVPALQALPQATVPPAPVATERMDAAQRAREAI
                     NRAIPSLSPSQPASVPRGGLLQTIQNSNRTDRGTHIEKVEIRTDKPLTPHELEGLLEM
                     AG"
     gene            complement(699391..699678)
                     /locus_tag="PSPA7_RS03285"
                     /old_locus_tag="PSPA7_0691"
     CDS             complement(699391..699678)
                     /locus_tag="PSPA7_RS03285"
                     /old_locus_tag="PSPA7_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074136.1"
                     /db_xref="GI:501021469"
                     /translation="MTERTEITLEIQDTEFLFTLTPADVTRYFNAVTQNNKVAPSNNL
                     LRSTVKQEQLASLRPHLANPMTVMKLAGALLEEYAPDVEVTVKKRSTEPSD"
     gene            complement(699675..700160)
                     /locus_tag="PSPA7_RS03290"
                     /old_locus_tag="PSPA7_0692"
     CDS             complement(699675..700160)
                     /locus_tag="PSPA7_RS03290"
                     /old_locus_tag="PSPA7_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme"
                     /protein_id="WP_012074137.1"
                     /db_xref="GI:501021470"
                     /translation="MSRVLLALVACLVALLIERGCLQRTNDRASRDLQDARREVAGLQ
                     QAAQVAGELLAARDALDLKHTQELNDERNANERLRAAVDAGRQRLHVKATCPAPVPTD
                     AGAAGLAAAGAAELDRTARQDYYALRDDLALTRRMVLALQDYARSCSRSFSTQPQGST
                     Q"
     gene            complement(700157..700618)
                     /locus_tag="PSPA7_RS03295"
                     /old_locus_tag="PSPA7_0693"
     CDS             complement(700157..700618)
                     /locus_tag="PSPA7_RS03295"
                     /old_locus_tag="PSPA7_0693"
                     /EC_number="3.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme"
                     /protein_id="WP_012074138.1"
                     /db_xref="GI:501021471"
                     /translation="MKLPPKLAAGGGVLALAAALVAPFEGRSLVAYLDPVGIPTICEG
                     ITAGVRMGDRATPAECDALLERELQRAVDAVDRQVLVPLPDTRRAALGSFVYNVGEGQ
                     LARSTLLRKLNAGDVRGACAELSRWVYAGGKKLGGLVRRRAAERELCEIGL"
     gene            complement(700615..700869)
                     /locus_tag="PSPA7_RS03300"
                     /old_locus_tag="PSPA7_0694"
     CDS             complement(700615..700869)
                     /locus_tag="PSPA7_RS03300"
                     /old_locus_tag="PSPA7_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074139.1"
                     /db_xref="GI:501021472"
                     /translation="MAVIDHRLTDVERLNRDVPPRLTRLEQQFEHVTDQLDELNQGQQ
                     KLAVTVDGLGRKIAWALGVASALWAVIQMVAPHLLRGVMP"
     gene            complement(700920..701129)
                     /locus_tag="PSPA7_RS03305"
                     /old_locus_tag="PSPA7_0695"
     CDS             complement(700920..701129)
                     /locus_tag="PSPA7_RS03305"
                     /old_locus_tag="PSPA7_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraR"
                     /protein_id="WP_012074140.1"
                     /db_xref="GI:501021473"
                     /translation="MADCFDRAQARELQDRELALQAHQVRVRPSGPSLTHCQECGEQI
                     PEARRALGGIIRCTPCQARFEKGGR"
     gene            complement(701129..701578)
                     /locus_tag="PSPA7_RS03310"
                     /old_locus_tag="PSPA7_0696"
     CDS             complement(701129..701578)
                     /locus_tag="PSPA7_RS03310"
                     /old_locus_tag="PSPA7_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_012074141.1"
                     /db_xref="GI:501021474"
                     /translation="MARISGMNFDITLGDLQVHVEKATLDITDNSAVAQTRGVPDGFV
                     DGDVTASGEYELDAANFALLIEAAKRAGSFRKLEPVDSLFYAKAGDSEVRVEAFGCKL
                     KVSSLLDIDPKGGSKTTHKVPFDVTSPDFIRINGVPYLDASETEDLR"
     gene            complement(701582..702697)
                     /locus_tag="PSPA7_RS03315"
                     /old_locus_tag="PSPA7_0697"
     CDS             complement(701582..702697)
                     /locus_tag="PSPA7_RS03315"
                     /old_locus_tag="PSPA7_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_012074142.1"
                     /db_xref="GI:501021475"
                     /translation="MALGSVSVNNLNLGQGPVTAIERYFLFIGPASKNVGKFLALNTQ
                     SDLDVQLGIPDADLKRQIAAARANGGPRWACMAAPIGADGRWQDALAAAQQQGVSVEA
                     VVITRPVATAAELQEMHAAAVELSNRYGRRVFVMAAVAGLVEGQDWATYLSQARALVA
                     DLAAPRVLCVPQLHGNNLGVLAGRLATDEASIADSPMRVPTGAVLALGETPKDKDGVP
                     LDMATLAELDKARYSVPQTYPDYPGVFWGDGNMLDAPGSDFNVVENLRVADKAARRVR
                     ILLIQRVADRRVNNTPASMAATASALMRPLREMSRSTTFAGLVFPGEIQPPLDGDVVL
                     TWKSRTEIEAFIRVRPYNCPKTLTANIALDLSGGDEE"
     gene            complement(702709..703389)
                     /locus_tag="PSPA7_RS03320"
                     /old_locus_tag="PSPA7_0698"
     CDS             complement(702709..703389)
                     /locus_tag="PSPA7_RS03320"
                     /old_locus_tag="PSPA7_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012077224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virion morphogenesis protein"
                     /protein_id="WP_025297584.1"
                     /db_xref="GI:644280492"
                     /translation="MARCAMAEPLNLDLRGLLGVRAQLALATLPPQLRRRLLNNALKR
                     VRAQARRNVSGQQSPDGTPFEPRKRKGRRKMLAGLVKPKHLNVTQLNADQGVLGWRNG
                     LMGHIAGQHQDGYTERRTAAQMRRWNRVQPNQACTEKQAKRLRRLGFRVRQAGKRGLS
                     RPSVPWIQEHVGFLQAGLLIRVLRDEQPGPQSWEITLPKRTFLGITQDETGRLVAQLL
                     EQILNSPR"
     gene            complement(703367..703804)
                     /locus_tag="PSPA7_RS03325"
                     /old_locus_tag="PSPA7_0699"
     CDS             complement(703367..703804)
                     /locus_tag="PSPA7_RS03325"
                     /old_locus_tag="PSPA7_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012077223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_012074144.1"
                     /db_xref="GI:501021477"
                     /translation="MNKLRALTAYLIERRLVPAEQLDSFAEQVNLALVWKPEERGLRL
                     GDMRYRAVIILERLADHPARLMALVGSWLENNDPDRDGLPDPVFDVEQMDRDLADVEL
                     AVEFVEPVHLAEDSAGEIEAFGRRWAFVPFDLWIAEHGEVRHG"
     gene            complement(703806..704267)
                     /locus_tag="PSPA7_RS03330"
                     /old_locus_tag="PSPA7_0700"
     CDS             complement(703806..704267)
                     /locus_tag="PSPA7_RS03330"
                     /old_locus_tag="PSPA7_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012077222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="head protein"
                     /protein_id="WP_012074145.1"
                     /db_xref="GI:501021478"
                     /translation="MSFSGKPTHVIQQAIPNDGFWPDLDVAEFQRLYRMPAEYLLDLL
                     VDGVTTARAEVNQDLAKRKRAWQTAGVTRLETADPQVLPDRAEYVAHYKRAVYCRAKA
                     QLLGQFATVNRRPEAENLAKEAEQTRELFLSYSQQAVRLIQGRSRITAELI"
     gene            complement(704365..705102)
                     /locus_tag="PSPA7_RS03335"
                     /old_locus_tag="PSPA7_0701"
     CDS             complement(704365..705102)
                     /locus_tag="PSPA7_RS03335"
                     /old_locus_tag="PSPA7_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="terminase"
                     /protein_id="WP_012074146.1"
                     /db_xref="GI:501021479"
                     /translation="MSLALAHKRRILAEGVAAGAATVPAYNPSEALNSPANAQKHLAL
                     MLTALDGDLERISAINSREERQRLKRDELLPKYLDYVQRYRAAGLVYPNPVLVQVLVW
                     LFDTVQFEAGLELALFAIGDGQEMPERFKRRDVQTFVADEVIDWAEAEYKAGRAPEPY
                     VSNLLPLVDGQWQLFERIPARYHKLLGQLAMDNEEWAQAIEHLDRAVELYPEIGVGTR
                     RAAAAKALAKAEAAKQSDEGDEPPPTP"
     gene            complement(705099..706121)
                     /locus_tag="PSPA7_RS03340"
                     /old_locus_tag="PSPA7_0702"
     CDS             complement(705099..706121)
                     /locus_tag="PSPA7_RS03340"
                     /old_locus_tag="PSPA7_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage capsid protein"
                     /protein_id="WP_012074147.1"
                     /db_xref="GI:501021480"
                     /translation="MGALSERAQAQYQQLQEDMAEAYNVHDTARTFAVEPTHAQELND
                     QITERADFLGRINVVPVSEIKGEKVLLGLNGPASSRTDTSTKDREPRDLLDLKNNEYE
                     LFHTETDVALKFATIDSWAKFPDFADRYLAAVQRRIALDRILIGFHGTHAAKQTDLQQ
                     FPMLQDVNKGWLQLARELIPEQVLKSADPAKKIVIGKGGDYANLDAAVHDVKQMIDPV
                     FRDEGDLVAIIGSDLLAYDKGKLYAAQGQTPTEKERIEEAQVIATYGGLPSFLVPFFP
                     VKGIMVTSWDNLSIYFQDTSWRRHLLENPKRSRVEDYNGRNEGYVIEQLGKFAALESD
                     SVELAP"
     gene            complement(706121..707074)
                     /locus_tag="PSPA7_RS03345"
                     /old_locus_tag="PSPA7_0703"
     CDS             complement(706121..707074)
                     /locus_tag="PSPA7_RS03345"
                     /old_locus_tag="PSPA7_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="scaffolding protein"
                     /protein_id="WP_034019549.1"
                     /db_xref="GI:730457073"
                     /translation="MPRSLVSPWKRVAVSGDTVDGRVITEQELRDCAETYDRSFYTAT
                     IWAEHDRWRGAHGTVYEVRLVEAKDDPELEPGQVSLEARLRPNDDLLALNDQGKGLFS
                     SIEIWPNFRNSGRCYLSGMAVTDEPASTRTQELYFSRRRPNGAGVRFFTNSHPLSNLR
                     EDDGATAPEVRGLIASLTRVFKLFSVPNTPTENPSSDEVEPMDEATAKALKALYDQLV
                     IILAGLQAVIEPVVEDVDTSDTQEQVDAVGAAVQDVVDQADEERDFKRKKGKEGKETK
                     ELSARMDELQDTMAKLLNTAQGRKIPRTTGAAAKARGKGLR"
     gene            707232..709280
                     /locus_tag="PSPA7_RS03350"
                     /old_locus_tag="PSPA7_0704"
     CDS             707232..709280
                     /locus_tag="PSPA7_RS03350"
                     /old_locus_tag="PSPA7_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="terminase"
                     /protein_id="WP_012074149.1"
                     /db_xref="GI:501021482"
                     /translation="MSYSIEVKEAAKRLYLRRAKPKEIQAQLGLPNVRIVYYWIARGG
                     WDELLTDEEPLAAISRRITLIAEKPGALSKADLDELDRLTSIRERLQKQAARPAPSPA
                     GEPAPEARAERGRERGERPPREGKRKPKKLKNDVSGVTEIDFLDKFTSRMFGYQLELF
                     AAKKNPLTARIRHILKSRQIGLTYYFAAEAFMDAVLTGDNQIFLSASRAQSEVFRSYI
                     VAFAAQWFDIELSGNPIILSKDGKPWAELRFLSTNSNTAQSYHGHVYIDEVFWIPNFQ
                     KLQTVASAMASHAKWRLTYFSTPSAVTHQAYPYWTGEEFRNSKRGKKAGPWPSEAQIH
                     AGALCPDGQWRKVITIQDAIAGGCNLFDLERLQLEYDEERFEQLFMCKFIDSTQAAFA
                     LADLERCYSDLGLWTDYDPDSPRPFDNRPVWLGYDPSRTRDDATCVVVAPPLEPGGKF
                     RILEKHSWRGTSFTHQAKQIEKLCERFNVQHIGIDITGVGYGVFDLVKDFFPRATPIH
                     YSLEAKNALVLKAQDVIQGKRIEWDAGWTEVAAAFLSIKRGTTASGLITYSASRTEAT
                     GHADVAWSIMHALAHEPLNTNKRRRSRYSLSSSTQATHGKAKTTAAGTTAQRRARVLV
                     RRTGTGADTEYRRVPGRLRQRVRADLPAARVAPGAGQAAACKPPSRRHRTVQAQPAVA
                     "
     gene            709192..710046
                     /locus_tag="PSPA7_RS03355"
                     /old_locus_tag="PSPA7_0705"
     CDS             709192..710046
                     /locus_tag="PSPA7_RS03355"
                     /old_locus_tag="PSPA7_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="terminase"
                     /protein_id="WP_034019547.1"
                     /db_xref="GI:730457069"
                     /translation="MSRQGLAKLLRANPHHGAIAPFKRNLLLRDFLPSLGLSVQTMRC
                     VGLDHMVFGECFLYLRENIAGQVLELEHLPAINMRCRLDGGYTMLLPHAEELEFDQDE
                     VLHLKEYDVEQNIYGIPDYLGGLQSLLLNEAATLFRRRYYSNGAHAGYVFYTNDENLS
                     EEDEENLKQQIAASKGVGNFRSMFVNIPGGSEKAIQIIPVGDFQAKDELEKVKNITRN
                     DVIAAWRMNPALAGIIPENSAGFGDIEKIDRVYMNNEIRPIQQLFLQVNEVLREDRRI
                     AFKEPVSG"
     gene            710092..710352
                     /locus_tag="PSPA7_RS03360"
     CDS             710092..710352
                     /locus_tag="PSPA7_RS03360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019725794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023122741.1"
                     /db_xref="GI:553791683"
                     /translation="MRVYCKVCGEKARIATREDITPEFAKLYCQCLDAKGCGHRFVMN
                     LSFSHTLVPAAEPLDRLLFDRLRELPRHLQVELFNQLGALRS"
     gene            complement(710328..710537)
                     /locus_tag="PSPA7_RS03365"
                     /old_locus_tag="PSPA7_0706"
     CDS             complement(710328..710537)
                     /locus_tag="PSPA7_RS03365"
                     /old_locus_tag="PSPA7_0706"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074151.1"
                     /db_xref="GI:501021484"
                     /translation="MEFQTVNLTSIREGLDDSRYVMKFIGAAVCHGQLGVEERLGAQI
                     VMEWLDQRMNDTASTLLVQDRKAPS"
     gene            complement(710896..711177)
                     /locus_tag="PSPA7_RS03370"
                     /old_locus_tag="PSPA7_0707"
     CDS             complement(710896..711177)
                     /locus_tag="PSPA7_RS03370"
                     /old_locus_tag="PSPA7_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074152.1"
                     /db_xref="GI:501021485"
                     /translation="MSNGAPVHVQERQVFNVSPERNRQAQAQLGLPPSFVIFEASGVL
                     NYFTGLGVVQVPLPQGEFLVGLQDPVGARRFGVVRFDGLDDQEGWGEQQ"
     gene            complement(711401..711688)
                     /locus_tag="PSPA7_RS03375"
                     /old_locus_tag="PSPA7_0709"
     CDS             complement(711401..711688)
                     /locus_tag="PSPA7_RS03375"
                     /old_locus_tag="PSPA7_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012639358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049792003.1"
                     /db_xref="GI:908647989"
                     /translation="MRRIPTVAAGALCSKADGTSGRSQMRVRNDEIRQLCKLARAMGY
                     AVQQTKRLHLKFTKPGRPPVFCSSTPGDCRAWLNARAQLRRSELMAEGGPA"
     gene            complement(712084..712440)
                     /locus_tag="PSPA7_RS03385"
                     /old_locus_tag="PSPA7_0710"
     CDS             complement(712084..712440)
                     /locus_tag="PSPA7_RS03385"
                     /old_locus_tag="PSPA7_0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074155.1"
                     /db_xref="GI:501021488"
                     /translation="MQNEQTPRQTLEAVLVTALIERATTAALKQLVPAALCHTEKGSV
                     IGRFLLALDDGAGHPFNLNDLRRLEHVQLDACLQILAVDHAGRLNVRQRVEKDADGRL
                     VWALLSSMWAPRKPNA"
     gene            complement(712456..712857)
                     /locus_tag="PSPA7_RS03390"
                     /old_locus_tag="PSPA7_0711"
     CDS             complement(712456..712857)
                     /locus_tag="PSPA7_RS03390"
                     /old_locus_tag="PSPA7_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074156.1"
                     /db_xref="GI:501021489"
                     /translation="MNASQPLTHELARVCGPFDLASTTAHQDFLHCWRRGAKLLGLPL
                     LQLPPARHWEIPVIEDAHLPQLLKAFRTLDTSRQVLLLTMLSLAGFKRSAWLSQEVGL
                     EFGQLAACRLGNEVFQVVVGLLAHHRETPSN"
     gene            complement(712829..713029)
                     /locus_tag="PSPA7_RS03395"
                     /old_locus_tag="PSPA7_0712"
     CDS             complement(712829..713029)
                     /locus_tag="PSPA7_RS03395"
                     /old_locus_tag="PSPA7_0712"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074157.1"
                     /db_xref="GI:501021490"
                     /translation="MSLPADIAYRRDCLARHVLRHWRREEITEWLADPKHSEEYREDM
                     RKRLNEQQKEIRRNERKPTAHP"
     gene            complement(713460..716153)
                     /locus_tag="PSPA7_RS03400"
                     /old_locus_tag="PSPA7_0713"
     CDS             complement(713460..716153)
                     /locus_tag="PSPA7_RS03400"
                     /old_locus_tag="PSPA7_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074158.1"
                     /db_xref="GI:501021491"
                     /translation="MTARSTQEQFEDIYRQDVIPALENDRELDFKPHEASDEYLNKGQ
                     CPGCGKRSLYISKSKPYQLKCNRLNQCGYEEKTRERYRHLFENLSERFPSTPENPNAT
                     ADAYLQRSRGFDISKIAGWYTQGRRPMANGSWADTVRFPLCNGYWERIIDARAVAANE
                     GDKAGIRKGMTYKGDGWEPTGQTYEKNDRVYIVEGIFHAIALWLAGYKVIASISANNF
                     PWRILEENKGKLITWIIALDDDPAAHAVIPKYLAGIRKRGEIGWVALAGQRADGKKRD
                     WDDVYRDGQLDDAFLQEACYRGRLFCATSPMKKAYLLYIKRPRPFFLVEFDNCLYSAR
                     VNLTELQKDLDGDDVDGHQPEFAKHTTISQVANCVPRFEYIERDAITGEQRYFFQFDF
                     PNSRLNCKEPLPPSAITEPRGFTKALLERTPGGMFEGGERVLAMLKSEWLRNPSTVRT
                     LPFIGYDEATGAYCYPSFGFHKGKEIMTNDHGFLDIGGDGLKTSARSYPVFQGEAFDP
                     SWFADFRAVFSLNGLAALSWWTGTLFAQQIRSAQSSWPFLELTGVAGSGKTTLLRFLW
                     RLIGRKDEEGIKPSGNGASGIGLLRAMSAVSNMPVVLLESDREKTDAMGRTLTEQYSW
                     DEIKPLFDHNAKLRVTGVKSGNSDTEALIFRGAVCISQNTMVDGSEAILTRIVYLHMT
                     LDHHSPDLKPLADRLKAIPVEQLAGYLRAVLCQENAWLQRYFEAFPHYEQRFMSQSGV
                     SHSRIVLCHAQVMAAAKATQSLFPAWTDRDLESLARHLEARALDRQQSCTAENKTAAQ
                     FWQIYHYLNEQTVTVTDSDGETHHEIRETLNHSTEKGLIAVNLNHFQQACRAAGQEVL
                     PTALLQRYLRQSRTHTFIETRKCHSRLEQRSINCWIFKRAG"
     gene            complement(716164..716406)
                     /locus_tag="PSPA7_RS03405"
                     /old_locus_tag="PSPA7_0714"
     CDS             complement(716164..716406)
                     /locus_tag="PSPA7_RS03405"
                     /old_locus_tag="PSPA7_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074159.1"
                     /db_xref="GI:501021492"
                     /translation="MQITIDTPYVTPNEFARRAGLNERTVRNKIERGEFLIRPKWPGE
                     AKGTVFINMIDLAMEAAEQAQRVRAEKKANGKAGKQ"
     gene            716500..716736
                     /locus_tag="PSPA7_RS03410"
                     /old_locus_tag="PSPA7_0715"
     CDS             716500..716736
                     /locus_tag="PSPA7_RS03410"
                     /old_locus_tag="PSPA7_0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074160.1"
                     /db_xref="GI:501021493"
                     /translation="MDLPAKFKAIRAKEKLTQAEFCALVEISISSWKKYEASIIDMGA
                     TPLLKVTNHPRFLKYTLWLMTGTTAPACGQVSPE"
     gene            complement(717868..717944)
                     /locus_tag="PSPA7_RS03415"
     tRNA            complement(717868..717944)
                     /locus_tag="PSPA7_RS03415"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(717908..717910),aa:Met,seq:cat)
     gene            complement(717961..721698)
                     /locus_tag="PSPA7_RS03420"
                     /old_locus_tag="PSPA7_0717"
     CDS             complement(717961..721698)
                     /locus_tag="PSPA7_RS03420"
                     /old_locus_tag="PSPA7_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012074162.1"
                     /db_xref="GI:501021495"
                     /translation="MQRLQAVLLLCLACCWPGLATALTLSPEERAWLAEHPELRLGIG
                     TSWPPFEFRDAQGHYQGLAANYIALLQERLRVSMTPVEPRSRTQVLEQARAGRLDLLP
                     GIMATPERQEYLTFPRPYLDFPIIILARKNGPLPKRIDELYGLKVAVVDHYAPHELLV
                     ARHPDLTLLPLPSVAAALQALATGQADAFVGDFASSVWNLRQLKLSGLEISGETPYRY
                     QLAMAVPRGEPILAGIIDKVFADLRAEEIDRLQAPWVGGLLDRRPAWGALARYGIPVA
                     LLILVSVAVLLAMNRRLRREVSRRRQLEQDLRDSEQHYRGLVESLNAIAWEMRLTENR
                     FTYVSPHAERLLGYPLAEWLEPGFWQRTLHPDDAEHAIDYCLSESQAGRDHSFDYRML
                     AADGRVVWIRDLVTLIGQGHELLLRGLMIDITETKHTEQALRLSEQKFASVFHHCPDM
                     VVLANGADGRFLAVNSTFEQQIGIAATEALGKTATELGIWGAPGLGPQVLEKLAQGNL
                     ANLEVPLRRRDGDTFSALLSAQHVTLDQRPALVVVIRDITRLLETQELLRISEEKFAN
                     AFHASPDGLLISRLEDGTLIDVNEGFSRLTGYRRDEVTSRSTLELGLWVDPEDRKRLM
                     SLVRHHTLTQGFTAPVLIRNGSIRQCEMSAHQISIGGEDCVLTIARDVTERQLMEEKL
                     QQAATVFESTAEGVMITDTRQRITAVNRAFSEITGYSEQEALGQSPRLLSSGQHDRAF
                     YLAMWNQLEREGHWQGEIWNRRKTGELYPEWLTISAVHNPQGEITHFVGVFADISTLK
                     YAQARLDYQAHHDPLTGLPNRLLFEHRLDHALDEAREESRPGAVLFIDLDRFKHINDS
                     LGHPTGDLLLKAIAERLRDQLRDVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNA
                     FTAPFQADGHEFFVSASIGIALFPKDGDDAPTLVKNADAAMYRAKSRGRSRIEYYTRE
                     LTFLATERMALETELRRALERDELLLYYQPKLSLESGLLVGAEALVRWHHPLFGEISP
                     ERFIPLAEDCGLILPLGDWVLEHACQQMGDWQKLHAPFGPLSVNLAGAQLGQPQLIER
                     LRQLLAQSGLEPSRLQLEITESFIMNQTEEALGVLRGLKDLGVQLAIDDFGTGYSSLS
                     YLKRLPLDILKIDKSFIRGLPDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFL
                     THEGCEQIQGFVLSPPLPAELFASKFLKPRQPIGAPREAPV"
     gene            complement(721805..723658)
                     /locus_tag="PSPA7_RS03425"
                     /old_locus_tag="PSPA7_0718"
     CDS             complement(721805..723658)
                     /locus_tag="PSPA7_RS03425"
                     /old_locus_tag="PSPA7_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009875775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_012074163.1"
                     /db_xref="GI:501021496"
                     /translation="MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVE
                     DIIRMINDMGINVFETAPDADALLLAEADTDEAAAEEAAAALAAVESDIGRTTDPVRM
                     YMREMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFPGTVDSILADYNRIVAEGGRL
                     SDVLSGYIDPDDGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDNSDSDDEGDGGPDP
                     EEARLRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVAR
                     VRSALEGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPKYAEAI
                     ERLRDDILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARRAKKEMVEANLRLVI
                     SIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQ
                     ARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMDMPEDKIRKVLKIAKEP
                     ISMETPIGDDEDSHLGDFIEDSTMQSPIEMATSESLKESTREVLAGLTAREAKVLRMR
                     FGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE"
     gene            complement(723738..725729)
                     /locus_tag="PSPA7_RS03430"
                     /old_locus_tag="PSPA7_0719"
     CDS             complement(723738..725729)
                     /locus_tag="PSPA7_RS03430"
                     /old_locus_tag="PSPA7_0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_012074165.1"
                     /db_xref="GI:501021498"
                     /translation="MAGLIPQSFIDDLLNRTDIVEVVSSRIQLKKTGKNYSACCPFHK
                     EKTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDQLEFPQAVEELAKRAGMDVPREER
                     GGRGHTPRQPSDSPLYPLLAAAAEFYKQALKSHPARKAAVNYLKGRGLTGEIARDFGL
                     GFAPPGWDNLLKHLGGDNLQLKAMLDAGLLVENSDSGKRYDRFRDRVMFPIRDSRGRI
                     IAFGGRVLGDDKPKYLNSPETPVFHKGQELYGLYEARQKNRDLDEIMVVEGYMDVIAL
                     AQQGIRNAVATLGTATSEEHIKRLFRLVPSILFCFDGDQAGRKAAWRALESVLPNLQD
                     GKRVRFLFLPEGEDPDSLVRAEGEDAFRARITQQAQPLAEYFFQQLMAEADPATLEGK
                     AHLATLAAPLLEKIPGNNLRQLMRQKLSEITGLSGENIGQLAQQSPPPAMDHGTTGAF
                     DGDDYFAASAYYENEPSHAPFESAPGYADAQPRKAWNKDRKPWDGKKWDGRKKWDKGG
                     RGDFKAPQRTPVSVESTTLNALRTLLHHPQLALKVDDAGTLAREQDTYAQLLVSLLEA
                     LQKNPRQSSMQLIARWHGTPQGRLLQALGEKEWLIVQENLEKQFFDTITKLSESQRFG
                     EREERLRSVMQKSYSELTDEEKALLREHYSLAASSPSQS"
     gene            complement(725812..726261)
                     /locus_tag="PSPA7_RS03435"
                     /old_locus_tag="PSPA7_0721"
     CDS             complement(725812..726261)
                     /locus_tag="PSPA7_RS03435"
                     /old_locus_tag="PSPA7_0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003137358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003085042.1"
                     /db_xref="GI:489175516"
                     /translation="MSEIKSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERIE
                     VDDARALLILDRMIKQRRDAQRQFSDAGRQDLAEVEAAEILVLQDFMPKPLDDHEIDA
                     LIERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARLSS"
     gene            complement(726329..726544)
                     /gene="rpsU"
                     /locus_tag="PSPA7_RS03440"
                     /old_locus_tag="PSPA7_0722"
     CDS             complement(726329..726544)
                     /gene="rpsU"
                     /locus_tag="PSPA7_RS03440"
                     /old_locus_tag="PSPA7_0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I5V8.3"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_003085057.1"
                     /db_xref="GI:489175531"
                     /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAE
                     RKRKAAAAVKRHAKKVQREQRRRERLY"
     gene            726745..727770
                     /locus_tag="PSPA7_RS03445"
                     /old_locus_tag="PSPA7_0723"
     CDS             726745..727770
                     /locus_tag="PSPA7_RS03445"
                     /old_locus_tag="PSPA7_0723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019371404.1"
                     /note="universal genome maintenance protein;
                     Kae1/Qri7/OSGEP/YgjD family protein; in Archaea, some Kae1
                     are found as fusion proteins similar to two distinct
                     proteins in yeast that are involved in the KEOPS complex;
                     kinase associated endopeptidase 1 (Kae1) and a
                     serine/threonine protein kinase (Bud32); in Pyrococcus
                     Kae1 has atypical AP endonuclease activity and inhibits
                     the kinase activity of Bud32; the protein is essential in
                     Escherichia coli and Bacillus subtilis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA N6-adenosine threonylcarbamoyltransferase"
                     /protein_id="WP_012074166.1"
                     /db_xref="GI:501021499"
                     /translation="MRVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVYGGVVP
                     ELASRDHVKRMLPLIRQVLDESGCKPADIDAIAYTAGPGLVGALLVGASCAQAMAFAW
                     GVPAVGVHHMEGHLLAPMLEEQPPRFPFVALLVSGGHTQLVRVDGIGRYQLLGESVDD
                     AAGEAFDKTAKLIGLGYPGGPEIARLAERGTPGRFVFPRPMTDRPGLDFSFSGLKTFS
                     LNTWQRCVEAGDDSEQTRCDIALAFQTAVVETLVIKCRRALKQTGLKNLVIAGGVSAN
                     QALRGGLEKMLGEMKGQVFYARPRFCTDNGAMIAYAGCQRLLAGQHDGPAIAVQPRWP
                     MESLPAV"
     gene            complement(727849..728418)
                     /locus_tag="PSPA7_RS03450"
                     /old_locus_tag="PSPA7_0724"
     CDS             complement(727849..728418)
                     /locus_tag="PSPA7_RS03450"
                     /old_locus_tag="PSPA7_0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9I5V6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_012074167.1"
                     /db_xref="GI:501021500"
                     /translation="MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNML
                     RVAGKKLAILTLLGDVGKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGG
                     KGVATAAGMLLGLYPPAVLLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGAL
                     LPMTVLTALIVWRHRANLRDLFAGRERHF"
     gene            728502..728855
                     /locus_tag="PSPA7_RS03455"
                     /old_locus_tag="PSPA7_0725"
     CDS             728502..728855
                     /locus_tag="PSPA7_RS03455"
                     /old_locus_tag="PSPA7_0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003099587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin triphosphate 2'-epimerase"
                     /protein_id="WP_003149641.1"
                     /db_xref="GI:489241427"
                     /translation="MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAG
                     DDIALALDYAALSERVLQFARESHFQLVETFAERLAEVLMDERGIPWLRIRVTKPGAV
                     PAARGVGVEIERGCR"
     gene            728846..729388
                     /locus_tag="PSPA7_RS03460"
                     /old_locus_tag="PSPA7_0727"
     CDS             728846..729388
                     /locus_tag="PSPA7_RS03460"
                     /old_locus_tag="PSPA7_0727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017001531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_003149639.1"
                     /db_xref="GI:489241425"
                     /translation="MSLIPVYLGLGSNVERERHLHAGLDALAGFLHDLRCSPVFESEP
                     VGIRSGPFFNLVVSARTDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLLYGDLV
                     GDFDGLVLPRAEVLKNAFVLWPLAELAPELEHPLARRAFGELWRESRIPQKLWPAPFE
                     WRGRALTPEALLQAFPRSSL"
     gene            complement(729361..730593)
                     /gene="cca"
                     /locus_tag="PSPA7_RS03465"
                     /old_locus_tag="PSPA7_0726"
     CDS             complement(729361..730593)
                     /gene="cca"
                     /locus_tag="PSPA7_RS03465"
                     /old_locus_tag="PSPA7_0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016252918.1"
                     /note="catalyzes the addition and repair of the essential
                     3'-terminal CCA sequence in tRNAs without using a nucleic
                     acid template; phosphohydrolase activities include
                     hydrolysis of pyrophosphate, 5'-nucleoside tri- and
                     diphosphates, NADP, and 2'-AMP with the production of Pi,
                     metal-dependent phosphodiesterase activity for 2',3'-cAMP,
                     2',3'-cGMP, and 2',3'-cCMP, and hydrolysis 2',3'-cyclic
                     substrates with the formation of 2'-nucleotides and
                     3'-nucleotides; these phosphohydrolase activities are
                     probably involved in the repair of the tRNA 3'-CCA
                     terminus degraded by intracellular RNases; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional CCA protein"
                     /protein_id="WP_012074168.1"
                     /db_xref="GI:501021501"
                     /translation="MQIYKVGGAVRDRLLGRPVTDIDWVVVGASSEEMLARGYRPVGA
                     DFPVFLHPQSGEEYALARTERKSGRGYGGFTFHASPDVTLEEDLTRRDLTINAMAEDE
                     QGRVIDPYGGQADLEARLLRHVSPAFAEDPLRVLRVARFAARYAGLGFRVAAETLALM
                     RQLAGSGELQALTPERSWKEISRALMEPNPEVFVQVLHDCGALAELMPEVEALFGVPQ
                     PAAHHPEIDTGVHVLSVLQQCARHHQPLTVRWACLLHDLGKGLTREADWPRHIAHETR
                     GLPLIDAINRRFRVPRDCQELARLVGEYHTHAHRALELRPTTLLELLQSFDVYRRPQR
                     FEEFVAASEMDARGRHGLEQRDYPQAAYLLGAAQAARAVSVKPLVEKGLKGAELGEAL
                     KRARLAALKAYKEERGKA"
     gene            complement(730636..731142)
                     /locus_tag="PSPA7_RS03470"
                     /old_locus_tag="PSPA7_0728"
     CDS             complement(730636..731142)
                     /locus_tag="PSPA7_RS03470"
                     /old_locus_tag="PSPA7_0728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014602427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074169.1"
                     /db_xref="GI:501021502"
                     /translation="MRLFATILLCLALGACADHPPGVRLTHPASAELPGLQGFQLMPP
                     ERAVDALPYRSRYPLINAELRQGLAAHGYHESATPQFRVYYWLALRDAALEFRPDLPP
                     TSSMGPYLAIHRLRDETGTLRVRLVDLEERILWEGTASTGLSPARANPEQLERAVGAL
                     LQQLPRAR"
     gene            complement(731237..732790)
                     /locus_tag="PSPA7_RS03475"
                     /old_locus_tag="PSPA7_0729"
     CDS             complement(731237..732790)
                     /locus_tag="PSPA7_RS03475"
                     /old_locus_tag="PSPA7_0729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014602428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVR family protein"
                     /protein_id="WP_012074170.1"
                     /db_xref="GI:501021503"
                     /translation="MSKRQPIATGSEWTFELIQQYDREISRIAERYALDTYPNQIEVI
                     TAEQMMDAYASVGMPIGYNHWSYGKHFLSTEKNYKRGQMGLAYEIVINSDPCIAYLME
                     ENTQCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERYGID
                     AVEDLLDSCHALMNYGVDRYKRPYPISAEEERQRQKEREELIQRQVNDLWRTIPRTGG
                     KDKEQSTARYPSEPQENILYFIEKNAPLLEPWQREVIRIVRKIAQYFYPQRQTQVMNE
                     GWATFWHYTLLNDLYDEGLVNDGFMMEFLQYHTSVVFQPSFDSPYYSGINPYALGFAM
                     YRDIRRICEEPTEEDRRWFPDIAGSDWLATLKFAMKSFKDESFILQFLSPKVIRDLKL
                     FSILDDDQKDDLLVAAIHDEAGYRTIRETLAAQYNLGNREPNIQIWNVDRRGDRSLTL
                     RHQQFDRQPLSDSTADVLKHLHRLWGFDIHLETLQGDQLIQTHHMPPKGVSEGEEGYP
                     RLDLIIPPI"
     gene            complement(732787..734058)
                     /locus_tag="PSPA7_RS03480"
                     /old_locus_tag="PSPA7_0730"
     CDS             complement(732787..734058)
                     /locus_tag="PSPA7_RS03480"
                     /old_locus_tag="PSPA7_0730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017517292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074171.1"
                     /db_xref="GI:501021504"
                     /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIT
                     DMEHGEQISIPGRDIDEPVLHHGRGGRQTVVHPGNKEFTAGEHIARPSGGGGGRGGGK
                     ASNSGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHITGTDTFKTIRAGISNDGNPS
                     RINIVRTLRSAHARRIALSGGSRAKLRAALKELERIRREEPDNLGDIQELELEIAKLR
                     ARIDRVPFLDTFDLKYNLLVKQPNPTSKAVMFCLMDVSGSMTQATKDIAKRFFILLYL
                     FLKRNYEKIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKMMQEIMAERYPTHE
                     WNIYAAQASDGDNWNDDSPVCRDILLKQIMPFVQYYTYVEITPREHQALWFEYERVRE
                     AFEDSFAQQQIVSASDIYPVFRELFQRRLVA"
     gene            complement(734159..736081)
                     /locus_tag="PSPA7_RS03485"
                     /old_locus_tag="PSPA7_0731"
     CDS             complement(734159..736081)
                     /locus_tag="PSPA7_RS03485"
                     /old_locus_tag="PSPA7_0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020295462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074172.1"
                     /db_xref="GI:501021505"
                     /translation="MSIFSHFQERFEATRQEEYSLKEYLDLCKQDKTAYASAAERLLM
                     AIGEPELLDTSVDSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVAFFRHAAQGLEEK
                     KQILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNPDEDGAILEED
                     YGIPRRYLRSIMSPWATKRLNEFGGDISQFRVVKLYPSILNQVAIAKTEPGDENNQDI
                     SALVGKVDIRKLEEFPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQ
                     EGNYNSTEGLGALPYSGIILAHSNESEWHSFRNNKNNEAFIDRIYIVKVPYCLRVADE
                     IKIYDKLLINSSLAHAHCAPDTLKMLSQFSVLSRLKEPENSNIYSKMRVYDGENLKDT
                     DPKAKSIQEYRDSAGVDEGMAGLSTRFAFKILSKVFNFDPHEVAANPVHLLYVLEQQI
                     EQEQFQPETRERYLRFIKEYLAPRYVEFIGKEIQTAYLESYSEYGQNIFDRYVLYADF
                     WIQDQEYRDPETGEILNRAALNEELEKIEKPAGISNPKDFRNEIVNFVLRARAGNNGK
                     NPSWLSYEKLRVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVKRMVERGYTEK
                     QVRLLSEWYLRVRKSQ"
     gene            complement(736362..736694)
                     /locus_tag="PSPA7_RS03490"
                     /old_locus_tag="PSPA7_0733"
     CDS             complement(736362..736694)
                     /locus_tag="PSPA7_RS03490"
                     /old_locus_tag="PSPA7_0733"
                     /EC_number="2.8.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015502273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase GlpE"
                     /protein_id="WP_003149627.1"
                     /db_xref="GI:489241413"
                     /translation="MSDTFQRIAPEQARQLRENGAQVVDIRDPQSYALGHISGSRHID
                     NHSVVDFIAAADLDAPLVVVCYHGNSSQSAAAYFIQQGFSDVYSLDGGFELWRSVYPA
                     DTSTGEAE"
     gene            complement(736738..737589)
                     /locus_tag="PSPA7_RS03495"
                     /old_locus_tag="PSPA7_0734"
     CDS             complement(736738..737589)
                     /locus_tag="PSPA7_RS03495"
                     /old_locus_tag="PSPA7_0734"
                     /EC_number="3.6.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UZ94.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase symmetrical"
                     /protein_id="WP_012074174.1"
                     /db_xref="GI:501021507"
                     /translation="MTVYAVGDLQGCLEPLKCLLERVAFDPAKDRLWLVGDLVNRGPQ
                     SLETLRFLYAMREAVVSVLGNHDLHLLAVAHRSERLKKSDTLREILEAPDREALLDWL
                     RRLPLLHYDEQRQVTLVHAGIPPQWSLEKARLRAAEVEEALRDDQRLPLFLEGMYGNE
                     PAKWDKKLHGIERLRVITNYFTRMRFCTEDGRLDLKSKEGLDTAPPGYAPWFSFASRK
                     TRGEKIIFGHWAALEGQCDEPGLFALDTGCVWGAKMTLLNVDSGERLSCDCAGQQASA
                     KPAGPPA"
     gene            complement(737589..737969)
                     /locus_tag="PSPA7_RS03500"
                     /old_locus_tag="PSPA7_0735"
     CDS             complement(737589..737969)
                     /locus_tag="PSPA7_RS03500"
                     /old_locus_tag="PSPA7_0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003121838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein ApaG"
                     /protein_id="WP_012074175.1"
                     /db_xref="GI:501021508"
                     /translation="MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENRGEVSA
                     QLLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQM
                     LGSDGVAFDAAIPVFRLAVPGALH"
     gene            complement(738006..738812)
                     /locus_tag="PSPA7_RS03505"
                     /old_locus_tag="PSPA7_0736"
     CDS             complement(738006..738812)
                     /locus_tag="PSPA7_RS03505"
                     /old_locus_tag="PSPA7_0736"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="WP_012074176.1"
                     /db_xref="GI:501021509"
                     /translation="MSELYQHRARKRFGQNFLHDAGVIHRILRAIHAREGQRLLEIGP
                     GQGALTEGLLGSGARLDVIELDQDLIPLLKLKFGLEPRFSLHQGDALKFDFASLVESD
                     EKLRVVGNLPYNISTPLIFHLLEHAPVIEDMHFMLQKEVVERLAATPGGGDWGRLSIM
                     VQYHCRVEHLFNVGPGAFNPPPKVDSAIVRLTPFAEPPHPARDPKLLERVVREAFNQR
                     RKTLRNTLKPLLSVEDIEAAAVDPTLRPEQLDLAAFVRLANRLAELQGNR"
     gene            complement(738928..739914)
                     /locus_tag="PSPA7_RS03510"
                     /old_locus_tag="PSPA7_0737"
     CDS             complement(738928..739914)
                     /locus_tag="PSPA7_RS03510"
                     /old_locus_tag="PSPA7_0737"
                     /EC_number="1.1.1.262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="WP_012074177.1"
                     /db_xref="GI:501021510"
                     /translation="MSLRFALTPGEPAGIGPDLCLLLARSAQPHPLIAIASRALLQER
                     AGQLGLAIDLLDASPAAWPGAPAKAGQLYVWDTPLAAPARPGQLTPANAAYVLETLTR
                     AGQGCLDGHFAGMITAPVHKGVINEAGIPFSGHTEFLADLTHTRQVVMMLATRGLRVA
                     LATTHLPLREVADAITTERLERVARILHADLRDKFGIARPRILVCGLNPHAGEGGHLG
                     REEIEVIEPCLERLRDEGLDLVGPLPADTLFTPKHLEHCDAVLAMYHDQGLPVLKYKG
                     FGAAVNVTLGLPIIRTSVDHGTALDLAGSGRIDSGSLQVALETAYQMAVSRS"
     gene            complement(739911..741203)
                     /locus_tag="PSPA7_RS03515"
                     /old_locus_tag="PSPA7_0738"
     CDS             complement(739911..741203)
                     /locus_tag="PSPA7_RS03515"
                     /old_locus_tag="PSPA7_0738"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone SurA"
                     /protein_id="WP_012074178.1"
                     /db_xref="GI:501021511"
                     /translation="MKTKLCNRLRPLALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQ
                     SQLDQRLREVHQTLLKRGAPLPPEHVLTQQVLERLIIENIQQQIGDRSGIRISDEELN
                     QAMATIAQRNGMSLEQFQAALTRDGLSYADARDQVRREMVISRVRQRRVAERIQVSEQ
                     EVKNFLASDMGKIQLSEEYRLANILIPVPEAASSDVIQAAARQAQELYQQLKQGADFG
                     QLAISRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSLAVGDVTEPVRTPGGFIILKLE
                     EKRGGSKMVRDEVHVRHILLKPSEIRSDAETEKLAQKLYERIQSGEDFGELAKSFSED
                     PGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSS
                     EKFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVEIKQ"
     gene            complement(741184..743970)
                     /locus_tag="PSPA7_RS03520"
                     /old_locus_tag="PSPA7_0739"
     CDS             complement(741184..743970)
                     /locus_tag="PSPA7_RS03520"
                     /old_locus_tag="PSPA7_0739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent tolerance protein OstA"
                     /protein_id="WP_003152145.1"
                     /db_xref="GI:489243952"
                     /translation="MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQAADQFDCKVSAT
                     GGWDCSPLQNANANLPPRPAHTATSVSTAAAGGSVSGGGETVEAEPAQRLVTESGGRA
                     LKSRSADYSHLDWIPREKLTAAQLAEIGPYCGGSYIEPVRPGMNDGAPNDESPTYVSA
                     KASRYEQDKQIATLAGDVVLRQGSMQVEGDEANLHQLENRGELIGNVKLRDKGMLVVG
                     DHAQVQLDNGEAQVDNAEYVIHKAHARGSALYAKRSENAIIMLKDGTYTRCEPSSNAW
                     TLKGNNVKLNPATGFGTATNATLRVKDFPVFYTPYIYFPIDNRRQSGFLPPSFGSTSD
                     TGFTLVTPYYFNLAPNYDATLYPRYMAKRGMMLEGEFRYLTHSSEGTINAAYLNDKDD
                     HRENFPDYSKDRWLYGIKNTTGLDSRWLAEVDYTRISDPYYFQDLDSDLGVGSTTYLN
                     QRGTLTYRGDTFTGRLNAQSYQLATTTDVTPYDRLPQITFDGFLPYSPGGLKLNYSTE
                     FVRFDRDLDENVYFNDDGTVRGFRPDASLQGLARSTGDRIHLEPSMSLPMTRSWGYLT
                     PSLKYLYTKYDLDLDSKGKTSLKVYDEKFNSSQDRSLPLVKVDGGLYFDRDVAFAGTK
                     FRQTLEPRAMYLYVPYKDQDNIPVFDTSEHTFSYDYLWRENRFAGRDRVGDANQLSLG
                     VTSRFIEPNGFERATLSAGQIYYFRDRRVQLPGLTEKDLARLKQENPNMDIKEPDNDS
                     WRSPYALAGLYRFNRDWNVTSDFNWNPSTKRTESGSAMFHYQPEANPNKIVNAGYRYR
                     EDTRRFNSSTGRFMYGREDDIIKQHDFSVIWPLVPQWSVLARWQYDYNKNRTLEAFGG
                     FEYDSCCWKLRLINRYWLDVDDDAFLVQSEKADRGIFLQIVLKGLGGIVGNKTEMFLD
                     KGIQGYRQREDQAM"
     gene            744097..745113
                     /locus_tag="PSPA7_RS03525"
                     /old_locus_tag="PSPA7_0740"
     CDS             744097..745113
                     /locus_tag="PSPA7_RS03525"
                     /old_locus_tag="PSPA7_0740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016252923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_012074180.1"
                     /db_xref="GI:501021513"
                     /translation="MSDDARFQQLNRWLDSCLPELFVAEGWGEVPPAELIPASSDASF
                     RRYFRWQGGDRSLVVMDAPPPQEDCRPFVEVAGLLAGAGVHVPKVLAQDLDNGFLLLS
                     DLGCQTYLDVLHPGNADELFEPALDALIAFQKVDVAGVLPPYDEAVLRRELQLFPDWY
                     LARHLGVELEGEALARWRRICDLLVRSALEQPRVFVHRDYMPRNLMLSEPNPGVLDFQ
                     DALHGPVTYDVTCLYKDAFVSWPEPRVHAALNRYWKKAVWAGIPLPPSFEDFLRASDL
                     MGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFRYLETAVARRPELAELGELLASLPQ
                     GAEA"
     gene            745110..745784
                     /locus_tag="PSPA7_RS03530"
                     /old_locus_tag="PSPA7_0741"
     CDS             745110..745784
                     /locus_tag="PSPA7_RS03530"
                     /old_locus_tag="PSPA7_0741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012613531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="WP_012074181.1"
                     /db_xref="GI:501021514"
                     /translation="MKAMVLAAGRGERMRPTTLHTPKPLIKAAGVPLIERQLLALRQA
                     GIDDWVINHAWLGEQIEAYLGDGSRLGGRIAYSAEGEPLETGGGIFRALPLLGEQPFL
                     LLNGDVWSDFDYTRLRLADGDLAHLVLVDNPAHHPAGDFHLDAAGRVGEARDAGGNLT
                     YSGIAVLHPALFDGCAPGAFKLAPLLRKAIAAGRVSGEHHRGHWVDVGTHERLAEVER
                     LLAEHA"
     gene            745786..746544
                     /locus_tag="PSPA7_RS03535"
                     /old_locus_tag="PSPA7_0742"
     CDS             745786..746544
                     /locus_tag="PSPA7_RS03535"
                     /old_locus_tag="PSPA7_0742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_012074182.1"
                     /db_xref="GI:501021515"
                     /translation="MLWPATLIGAGAGWALASIPGALLGGLLGQLLDRRLRLESWRSL
                     LARLRGRAVSDEDDLLFQLLGYLAKSGGRVDEVHIQQARQEMTLRRLDARARHRAIAS
                     FGKGKAGVAHLQEEVARLKGERAEAVLLACWRMAWAGGVLSQSARQLVLQWGRWLGWS
                     AERTERLSARVMPRRARPVAQDSYRDALLLLGVEAGSEPVAIKRAYRKLISQHHPDKL
                     AGAGASAERVRAATEKTRQLQAAYALIREREGFR"
     gene            complement(746545..747594)
                     /locus_tag="PSPA7_RS03540"
                     /old_locus_tag="PSPA7_0743"
     CDS             complement(746545..747594)
                     /locus_tag="PSPA7_RS03540"
                     /old_locus_tag="PSPA7_0743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074183.1"
                     /db_xref="GI:501021516"
                     /translation="MPVLRHPPKPFALLLATSLLWPAAAHAEEESAKEQPPAMERPAV
                     SERSQDEARGLERQLPEESQQILKAGDESFLTLWLPANSAEPEGVVILVPGDGESPDW
                     PQVIGPLRRKLPDAGWQTLSLALPDPQSSAPVTRPAGSAASASADKDASAIDSASKTE
                     VKGESGNAPAAESTAEAGSGEPAQSDERPTPPAIDPVEQRKAHAERVMARLQATIDLA
                     LQHEPKSVVLLGHGTGAYWAARYLAEKEPSEIHNLLLVAPELPRDFRPPLEDMVPKLK
                     LATGDFYYRDTRADRDAARLRMQAGKRQKHPAYIQVAMQALPADPEAEQEQLYRRIRG
                     WLGLHLQAAAQKPME"
     gene            747746..750145
                     /locus_tag="PSPA7_RS03545"
                     /old_locus_tag="PSPA7_0744"
     CDS             747746..750145
                     /locus_tag="PSPA7_RS03545"
                     /old_locus_tag="PSPA7_0744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012074184.1"
                     /db_xref="GI:501021517"
                     /translation="MLRRFCVFFCCLLLSLSPRAEEAPPGLPLTAELQAWLAGHRELR
                     VGVVTEVPYAQYDRRLQRYSGANVELMGWLAATMQVTLQWQGYPDQAALDEALRDGRV
                     DIAPGLSQTPSGLRLWLFSDPYLRVSRLVVGRREGSGSVELEQLERDTPVAVRGHGSV
                     AGYLSGTYSGLRLLPADSEREVLRAVLAGQARYAVIDEAQFSRLTREPEFADLAVVGD
                     IGYPQLLRVATRRDWPELAMVVDQALRALPRKSLDQLHERWLQPRYPRLGESPGFWQN
                     LSILLGLLLAGALAAVFLQRRQQQALEARLYGARRDLELRQAAEEALRLTQFSVDHST
                     LGILWVNWDSRVRYANRAAEQVLGYADGQLVDRPLVDFEPGLDMDRWLTLWRRARNSE
                     EGPLSFETRCLRADGSWLPADVSLSFLRFGTSEYLVVFLSDVTERRRAREALQESEAR
                     MKGIASNVPGMVFRLERPRAGAFSDFAYISEGSEALVGYSARELIESGRGIRGLVHPD
                     DRDGYWSSQMAALEEDRDWHWQGRILTRRGELRWADIKASARCFEDGRAVWDGVVWDI
                     TANKQIELELGESRAQLRELSAHLESVREEEKARIAREVHDELGQVLTVLKLETSMCE
                     LAYADAEDGLRERLGNMKKLIAQLFQLVRDVATALRPPILDAGIGSAVEWQARRFEAR
                     TQIPCLVEVPENPPQLADARAIGLFRILQEALTNVMRHAEAHTVQLRLVREGEELCLS
                     VSDDGRGFDVATVGRGSSFGLVGMRERVLMMGGRLDIDSAPGEGTTLSVRIPLGVSGP
                     S"
     gene            750191..750820
                     /locus_tag="PSPA7_RS03550"
                     /old_locus_tag="PSPA7_0745"
     CDS             750191..750820
                     /locus_tag="PSPA7_RS03550"
                     /old_locus_tag="PSPA7_0745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041025283.1"
                     /db_xref="GI:751334185"
                     /translation="MIRVLVAEDHTIVREGIKQLIGMAKDLQVVGEATNGEKLLETLR
                     GTPCEVVLLDISMPGVNGLEAIPRIRALSEPPAILVLSMHDEAQMAARALKIGAAGYA
                     TKDSDPALLLTAIRRVAGGGRYIDPDLADRMVFEVGLTDSRPPHALLSEREFSVFERL
                     VQGANVNEIAQQLAVSNKTVSTHKARLMQKLNAHSVADLVRYAMEHRLL"
     gene            750949..751983
                     /locus_tag="PSPA7_RS03555"
                     /old_locus_tag="PSPA7_0746"
     CDS             750949..751983
                     /locus_tag="PSPA7_RS03555"
                     /old_locus_tag="PSPA7_0746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012074186.1"
                     /db_xref="GI:501021519"
                     /translation="MLPAMRTGLLCALLGVSVPAWAEYVTVISFGGANKEAQESAFYK
                     PFKSATGNSVVHGSYNGDLAKLKRMVEISHVSWDVVEVEAPELARGCEEGLFEKLDMA
                     KVGDPADFVPGAVQPCGVGIFVWTTLLAYNRDKVAGTPQGWADFWDVKKFPGKRGLRW
                     GAKYSLEFALMADGVAPKDVYPVLATPAGVERAFRKLDELKPYIHWWKSGQDPVRDLS
                     DGTVAMSSAYNGRIAAAQAEKRHLSMVWSGGVYDFDFWALPAGVWKKQLAEDFIRFAS
                     QPEQQKAFAENIAYGPANRKAVDLLDPGVAANLPTAAQNMKNAVGMNVAFWAEHGEAL
                     EQRFQNWVKR"
     gene            752217..753326
                     /locus_tag="PSPA7_RS03560"
                     /old_locus_tag="PSPA7_0747"
     CDS             752217..753326
                     /locus_tag="PSPA7_RS03560"
                     /old_locus_tag="PSPA7_0747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_012074187.1"
                     /db_xref="GI:501021520"
                     /translation="MAETQGGDVLVSFRGVQKSYDGETLIVKDLNLDIRKGEFLTLLG
                     PSGSGKTTSLMMLAGFETPTAGEILLAGRSINNVPPHKRDIGMVFQNYALFPHMTVAE
                     NLAFPLSVRGMGKTDVKERVKRALSMVQLDAFAGRYPAQLSGGQQQRVALARALVFEP
                     QLVLMDEPLGALDKQLREHMQMEIKHLHQRLGVTVVYVTHDQGEALTMSDRVAVFHQG
                     EIQQIEPPRNLYEHPRNTFVANFIGENNRLSGQLLSRDGERCVVGLPRGEKIEALAIN
                     VGQPGEPVTLSIRPERVRLNGASEACANRFSGRVAEFVYLGDHVRVRLEVCGREDFFV
                     KQPIAELDPTLSVGDVVPLGWQVEHVRALDPLPAA"
     gene            753382..754428
                     /locus_tag="PSPA7_RS03565"
                     /old_locus_tag="PSPA7_0748"
     CDS             753382..754428
                     /locus_tag="PSPA7_RS03565"
                     /old_locus_tag="PSPA7_0748"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012074188.1"
                     /db_xref="GI:501021521"
                     /translation="MSKSLKAASLKFATLAAGLACAAQAMAVDLTVVSFGGANKSAQI
                     KAFYEPYQKATGNRIVAGEYNGEMAKVKAMVDTNSVSWDLVEVESPELSRGCDEGLFE
                     ELDPAQFGKTEDFVPGAIQPCGVGFFVWSTVLAYNADKLKSAPTSWADFWDIKKFPGK
                     RGLRKGAKYTLEFALMADGVAPKDVYSVLATKEGQDRAFKKLDEIKSSIQWWEAGAQP
                     PQYLASGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKKQEETLKFI
                     AFSVQPQQQKTYSENIAYGPANKQAVPLLDKALLKDMPTTPENIQNQVAMDVTFWADY
                     GEQLEQRFNAWAAR"
     gene            754540..755787
                     /locus_tag="PSPA7_RS03570"
                     /old_locus_tag="PSPA7_0749"
     CDS             754540..755787
                     /locus_tag="PSPA7_RS03570"
                     /old_locus_tag="PSPA7_0749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003099537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012074189.1"
                     /db_xref="GI:501021522"
                     /translation="MATAVPMSQAAGSTLKQRLARAERMNRLKSQALILPLVAFLVLT
                     FLVPIAALLYKSVSNPEVVRSLPLTVEAISAWDGKSLPADAVYKALSQDLAEARRNQT
                     IGDLSKRLNMELAGYRSLLAKTARKLPFKEEPASYKDAMEQLDERWGDPAYWQVIRRN
                     ASSYTPYYLLAALDHRIDDLGEVARATPDQAIYLDIFARTFWMGAVITVVCLLLAYPL
                     AYLLANLPTRKSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINGALLKLGLIDQPL
                     QLVFNRTGVYIAMVHIMLPFMILPIYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQ
                     TVAGVGAGCLLVFILSIGYYITPALLGSPNDQMVSYFVAFYTNSTINWGMATALGGLL
                     LLATLVLYIVYSWLVGASRLRLG"
     gene            755864..756694
                     /locus_tag="PSPA7_RS03575"
                     /old_locus_tag="PSPA7_0750"
     CDS             755864..756694
                     /locus_tag="PSPA7_RS03575"
                     /old_locus_tag="PSPA7_0750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter permease"
                     /protein_id="WP_003152154.1"
                     /db_xref="GI:489243961"
                     /translation="MLSPYMSPVERLWFYSLRILCGLVLLFLVLPVLVIVPLSFNSGT
                     FLVYPLQGFSLRWYADFFQSAEWMRSLTNSLIVAPAATLLAMVFGTLAAIGLTRGEFR
                     GKALVMSLMISPMVVPVVIIGVASYLFFAPLGLGNSYLSLIVVHAVLGVPFVIITVSA
                     TLQGFNHNLVRAAASLGAPPLTAFFRVTLPLIAPGVISGALFAFATSFDEVVVTLFLA
                     GPEQATLPRQMFSGIRENLSPTIAAAATLLIGFSVLLLLTLEWLRGRSEKMRTAQPGA
                     "
     gene            756818..757492
                     /locus_tag="PSPA7_RS03580"
                     /old_locus_tag="PSPA7_0751"
     CDS             756818..757492
                     /locus_tag="PSPA7_RS03580"
                     /old_locus_tag="PSPA7_0751"
                     /EC_number="5.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_012074190.1"
                     /db_xref="GI:501021523"
                     /translation="MQPFAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVP
                     NLTIGPMVCSALRKYGVSAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEASQHIDRS
                     LQLIRDGGCKAGLVFNPATPLDVLKYVMDKVDMVLLMSVNPGFGGQKFIPGTLDKLRE
                     ARALIDASGREIRLEIDGGVNVKNIREIAAAGADTFVAGSAIFNAPDYAEVIRAMHAE
                     LAQAHP"
     gene            757492..758310
                     /locus_tag="PSPA7_RS03585"
                     /old_locus_tag="PSPA7_0752"
     CDS             757492..758310
                     /locus_tag="PSPA7_RS03585"
                     /old_locus_tag="PSPA7_0752"
                     /EC_number="3.1.3.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_012074191.1"
                     /db_xref="GI:501021524"
                     /translation="MSAAEPFFATRLPRLVMFDLDGTLVDSVPDLTAAVDSMLASLGR
                     PPAGIEKVRQWIGNGARVLVRRALAGSIEHDGIGEEETEAALALFMEAYADSHALTEV
                     YPGVVDTLRWLKRNGVEMALITNKPERFVAPLLDEMKLGRYFRWIIGGDTLPQQKPDP
                     AALLFVMKMAGVEPEDALFVGDSRNDVLAAKAAGVRCAALSYGYNHGRPIAEEAPTLV
                     IDNLRDLLPCADRAAAIVLPDDSLSPTDQRDQAVAVSKLWMKVIKALARWRWRA"
     gene            758383..759861
                     /locus_tag="PSPA7_RS03590"
                     /old_locus_tag="PSPA7_0753"
     CDS             758383..759861
                     /locus_tag="PSPA7_RS03590"
                     /old_locus_tag="PSPA7_0753"
                     /EC_number="4.1.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P20580.1"
                     /note="with component II, the glutamine amidotransferase,
                     catalyzes the formation of anthranilate from chorismate
                     and glutamine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit I"
                     /protein_id="WP_012074192.1"
                     /db_xref="GI:501021525"
                     /translation="MNREEFLRLAADGYNRIPLSFETLADFDTPLSIYLKLADAPNSY
                     LLESVQGGEKWGRYSIIGLPCRTVLRVYGHQVRISVDGAETERFDCADPLAFVEEFKA
                     RYQVPTVSGLPRFDGGLVGYFGYDCVRYVEKRLASCPNPDPLGNPDILLMVSDAVVVF
                     DNLAGKIHAIALADPAEENAYERGQARLEELLERLRQPIVPRRGLDLEAARGGEPAFR
                     ASFTREDYESAVERIKDYILAGDCMQVVPSQRMSIAFRAAPIDLYRALRCFNPTPYMY
                     FFNFGDFHVVGSSPEVLVRVEDGLVTVRPIAGTRPRGINEEADLALEQDLLSDAKEIA
                     EHLMLIDLGRNDVGRVSDIGAVKVTEKMVIERYSNVMHIVSNVTGHLREGLGAMDALR
                     AILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYLAWNGNMDTAIAIRTAVIKDG
                     ELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQSVE"
     gene            complement(760146..760460)
                     /locus_tag="PSPA7_RS03595"
                     /old_locus_tag="PSPA7_0754"
     CDS             complement(760146..760460)
                     /locus_tag="PSPA7_RS03595"
                     /old_locus_tag="PSPA7_0754"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003129207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003152158.1"
                     /db_xref="GI:489243966"
                     /translation="MQPSIAPITHVPRQETVELVYRIFGDVLVPLEQVRERWFRNLNK
                     ENFSKALACGRIALPVTTLDDSHKAMQFVALDHLAAYVDQRASQAGSARRAQPGTDSV
                     AS"
     gene            complement(760561..761331)
                     /locus_tag="PSPA7_RS03600"
                     /old_locus_tag="PSPA7_0755"
     CDS             complement(760561..761331)
                     /locus_tag="PSPA7_RS03600"
                     /old_locus_tag="PSPA7_0755"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q06553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003152159.1"
                     /db_xref="GI:489243967"
                     /translation="MDKSTQIPPDSFAARLKQAMAMRNLKQETLAEAAGVSQNTIHKL
                     TSGKAQSTRKLIEIAAALGVSPVWLQTGEGAPAARSPVPVADGSPLVLEPLHPWDSET
                     PLDEDEVELPLYKEVEMSAGAGRTAVREIEGRKLRFSYATLRASGVDPSAAICAQLTG
                     NSMEPLIMDGSTIGVDTATTHITDGEIYALEHDGMLRVKFVYRLPGGGIRLRSFNREE
                     YPDEEYSPEDMRSRQISMIGWVFWWSTVRHRRGPSLVR"
     gene            761789..761989
                     /locus_tag="PSPA7_RS03605"
                     /old_locus_tag="PSPA7_0756"
     CDS             761789..761989
                     /locus_tag="PSPA7_RS03605"
                     /old_locus_tag="PSPA7_0756"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003152160.1"
                     /db_xref="GI:489243968"
                     /translation="MADLADRANELVLARLDGLLAARPALVIRESAEECQDCGEPIPQ
                     ARRQAVPGCNRCIDCQARHERR"
     gene            762035..762394
                     /locus_tag="PSPA7_RS03610"
                     /old_locus_tag="PSPA7_0757"
     CDS             762035..762394
                     /locus_tag="PSPA7_RS03610"
                     /old_locus_tag="PSPA7_0757"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003152161.1"
                     /db_xref="GI:489243969"
                     /translation="MIKAIDEMLKLWAEEMHTPGSNGGGYAGGNLIAMLIASKGEVVR
                     GHRGSRVILDRVAEVDRLVNRLPEELKNVVVEHYLNRDSFPEQKYRHCGCSRNTFYLR
                     LHVAHQGIQDGLLRRAA"
     gene            762849..763202
                     /locus_tag="PSPA7_RS03615"
                     /old_locus_tag="PSPA7_0758"
     CDS             762849..763202
                     /locus_tag="PSPA7_RS03615"
                     /old_locus_tag="PSPA7_0758"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holin"
                     /protein_id="WP_003152162.1"
                     /db_xref="GI:489243970"
                     /translation="MGNEPQTLTEMPLWVLILLAALGGVSGEMWRADKAGLGGWALLR
                     RLALRSGASIVCGVAVMLLALACGAALLFAAALGSLTAAAGAEIAVGLYERWAARRLG
                     VCELPEDEPRERGPY"
     gene            763224..763739
                     /locus_tag="PSPA7_RS03620"
                     /old_locus_tag="PSPA7_0759"
     CDS             763224..763739
                     /locus_tag="PSPA7_RS03620"
                     /old_locus_tag="PSPA7_0759"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003152163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003152163.1"
                     /db_xref="GI:489243971"
                     /translation="MPEQAVTLEALYVAIEQVLRERLPEVTLIGFWPGVPERTPAVAL
                     EVAELLPERDPGTGESALSCRLQARVLVPLDADRQAVALAGEIVRALRGQTWGLALEP
                     ARLVRATVDSSREELKGLRAWLVEWTQALRLGEPEWAWEDQPPGSLLLGLDPWTGPGH
                     EADYFAPEDLP"
     gene            763736..764293
                     /locus_tag="PSPA7_RS03625"
                     /old_locus_tag="PSPA7_0760"
     CDS             763736..764293
                     /locus_tag="PSPA7_RS03625"
                     /old_locus_tag="PSPA7_0760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage baseplate protein"
                     /protein_id="WP_012074193.1"
                     /db_xref="GI:501021526"
                     /translation="MSYVSAEHDRMLAAMILPCVVVAVDLAAARVRVRCGDWTSGWLR
                     WHAQAAGQARHWRAPSLGEQGVLLSPSGAVAMGTFIPGLYGDAGAAPDSSASRETWRF
                     DDGASLSYDWSAHRYRIEVPSGTVEVKAGASRVLVSDAEVRAEAAKISLQGAVEIAGP
                     LKVSGDILGGGSIIDTSGNSNHHTH"
     gene            764445..764771
                     /locus_tag="PSPA7_RS03630"
                     /old_locus_tag="PSPA7_0761"
     CDS             764445..764771
                     /locus_tag="PSPA7_RS03630"
                     /old_locus_tag="PSPA7_0761"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004366794.1"
                     /db_xref="GI:490500675"
                     /translation="MIGMDRRSGQPLSGLAHLKQSIEDILTTPLGSRRMRPEYGSKLR
                     RMVDLPLSEGWKSAVQAEVARALGRWEPRIALSSVRVVAVVEGRVGLLLSGVFEGEDI
                     NMEISA"
     gene            764768..765655
                     /locus_tag="PSPA7_RS03635"
                     /old_locus_tag="PSPA7_0762"
     CDS             764768..765655
                     /locus_tag="PSPA7_RS03635"
                     /old_locus_tag="PSPA7_0762"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate assembly protein"
                     /protein_id="WP_004366796.1"
                     /db_xref="GI:490500677"
                     /translation="MIIDLSQLPEPEVIESLDFEAIYQELLGDFRAAMAGEWTAELES
                     DPVLKLLQLAAYRELLLRARINDAARAVMLAYASGADLDQLAAGYNVHRLVVQKADPD
                     AVPPKESMLESDDSLRNRTQLAFDQLSVAGPRNAYIAYALGADGNIADVSAISPAPCE
                     ALVSVLSTEGNGVAGEPLLEAVRRALNDEDVRPVGDRVTVQSARIVDYRVDAVLYLYP
                     GPEAELIRKAAEASLQGYIATQRRLGRDIRRSALFAALHVEGVQRVELSAPGQDMVLD
                     ETQAAYCTGYSIRVGGSDE"
     gene            765648..766262
                     /locus_tag="PSPA7_RS03640"
                     /old_locus_tag="PSPA7_0763"
     CDS             765648..766262
                     /locus_tag="PSPA7_RS03640"
                     /old_locus_tag="PSPA7_0763"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_004366797.1"
                     /db_xref="GI:490500678"
                     /translation="MSSRLLPNNSTVLERALASVLPSDLPVPLRELMNPQRCPVELLP
                     YLAWAWSVDRWDERWSEGVKRKAIAAAFHIHQHKGTIAALRRVIEPLGYLIEVLEWWQ
                     SDPPGPPGTFRLRIGVLESGITDVMFEEVERLIDDAKPLTRHLVGMDISLETQGWMHI
                     GSGHYDGDILTVYSYLPEVIEVAGLYGSPGHDHIIDSMSVYPWP"
     gene            767939..769099
                     /locus_tag="PSPA7_RS03650"
                     /old_locus_tag="PSPA7_0765"
     CDS             767939..769099
                     /locus_tag="PSPA7_RS03650"
                     /old_locus_tag="PSPA7_0765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_004366801.1"
                     /db_xref="GI:490500682"
                     /translation="MSFFHGVTVTNVDIGARTISLPSSSIIGLVDTFIPSADLTAIPD
                     VPALITSEREAAAAFGVGSSIYKACKAIYSQASAVIVAVGVLKVEEANEQASAIIGSV
                     TAAGQRTGLQALLDGKSRFNAQPRLLVAPKHSASQAVASAMVSLAEKLRAVAIVDGPN
                     STDEAAIAYAKNFGSKRLYLVDPGVQSWDVQANGSVDAPASAYAAGLFAWTDAEYGFW
                     SSPSNKEIKGITGTARPVEFLDGDESCRANLLNNANIATIIRDDGYRLWGNRTLSSDS
                     KWAFVTRVRTMDLVMDAILAGHKWAVDRGITRTYVKDVTEGLRAFMRDLKNQGALINF
                     EVYADPDLNTASQLAQGKVYWNIRFTDVPPAENPNFRVEVTDQWLTEVLDVA"
     gene            769112..769615
                     /locus_tag="PSPA7_RS03655"
                     /old_locus_tag="PSPA7_0766"
     CDS             769112..769615
                     /locus_tag="PSPA7_RS03655"
                     /old_locus_tag="PSPA7_0766"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage protein"
                     /protein_id="WP_004366803.1"
                     /db_xref="GI:490500684"
                     /translation="MIPQTLTNTNLFVDGVSFAGDVPSLTLPKLTVKTEQYRAGGMDA
                     PVSIDMGLEALEAKFSTNGARREALNFFGLADQSAFNGVFRGSFKGQKGASVPVVATL
                     RGLLKEVDPGDWKAGEKAEFKYAIAVSYYKLEIDGREVYEIDPVNGVRAINGVDQLAG
                     MRNDLGL"
     gene            769630..769974
                     /locus_tag="PSPA7_RS03660"
                     /old_locus_tag="PSPA7_0767"
     CDS             769630..769974
                     /locus_tag="PSPA7_RS03660"
                     /old_locus_tag="PSPA7_0767"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004366805.1"
                     /db_xref="GI:490500686"
                     /translation="MTQENRQPGWLTLDADAAIVRLSRPAQCNGVSVDTLTLRAPTVR
                     DIRLAGKVAGDDAEERELQLFASLAQVSRQDLEGLKLSDYQRLQGAYFRLVQEDPDDA
                     FAYAPAGEAAGH"
     gene            770147..772411
                     /locus_tag="PSPA7_RS03665"
                     /old_locus_tag="PSPA7_0769"
     CDS             770147..772411
                     /locus_tag="PSPA7_RS03665"
                     /old_locus_tag="PSPA7_0769"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail length tape measure protein"
                     /protein_id="WP_012074196.1"
                     /db_xref="GI:501021529"
                     /translation="MSKDIDLVVSIGGIVDPSLGKAFDTVKARVDSLQERSRQAASLR
                     DLLGDAIRLEKELVDMRKVGDRGVAEHDRQLRERQAQLKRLGIEAREASAAYAQLDDM
                     QRGLDMQVRGLQRLEQANWALPLATAFSGVVVAASKAAAGYQARLRDLAIRNGLDDIQ
                     EKKLASRVQESAGKTGLGRVAALNLLEDLNATGMGFAAAQQNLGLAGRFGFGQKIAPA
                     VTAGLVRALQLAQGSDSPEQLSAALDRLVTLGKGRIGSEVLAQRLPALLPALAPAGKV
                     ESGDIDALGALLEIQAKSATPDQADARAKAWLEFVRSGSLERAYGKDYEQELEALRKD
                     GASSLEASLELAARYRDRGGELRAGSASPALEAYRASRGEFQALLENQTSSSGSSERD
                     AERRKDSSEELWKSSDERWGRAQTALGSALNPYLDSVARWSARLGDSTAGLLEAHPQE
                     AAGLTAGAGAALSGYLLYKGGRGAIDVLRGGRLGRHAAGGVGDLLGRAAGNVGGSEAQ
                     RVFVTNWPLSSMAGVQPKQPDSAGKRQTSRKQGQALRQRKGKGGGIKARSTPSFGFAA
                     ERSGYSSLGRLSRLPVRNAPLQVASSLLDVADIYSSDMSASEKTVAYSETGGSLAGSL
                     AGAALGASIGSVVPVVGTLIGGLVGGAIGAWGGGALGASLGRSLAGEPPASPLDKAGT
                     GNEAQVAVATQPAPAAPIPNWTFAPQINLTVQGNVHEPRRLAEELLPYLQRMLADFAG
                     EQQRRSLYDPAMVV"
     gene            772421..773290
                     /locus_tag="PSPA7_RS03670"
                     /old_locus_tag="PSPA7_0770"
     CDS             772421..773290
                     /locus_tag="PSPA7_RS03670"
                     /old_locus_tag="PSPA7_0770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_012074197.1"
                     /db_xref="GI:501021530"
                     /translation="MAYLEQLQAGLKHLGRAGESGRKNLDKVVAPVNGAISEIRGAAS
                     ELENLPGVSPEMAARLQRAMRGIGQAQGKVNRVVSTYNRASRALLGVDERLDALKVQV
                     NRATQAVGKVAGAVSPTLAGVLPSWLLAPTATPPSESVAPLPHLLVLQPLTANGQPFY
                     FNLDTAAFDTLQRTSAYNWSAQARLGRRPALQSVGLGEENILLKGAVFPLRRQVGEQK
                     VVGLEQLEALRKLAERREPLVLSSGYGEVRMGLWCLVRISESQSALLGNGAPRKQTFD
                     LEFKRYGDDLPNR"
     gene            773265..773471
                     /locus_tag="PSPA7_RS03675"
                     /old_locus_tag="PSPA7_0771"
     CDS             773265..773471
                     /locus_tag="PSPA7_RS03675"
                     /old_locus_tag="PSPA7_0771"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003101635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_004366813.1"
                     /db_xref="GI:490500694"
                     /translation="MATICRTADGDLLDSLCYHVYGHLPGCVEATLEANPGLADEVQP
                     LRAGLLIRFPDMPLVNSAQVRLWD"
     gene            773529..774524
                     /locus_tag="PSPA7_RS03680"
                     /old_locus_tag="PSPA7_0772"
     CDS             773529..774524
                     /locus_tag="PSPA7_RS03680"
                     /old_locus_tag="PSPA7_0772"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004366815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage late control protein"
                     /protein_id="WP_004366815.1"
                     /db_xref="GI:490500696"
                     /translation="MQPSFRIVADGTDITARLNDRLLRLTLLDKPGMESDTLTLRIDD
                     RDGLVALPRRGAVLEVYLGYAGEALMRMGRYTVDTLRWSGPPDTLNITAKAGDMRGSG
                     KSTRSGGWENTSLAQVCRDVGARNGWRVECPLQVAISRVDQINESDYHFVTRLARQYD
                     CTAKLAEGMLLVLPRESGQSATGRLIEPLVLGRSDVGSFDVTYDDRSLMKTVKTRYQV
                     PGSGEVQSVELKNPKAPATARGEHVERHLYASRGEAEQAARARLAGFNRSSAGVRLEL
                     PGRADLYAERRIVLQGFKAGIDGEFLVDSVEHTYDAGGWTITVQCNGGRGGKGDG"
     gene            774549..775178
                     /locus_tag="PSPA7_RS03685"
                     /old_locus_tag="PSPA7_0773"
     CDS             774549..775178
                     /locus_tag="PSPA7_RS03685"
                     /old_locus_tag="PSPA7_0773"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003117966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074198.1"
                     /db_xref="GI:501021531"
                     /translation="MKLTEQQLLRILPNARLVAGVFVPALQAAMAEAQIDTPARGAAF
                     IAQVGHESAQLTRLVENLNYSARGLAATWPGRYRGADGQPNALALRLARNPQAIADNA
                     YAARNGNGDEASGDGWRFRGRGLLQVTGRANYRVVGEALGEPLEAEPWRLEQPVPAAR
                     SAAWWWAGHGLNELAERGEFAAITRRINGGLNGQAERLALWRRARAVLS"
     gene            775175..775537
                     /locus_tag="PSPA7_RS03690"
                     /old_locus_tag="PSPA7_0774"
     CDS             775175..775537
                     /locus_tag="PSPA7_RS03690"
                     /old_locus_tag="PSPA7_0774"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074199.1"
                     /db_xref="GI:501021532"
                     /translation="MSRLGLRLLALSLVLLVGALLGGGVTARHYRSQLDEAQRQLAAT
                     RTASDQLQMLLDEQQRTLSALRTSAEVRAKEATQALNDARAQAAEQYAAAVRLLQARD
                     AGEDCQAARVAIDRELGL"
     gene            775534..775791
                     /locus_tag="PSPA7_RS03695"
                     /old_locus_tag="PSPA7_0775"
     CDS             775534..775791
                     /locus_tag="PSPA7_RS03695"
                     /old_locus_tag="PSPA7_0775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074200.1"
                     /db_xref="GI:501021533"
                     /translation="MSRLLLCLCLILAGCAGSPPEPRPLRVEMPLAVPCRVPEVRPPS
                     WAGATLKAGDSLQTKVRALLAERRQRQGYELELQAALRACR"
     gene            775817..>776016
                     /locus_tag="PSPA7_RS03700"
                     /pseudo
     CDS             775817..>776016
                     /locus_tag="PSPA7_RS03700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118920.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            776111..776605
                     /locus_tag="PSPA7_RS03705"
                     /old_locus_tag="PSPA7_0777"
     CDS             776111..776605
                     /locus_tag="PSPA7_RS03705"
                     /old_locus_tag="PSPA7_0777"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074202.1"
                     /db_xref="GI:501021535"
                     /translation="MSILTQGTQIYALVPPVSGSGAATVLEIEGVTSFNPGGNPADQI
                     EDPCLSDTSRKYKKGLRTPGQATLGVNADPRLASHVRLFQLSEQDGETSVKWAIGWSD
                     GIDVKPTVSTEGDDFVLPPARTWFTFEGYVSDFPFDFASNTLVATQATIQRSGAGKWT
                     PKAA"
     gene            776617..776964
                     /locus_tag="PSPA7_RS03710"
                     /old_locus_tag="PSPA7_0778"
     CDS             776617..776964
                     /locus_tag="PSPA7_RS03710"
                     /old_locus_tag="PSPA7_0778"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003118921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003150143.1"
                     /db_xref="GI:489241932"
                     /translation="MNLNDLRAAGGFIESTLVRKDITWTRVPAGKKRAVSDTFQVYVR
                     RNSFGAVERLFSAEGDQQSRNARYLAECIRLGESGEESLTYEQAYDLDPALGFLLLQA
                     VGEVNRVEDAEKN"
     gene            776994..777248
                     /locus_tag="PSPA7_RS03715"
                     /old_locus_tag="PSPA7_0779"
     CDS             776994..777248
                     /locus_tag="PSPA7_RS03715"
                     /old_locus_tag="PSPA7_0779"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003113188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003150141.1"
                     /db_xref="GI:489241930"
                     /translation="MLNGVGGSTIAEAKERLSYVEYRAWVAYLNKRGSLHPGHRLELA
                     LARIAALLGHALGADADPDAFRPHMALQPLSLHQAMDQWA"
     gene            777295..779133
                     /locus_tag="PSPA7_RS03720"
                     /old_locus_tag="PSPA7_0780"
     CDS             777295..779133
                     /locus_tag="PSPA7_RS03720"
                     /old_locus_tag="PSPA7_0780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017002349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074203.1"
                     /db_xref="GI:501021536"
                     /translation="MATNSNGSLTLDLVLRSEGYRAGMDKVGRINDQKMRAMEARAEK
                     AGKAIGKSLDSSALIASSVLDQALDMLGKTTRQAEQAKKPAQKAQDKVLAEWKTRQKE
                     LGEAWKSYREPLQDLSKLNEALLKNSSDKLDKALLNLSETGKLSLANVGKTAYADAAR
                     LASRQMTLMLLDGLFGWVASVGTEKPKVDDKAGKGLAKAGDDEKEQPSLQSQVFKQWL
                     LQMNSVWGAYRVPLQDISGMTDELFRNASEKLEKSLFNFATTGKLSLSNFAKTVIDDV
                     ARIAARQLSMLALDGLFGWLNDKAGITEAQLASQKPHTSLLEKARSDAGQAAAGVPAA
                     QGAAPIPAATMDVGAMVATASGQTGDGSKASGADASVSAGKPVGSWVEQMDASWASLR
                     DQAQDVSGMMDTLFTNAFTNMENALFTFATTGKLSFKDFADSVIQDMARIAARQATLQ
                     IIGGIVGTVSGFFGSGATAGSRISDYTGADMANWVSKQRAGGMPGFARGGAFNDGIQS
                     APALFSMAGGRPALIGERGPEAIMPLSRGSDGVLGVRALGGGEGGNVFNFSTSVSLGG
                     SREGAATASGDVGTGQQLAGMINDAARNVVAQELRPGGLVWRMVNG"
     gene            779126..779467
                     /locus_tag="PSPA7_RS03725"
                     /old_locus_tag="PSPA7_0781"
     CDS             779126..779467
                     /locus_tag="PSPA7_RS03725"
                     /old_locus_tag="PSPA7_0781"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003113186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_012074204.1"
                     /db_xref="GI:501021537"
                     /translation="MADLERFTWDISIDSAGQANQLVRQVQYGGGYSQALGDGLNNLS
                     ETWQVSRTGDLALIGPIRDFLKRHGGYRSFLWTLPTGEPVRVRAQGWQLRPRGNGVFT
                     LSTTFQQVFNP"
     gene            779475..780170
                     /locus_tag="PSPA7_RS03730"
                     /old_locus_tag="PSPA7_0782"
     CDS             779475..780170
                     /locus_tag="PSPA7_RS03730"
                     /old_locus_tag="PSPA7_0782"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_012074205.1"
                     /db_xref="GI:501021538"
                     /translation="MTITADDQALEPGALVRLFDLDCTGFGGEMLRFHGHLQQGPIHW
                     QGNAYQAWPLEARGFEQRGDGRASSPTLSVGNIDGSISALCLFFDGLVGARLTVRETY
                     AHYLDEANFAEGNPQADPSQERLNIWFLEQKTAENSVQVTWELSAPPDFQGQQIPARQ
                     ITSLCHWCITNEYRGQDCNYTGTAMFDADGNPVDDPALDRCGGRVSDCKLRFGADNPL
                     SHGGFAGAGLVRM"
     gene            780173..780943
                     /locus_tag="PSPA7_RS03735"
                     /old_locus_tag="PSPA7_0783"
     CDS             780173..780943
                     /locus_tag="PSPA7_RS03735"
                     /old_locus_tag="PSPA7_0783"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase P60"
                     /protein_id="WP_003150138.1"
                     /db_xref="GI:489241927"
                     /translation="MELSRSLQRAIAEHAAREHPRECCGLIVRGTRQRRYLACRNAAG
                     SPSEHFVIDHQDWCAAEDQGEVLAIVHSHPDVPATPSMADRVSCELHGLPWVILSWPE
                     GDVAHLAPEGYQAPLLGREFAHGVLDCWSLCRDWYRREAGLELPDYPRRDGWWETGES
                     LYEQHYAAAGFRPVPLAEIRRGDMLVMQVGRALHPNHAGIYLGNDWRLDSEPAQALGG
                     DGPFLLHHLYGRLSTRDVFGGPWIERTRLVLRHTRMPQ"
     gene            780998..781600
                     /locus_tag="PSPA7_RS03740"
                     /old_locus_tag="PSPA7_0784"
     CDS             780998..781600
                     /locus_tag="PSPA7_RS03740"
                     /old_locus_tag="PSPA7_0784"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003161918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003117974.1"
                     /db_xref="GI:489209088"
                     /translation="MSDTLSQGLTTIRLYGVLGKRFGRMHGRLLESGTVREAMSALKH
                     TMEGFETFMREAESKGLTFAVFRGRTNLSGEQLDMRGREDIRIVPLVIGSKQAGLFQT
                     ILGAALIVVGGFTTFFSGGTSSFLVTVGVSMLAGGVMQMLSPQPKGLKGREAPENAPS
                     YAFGGPVNTIAQGHPVGVLYGKRRIGGAVISAGIYAEDRL"
     gene            781659..785324
                     /locus_tag="PSPA7_RS03745"
                     /old_locus_tag="PSPA7_0785"
     CDS             781659..785324
                     /locus_tag="PSPA7_RS03745"
                     /old_locus_tag="PSPA7_0785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074206.1"
                     /db_xref="GI:501021539"
                     /translation="MNKTITGHKGGSKKPRQPVEMPDSVRSIARAKILLALGEGEFDG
                     GVDGRSIYLDDTPLLAADGSVNFPGVTWEFRPGSVDQEHIAGVPAVENELAVGVELKS
                     DAPWVRAVSNTQLSAVRLRLSWPAIQRQQENGDVVGYRIDYAIDIAVDGGAWQEALKA
                     SLDDKSTSRYERSHRVDLPEARSGWQVRVRRLTPNQNNNRIADTMRVEAITEVIDAKL
                     RYPNTALLFVEFDASQFQSIPQISVEARGRRVRVPSNYDPQTRSYSGTWDGSFKSAWT
                     SNPAWHWYDIVLHKRFGLGRRIDASMVDKWSLYRIAQYCDQSVPDGKGGQEPRFSCNL
                     YLQSRAEAWTVLRDLAAIFRGMSYWSGAEMVAVADMPEDEAYTFSPSNTVRGDDGSHF
                     NYSSSRQRDRHTLALVNYDNPGNGYQSQPVAVNNDRAQRRYGISQLEITAIGCTSEGE
                     AQRRGQWALLTEELEQDAVTFRTGMDGRGLAPGKIIAVADPVKSGKQIGGRLSAVDGR
                     ALTLDRDVEARPGDRLLVNLPNGKAEARTVQSVVGRVLSVTAAYSETPRPQGQWALQS
                     NSLTTQRFRIMSITRPEDNLFEITALQHNASKFDAIDNGARIEAPPVTSIPPGVQAPP
                     QNVRIKAFTKVDQGLAVTSLSASWDAAPNAVAYEAEWRKDSGNWVRVPRTSALGFDVP
                     GIYAGRYLVRVRALNVMEVGSVYASSVETALEGKTTPPPALAYLRCVAGPWRIGLEWG
                     FPASGAADTAYTEIQQSATPGGSEETARALGLFAYPGNTHLVSPIPAGERLAFRGRLI
                     DRSGNVGAWSNWVTGTSSSDASEYNQLITQEYVESALGQQFFSDIERMQVDIGGLQKQ
                     VGDLADVLLYDPAKVYAKNDMVRQGQRLYQALKAVPAKTAPPNAAYWSDIGQSLETAN
                     GLAQQVASHTAEISELDGSLTAQASRLGVLQAATRDDADDGNGAMADALRGWKTVARA
                     AQEETVRATENEAQATRTTLLEARTADAEGRIATVERVATSDRQATAQRLDKLSASIG
                     GTAASLQSEQTARANADSALAQRIDTVQARTDTNSAAIQTTSQAVASLDGNVKAMYSV
                     KLQAHANGQKYAAGWQLGFDSGTSVSTMAFQADRFIFFDSSSGAVAAPVSIVGGKIFI
                     NSAIIKDGSITSAKIEDSLQSENYESGTRGWRIDKSGSFELNGEETGLRRVLRPNYDR
                     YYDTQSGILVIEIGELA"
     gene            786573..787622
                     /locus_tag="PSPA7_RS03750"
                     /old_locus_tag="PSPA7_0787"
     CDS             786573..787622
                     /locus_tag="PSPA7_RS03750"
                     /old_locus_tag="PSPA7_0787"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber protein"
                     /protein_id="WP_003150136.1"
                     /db_xref="GI:489241925"
                     /translation="MPWYSTGTVSVVPNSDTVTGSGTAFSANARAGDAFRGPDGRWYE
                     IGNVASATVLTIKPAYQGASATAQAYSITPVQGYPKALADQFRDLNNQWGSLLAAVKP
                     WAIASTGSQAQVDMGITEVGRALNGASTAANALRYLGGVTSQMAFTRSYADSNALPNE
                     CGFFGIGLGPWSNLPPGIDALNPIGSAIYQNVYDASTAYQLFIPRTSNILYFRRKVAG
                     NWQAWVRMLSDAQLLGAVAQSSGAPIGAIMERGSNANGQYERFANGTQVCTVSLLGAN
                     DRVAGQGYTLTLPATFTGDWAVGVSVSWASHSFNPAANNGIRVAYANGNALTFILSEN
                     LGTNRLLFSCVGRWF"
     gene            787622..787924
                     /locus_tag="PSPA7_RS03755"
     CDS             787622..787924
                     /locus_tag="PSPA7_RS03755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003150135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041025284.1"
                     /db_xref="GI:751334186"
                     /translation="MIITLSPYAPLPGSDEHLSLVRAGDTLTVNGQLFDFTPLPNGGE
                     LPSEAIESEWFVGSVMRRAGRLELALRFPLAENASSAARFPEPMLIEADGPVELPR"
     gene            787921..788145
                     /locus_tag="PSPA7_RS03760"
                     /old_locus_tag="PSPA7_0788"
     CDS             787921..788145
                     /locus_tag="PSPA7_RS03760"
                     /old_locus_tag="PSPA7_0788"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012074208.1"
                     /db_xref="GI:501021541"
                     /translation="MIDWSKVITAEQQVQQRQKAEHDAVIVARACAYRTESDPLKTEA
                     EFDAIKAGTEPDYSGWIAKVEEIKGRYPLP"
     gene            788551..789156
                     /locus_tag="PSPA7_RS03765"
                     /old_locus_tag="PSPA7_0790"
     CDS             788551..789156
                     /locus_tag="PSPA7_RS03765"
                     /old_locus_tag="PSPA7_0790"
                     /EC_number="4.1.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019486387.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="WP_003150133.1"
                     /db_xref="GI:489241922"
                     /translation="MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAP
                     ERIVLSPGPCTPNEAGVSLAVIERFAGRLPLLGVCLGHQSIGQAFGGEVVRARQVMHG
                     KTSPIHHKDLGVFAGLANPLTVTRYHSLVVKRESLPECLEITAWTQLDDGSVDEIMGV
                     RHKTLNVEGVQFHPESILTEQGHELLANFLRQRGGVRGEGN"
     gene            789158..790207
                     /gene="trpD"
                     /locus_tag="PSPA7_RS03770"
                     /old_locus_tag="PSPA7_0791"
     CDS             789158..790207
                     /gene="trpD"
                     /locus_tag="PSPA7_RS03770"
                     /old_locus_tag="PSPA7_0791"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014602441.1"
                     /note="Catalyzes the conversion of
                     N-(5-phospho-D-ribosyl)-anthranilate and diphosphate to
                     anthranilate and 5-phospho-alpha-D-ribose 1-diphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="WP_012074210.1"
                     /db_xref="GI:501021543"
                     /translation="MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGRCTDAQIGAFLMG
                     MRMKSETIDEIVGAVAVMRELADGVQLPTLKHVVDVVGTGGDGANIFNVSSAASFVVA
                     AAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFMFAQVHHKA
                     MKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRLGSEHVL
                     VVHSRDGLDEFSLAAATHIAELKDGEVREYEVRPEDFGIKSQTLMGLEVDSPQASLEL
                     IRDALGRRKTEAGQKAAELIVMNAGPALYAADLATSLHEGIQLAHDALHTGLAREKMD
                     ELVAFTAVYREENAQ"
     gene            790204..791040
                     /gene="trpC"
                     /locus_tag="PSPA7_RS03775"
                     /old_locus_tag="PSPA7_0792"
     CDS             790204..791040
                     /gene="trpC"
                     /locus_tag="PSPA7_RS03775"
                     /old_locus_tag="PSPA7_0792"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016561543.1"
                     /note="involved in tryptophan biosynthesis; amino acid
                     biosynthesis; converts
                     1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate to
                     C(1)-(3-indolyl)-glycerol 3-phosphate and carbon dioxide
                     and water; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="WP_012074211.1"
                     /db_xref="GI:501021544"
                     /translation="MSVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFA
                     NALLERARRKEPAVIAEIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFF
                     QGADAYLKEARAACALPVIRKDFMIDPYQIVEARAIGADCILLIVSALDDMLMGELAA
                     TAKSVGLDVLVEVHDGAELERALKTLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRD
                     RLVVTESGILNRADVELMEVSEVYAFLVGEAFMRADDPGLELKRLFFQERGGVVLGAD
                     PD"
     gene            complement(791102..791745)
                     /locus_tag="PSPA7_RS03780"
                     /pseudo
     CDS             complement(791102..791745)
                     /locus_tag="PSPA7_RS03780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003300953.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic AMP receptor protein"
     gene            792017..792439
                     /locus_tag="PSPA7_RS03785"
                     /old_locus_tag="PSPA7_0794"
     CDS             792017..792439
                     /locus_tag="PSPA7_RS03785"
                     /old_locus_tag="PSPA7_0794"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016490501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003085219.1"
                     /db_xref="GI:489175694"
                     /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPDHGGRNLGVRPMEMV
                     LIGLGGCTNFDVVSILKKARQPVESCEAFLEAERADEEPKVFTKIHVHFVVKGRGLKE
                     AQVKRAVELSAEKYCSASIMLGRGGVEITHDYEIVELG"
     gene            792759..793553
                     /locus_tag="PSPA7_RS03790"
                     /old_locus_tag="PSPA7_0795"
     CDS             792759..793553
                     /locus_tag="PSPA7_RS03790"
                     /old_locus_tag="PSPA7_0795"
                     /EC_number="4.1.1.50"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q02TB2.1"
                     /note="S-adenosylmethionine provides the aminopropyl
                     moiety required for spermidine biosynthesis from
                     putrescine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine decarboxylase proenzyme"
                     /protein_id="WP_003150131.1"
                     /db_xref="GI:489241920"
                     /translation="MKSKLKLHGFNNLTKTLSFNIYDICYAETPEDLQAYVQYIDEEY
                     DAERLTQILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTPTDSQIEESPGPL
                     PDTILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPLKALNYLIHQFDSD
                     IVTVDYRVRGFTRDIEGRKHFIDHEINSIQNYLSDDTREAYQMTDVNVYQENLFHTKM
                     LLKDFELENYLFGDATRNLSAEQREQVTERLRHEMLEIFYARNMPH"
     gene            complement(793618..794265)
                     /locus_tag="PSPA7_RS03795"
                     /old_locus_tag="PSPA7_0796"
     CDS             complement(793618..794265)
                     /locus_tag="PSPA7_RS03795"
                     /old_locus_tag="PSPA7_0796"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017517343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
                     hydroxylase"
                     /protein_id="WP_012074213.1"
                     /db_xref="GI:501021546"
                     /translation="MSADRHYSPIDRFLLQADSALRTLLPFSGQPARPSPAIVEPDGE
                     LSEEDTRHIAGLMRINHTGEVCAQALYQGQSLTARLPEVREAMEEAAEEEIDHLAWCE
                     QRIRQLGSRPSVLNPIFYGLSFGVGAAAGLVSDRVSLGFVAATEDQVCKHLDEHLAQI
                     PQEDRKSRAILEQMRVDEEQHSSNALAAGGLRFPAPVKLGMSLLAKVMTKSTYRI"
     gene            complement(794365..794703)
                     /locus_tag="PSPA7_RS03800"
                     /old_locus_tag="PSPA7_0797"
     CDS             complement(794365..794703)
                     /locus_tag="PSPA7_RS03800"
                     /old_locus_tag="PSPA7_0797"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015475292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012074214.1"
                     /db_xref="GI:501021547"
                     /translation="MDCLFCKIVAGEVPARKFYEDEEVVAFHDIGPQAPVHFLVIPKR
                     HIPTLEHLTEADRPLAGHILFTAQRLAREQGCAEGFRVVMNCNDLGGQTVHHIHMHVL
                     GQRQMHWPPG"
     gene            794779..796260
                     /locus_tag="PSPA7_RS03805"
                     /old_locus_tag="PSPA7_0798"
     CDS             794779..796260
                     /locus_tag="PSPA7_RS03805"
                     /old_locus_tag="PSPA7_0798"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016561544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_003150128.1"
                     /db_xref="GI:489241917"
                     /translation="MKNDIHDLGLVLDSRVKLILIESWDEPKVMETLTGLAIKRGLGL
                     YTWSVTEGVQRLGFGGEPLGDEDSSDPVAALRLIRHDRQANLYVLCDLHPFLGDSPIL
                     VRLLKEIAMAEGNHRPTVVLVSHALKLPAEVQRFAARFSLSLPSEDELLGIVREEASR
                     WSERNRGARVRTDNRTLQQVVKNLRGLSHAEARLLARNVICNDGAITQEDLPELNRTK
                     FQLLDLEGVLSFEYDTARFAEVGGLTALKRWLGERQSAFLAGKPGDQPKGIMLVGVQG
                     AGKSLAAKAVAGLWGLPLLRLDFACLYNKYFGETERNLREALRLAEQMAPCVLWMDEV
                     EKGLSGGDQDNGVSQRVLGTLLTWMAEREAPVFLVATANAIDRLPPELVRKGRFDELF
                     FVDLPAPEIRAEIFRIHLQRRELEPAQFDLAALAAASQGFSGAEIEQAVVAALYAGQA
                     RQQAVDQELLLKELARTSPLSVLMAERLATLRAWANGRAVPAD"
     gene            complement(796272..797072)
                     /locus_tag="PSPA7_RS03810"
                     /old_locus_tag="PSPA7_0799"
     CDS             complement(796272..797072)
                     /locus_tag="PSPA7_RS03810"
                     /old_locus_tag="PSPA7_0799"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_012074215.1"
                     /db_xref="GI:501021548"
                     /translation="MPRYALITGASSGIGLALAEALARRGRALILVARQRDALESIAY
                     ELAQRFGVEVLFRTCDLAEPLQLSGLLHELEQGERQIDLLVNNAGIGSAGPFVDQEWA
                     REQELIELNILALARLCHALGTRMAAQGGGQILNVASVAAFQPGAWMSNYYASKAYVL
                     HFSEGLREELKARAVKVSVLCPGPTRTAFFREAGMRLGKLEQGKLMMSPEEVALLALR
                     GLDRNRALIVPGWRNRLLALSPRLAPRWLVRRIAARLNASTLPSAPRA"
     gene            complement(797133..798200)
                     /locus_tag="PSPA7_RS03815"
                     /old_locus_tag="PSPA7_0800"
     CDS             complement(797133..798200)
                     /locus_tag="PSPA7_RS03815"
                     /old_locus_tag="PSPA7_0800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074216.1"
                     /db_xref="GI:501021549"
                     /translation="MTDQRFKIVFSGELMPDAQLEAVKDNLARLFKSEPGKIDALFGG
                     RPVVLKRELPEAEADRYLAALHQAGANAHKEVDLAASLSLVETPEHNPPAADEPPAQD
                     LPPMTCPKCGHEQPSAPECAACGIIIEKYLARQAQLGENTAPAAATAAAASPYTPPSA
                     QVGDALPAYGELNVFTTNGRIGRLRYLGWSMAMTLCFMLIMGLGFLLGETVGVAVTVL
                     ASIAFIVIAVMIGVQRLHDLGWSGWLWLLNFVPFVGSVFGILMLVLPGSNGANRYGPP
                     PPANSTGVKVLASLIVLLPIVAIIAAIALPSYEGYLERANYEGGASEPYTMEEQASAA
                     AAEASEAATAAAETLEEDQQQ"
     gene            complement(798322..799290)
                     /locus_tag="PSPA7_RS03820"
                     /old_locus_tag="PSPA7_0801"
     CDS             complement(798322..799290)
                     /locus_tag="PSPA7_RS03820"
                     /old_locus_tag="PSPA7_0801"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_012074217.1"
                     /db_xref="GI:501021550"
                     /translation="MSLPALLDQRLRLPMVAAPMFLVSNPQLVLACCRNGIVGSFPAL
                     NQRDSSGFKGWLEEIEAGLAELDNPAPYAVNLIVHNTNPRLQADLRICVEQRVPIVIT
                     SLGAVREVVDAVHSYGGLVFHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFA
                     LVAEIRQFFDKTLLLAGCLNHGHEILAAQMLGADLAYLGTRFIATRDSNASDAYKQMI
                     LEARAADIVHTPAVSGVPASFMRQSLEAAGYDLKRLTDKADMNYGEKLKPVNDEAKAW
                     KTVWSAGQGAGNIDDLPAVDQLIARLDHEYRDALQKANRLATRWPR"
     gene            complement(799306..799731)
                     /locus_tag="PSPA7_RS03825"
                     /old_locus_tag="PSPA7_0802"
     CDS             complement(799306..799731)
                     /locus_tag="PSPA7_RS03825"
                     /old_locus_tag="PSPA7_0802"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003113170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_034000210.1"
                     /db_xref="GI:730365285"
                     /translation="MMYLWLKAFHIIAVVCWFAGLFYLPRLFVYHAMSEDQASRERFC
                     VMERKLYRGIMMPSMLATLVLGLWMLYLTPGWLSQGWLHAKLTLVLLLVGYHHACGAM
                     LKRFARGEPGRSHVFYRWFNEVPVLFLLLIVLLVVLKPF"
     gene            800018..801052
                     /locus_tag="PSPA7_RS03830"
                     /old_locus_tag="PSPA7_0803"
     CDS             800018..801052
                     /locus_tag="PSPA7_RS03830"
                     /old_locus_tag="PSPA7_0803"
                     /EC_number="1.2.1.38"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003450683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="n-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_012074218.1"
                     /db_xref="GI:501021551"
                     /translation="MIKVGIVGGTGYTGVELLRLLAQHPQARVEVITSRSEAGVKVVD
                     MYPNLRGHYDDLQFSVPDTQRLGACDVVFFATPHGVAHALAGELLDAGTRVIDLSADF
                     RLADAEEWARWYGQPHGAPALLEEAVYGLPEVNREKIRQARLIAVPGCYPTATQLGLI
                     PLLEAGLADASRLIADCKSGVSGAGRGAKVGSLFCEAGESMMAYAVKGHRHLPEISQG
                     LRRASGGEVGLTFVPHLTPMIRGIHATLYAHVADRSVDLQALFEKRYANEPFVDVMPA
                     GSHPETRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQALQNMNILFGLDER
                     LGLSHAALLP"
     gene            801052..801771
                     /locus_tag="PSPA7_RS03835"
                     /old_locus_tag="PSPA7_0804"
     CDS             801052..801771
                     /locus_tag="PSPA7_RS03835"
                     /old_locus_tag="PSPA7_0804"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003150123.1"
                     /db_xref="GI:489241912"
                     /translation="MSGWELRFRDPRRAWLARLGIGALLLSVPLAFFGGRWSTGADNA
                     RSEAEAQRQEALIGEQKTELERLRTEVEVLRSGERLGQQAIEQSRQTIKLLEEQVFKQ
                     QQDIAFYKGVVAPASKTDALEIRAFEVQGTDNPLRFRYKVMLSRLGKDERKLDGRLKV
                     RISGKLARKDTSYDLEQLSPELGKTGLSISLRHFQSIPEAGRFAELELPKNFIPTLID
                     VRAELNGQSKPLQRRFDWPKQ"
     gene            801781..802194
                     /locus_tag="PSPA7_RS03840"
                     /old_locus_tag="PSPA7_0805"
     CDS             801781..802194
                     /locus_tag="PSPA7_RS03840"
                     /old_locus_tag="PSPA7_0805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003085251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012074219.1"
                     /db_xref="GI:501021552"
                     /translation="MWSKNKGRADVQRFTGQTSLIASGAELVGDMNLKGAVQIDGAVR
                     GALQAHEGLVRVSVGGRVDGEIRAPHVIIDGQVDGDIHAIERLELGAQARVKGNLHYG
                     LIETAMGAQIDGRLCPMTEASPRPLELPASVETVD"
     gene            802272..802622
                     /locus_tag="PSPA7_RS03845"
                     /old_locus_tag="PSPA7_0806"
     CDS             802272..802622
                     /locus_tag="PSPA7_RS03845"
                     /old_locus_tag="PSPA7_0806"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014833873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="WP_003085254.1"
                     /db_xref="GI:489175729"
                     /translation="MSIETFTPTPLLFTPGAANKVKTLIDEEGNPRLKLRVFVTGGGC
                     SGFQYGFTFDEDIADDDTVIERDGVGLVVDPMSFQYLAGSEVDYQEGLEGSRFVIKNP
                     NAATTCGCGQSFSI"
     gene            complement(802672..803763)
                     /locus_tag="PSPA7_RS03850"
                     /old_locus_tag="PSPA7_0807"
     CDS             complement(802672..803763)
                     /locus_tag="PSPA7_RS03850"
                     /old_locus_tag="PSPA7_0807"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6UZG7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="WP_034000208.1"
                     /db_xref="GI:730365279"
                     /translation="MPRYLGLMSGTSMDGMDIVLIEQGDRTTLLASHYLPMPADLRED
                     ILALCAPGPDEIARAADVERRWVGLAAQGVGELLRQQRLAPGAVRAIGSHGQTIRHEP
                     ARHFTVQIGNPALLAELTGIDVIADFRRRDVAAGGQGAPLVPAFHQALFGDSGKARAI
                     LNIGGFSNVSLLAPGKPVRGFDCGPGNVLMDAWIHCRRGEHFDRDGAWAASGRVNDDL
                     LASLLADEFFATRGPKSTGRERFNLAWLQERLAGHPVLPAEDVQATLLELSARSISES
                     LLDAQPECEEVLVCGGGAFNAALMARLAALMPAARIASTDAYGIPPAWMEGMAFAWLA
                     HRFLERLPGNCPDVTGAAGPRVLGALYPA"
     gene            complement(803766..805172)
                     /locus_tag="PSPA7_RS03855"
                     /old_locus_tag="PSPA7_0808"
     CDS             complement(803766..805172)
                     /locus_tag="PSPA7_RS03855"
                     /old_locus_tag="PSPA7_0808"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012074221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_012074221.1"
                     /db_xref="GI:501021554"
                     /translation="MTQSDQKAPPYYPKSHLLAASGVAALLSLALLVFPSSEVEAKRT
                     TLNLELESNTDRILQEKDDLLPQSVTNSSDEGTPFAQAEGAEQNSDTPVSAAKPVDPE
                     WKSVTVASGDTLSTVFAKAGLSTSAMHDMLASSKDAKRFTHLKVGQEVKLKLDPNGEL
                     QALRVKQSELETIGLDKTAKGYAFKREKAQIDLHTAYAHGRITSSLFVAGRNAGLPYN
                     LVTSLSNIFGYDIDFALDLREGDEFDVIYEQHKVNGKQVATGNILAARFVNRGKTYTA
                     VRYTNKQGNTSYYRADGSSMRKAFIRTPVDFARISSRFSLGRRHPILNKIRAHKGVDY
                     AAPIGTPIKATGDGKILQAGRKGGYGNAVVIQHGQRYRTIYGHMSRFAKGIRSGTSVK
                     QGQIIGYVGMTGLATGPHLHYEFQINGRHVDPLSAKLPMADPLGGADRKRFMAQTQPM
                     IARMDQEKKTLLALNKQR"
     gene