GenomeNet

Database: RefSeq
Entry: NC_010175
LinkDB: NC_010175
Original site: NC_010175 
LOCUS       NC_010175            5258541 bp    DNA     circular CON 16-MAY-2014
DEFINITION  Chloroflexus aurantiacus J-10-fl chromosome, complete genome.
ACCESSION   NC_010175
VERSION     NC_010175.1  GI:163845603
DBLINK      Project: 57657
            BioProject: PRJNA57657
KEYWORDS    RefSeq.
SOURCE      Chloroflexus aurantiacus J-10-fl
  ORGANISM  Chloroflexus aurantiacus J-10-fl
            Bacteria; Chloroflexi; Chloroflexia; Chloroflexales;
            Chloroflexineae; Chloroflexaceae; Chloroflexus.
REFERENCE   1  (bases 1 to 5258541)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T.,
            Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chertkov,O.,
            Brettin,T., Bruce,D., Detter,J.C., Han,C., Schmutz,J., Larimer,F.,
            Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Pierson,B.K.,
            Blankenship,R.E. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Chloroflexus aurantiacus J-10-fl
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5258541)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-DEC-2007) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5258541)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T.,
            Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chertkov,O.,
            Brettin,T., Bruce,D., Detter,J.C., Han,C., Schmutz,J., Larimer,F.,
            Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Pierson,B.K.,
            Blankenship,R.E. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CP000909.
            RefSeq Category: Reference Genome
                        UPR: UniProt Genome
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4000861
            Source DNA and bacteria available from Robert E. Blankenship
            (blankenship@wustl.edu)
            Contacts: Robert E. Blankenship (blankenship@wustl.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5258541
                     /organism="Chloroflexus aurantiacus J-10-fl"
                     /mol_type="genomic DNA"
                     /strain="J-10-fl"
                     /db_xref="taxon:324602"
     gene            336..1775
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /db_xref="GeneID:5825775"
     CDS             336..1775
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein"
                     /protein_id="YP_001633648.1"
                     /db_xref="GI:163845604"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="GeneID:5825775"
                     /translation="MNLTQIWKATLSALQTQTSRHDYEALLRPATLLSLDNGAAFIGV
                     SSPGQKEGLENRLLMPLRNALARVVGYPVQVQVLIANLNSRTEPSPSLTLSNGSRLMS
                     DPEPVVAETPAPALTPGNGTGERVVQLDLASAMRSGMLNPRYTFSSFIVGSSNRLAHA
                     ACLAVADNPGQAYNPLFLYGGVGLGKTHLLHAIGNRVLDRDPEINVLYVSSEKFTNDL
                     INAIRRQQTEEFRMRYRNIDVLLIDDIQFIAGKDATQEEFFHTFNTLHSAAKHIVISS
                     DRPPKAILTLEERLRSRFEWGLIVDVQPPDLETRTAILRAKAEQMSVHVPDEVIDFLA
                     HKIQSNIRELEGSLNRVAAYAELNRAPITIETATAALADLLGNQRRRRISAEAILQIV
                     SEHYGIEVEQLRARNRSRHVVVPRQVAMYLLREETESSLVDIGNLLGGRDHTTVMYGC
                     EKIAEEINSDSRLRSEVMAIRERIQMLRG"
     misc_feature    339..1760
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    <519..>716
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="Cyclin-dependent kinase 5 activator protein;
                     Region: CDK5_activator; pfam03261"
                     /db_xref="CDD:251836"
     misc_feature    798..1229
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    873..896
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(876..899,1062..1064,1158..1160)
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    1050..1067
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    1200..1202
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1491..1757
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1557..1559,1581..1586,1605..1607,1623..1631,
                     1656..1670,1677..1679,1686..1691)
                     /gene="dnaA"
                     /locus_tag="Caur_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1940..3841
                     /locus_tag="Caur_0002"
                     /db_xref="GeneID:5824891"
     CDS             1940..3841
                     /locus_tag="Caur_0002"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     KEGG: mpt:Mpe_A2513 PrpE protein ligase (putative
                     propionyl-CoA synthetase)"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_001633649.1"
                     /db_xref="GI:163845605"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="GeneID:5824891"
                     /translation="MGYEAVYRRSIEEPEAYWAEFAAELHWYKPWEKVLDNSNPPFTR
                     WFVGGETNLCYNAVDRHALGGRRGQAALIWESAETGQSRTLTYFELYREVNRLAGLFH
                     NLGVRKGDRIIIYMPMVPEAIFAMLACVRIGAIHSVVFGGFSVTSLASRIDDAEPVLI
                     VTADAGMRKGQPVPLKEIVDKALAEANTDSVRDVLVLNRGLVPVELKKGRDLDWYEQL
                     AKRGERYVEPVPVASTDPSYILYTSGTTGKPKGVVRDTGGYMVALYASMSTIYNCGDG
                     DVFWSTSDIGWVVGHSYIVYAPLLKGVPTVVYEGRPDHPDPGVWWRVIEKYGVTHVFT
                     APTALRALRKFPEHWMRDADISSLKLLYAAGEPLDAPTYEWASAALGVPVIDHYWQTE
                     SGWPMVTNPVGVELLPIKPGSPTKPAFGHRLEVVDADGNPVPPGEKGFLVEHGPLPPG
                     TLLTLWNDDERFVKGYWGHFKDKLLYMTGDYAIKDADGYLFMLGRADEVLNVSGHRLG
                     TREIEEVVSAHPAVAEASVIGVRDELKGEDVLVVAVLKQHITPQMQDDIANEIRQLVR
                     ERIGPIATPKAVHFVSMLPKTRSGKIMRRVIRAVYQGDNLGDLSTIEDDATVDMVREA
                     IELLRGDLS"
     misc_feature    1940..3817
                     /locus_tag="Caur_0002"
                     /note="propionyl-CoA synthetase; Provisional; Region:
                     prpE; PRK10524"
                     /db_xref="CDD:182517"
     misc_feature    1973..3802
                     /locus_tag="Caur_0002"
                     /note="Propionyl-CoA synthetase (PrpE); Region: PrpE;
                     cd05967"
                     /db_xref="CDD:213314"
     misc_feature    order(2654..2656,2663..2680,2684..2689)
                     /locus_tag="Caur_0002"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213314"
     misc_feature    order(2663..2665,3029..3034,3095..3112,3377..3379,
                     3413..3415,3422..3424,3455..3457,3710..3712)
                     /locus_tag="Caur_0002"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213314"
     misc_feature    order(2663..2665,2786..2791,2942..2944,2948..2953,
                     2960..2962,3029..3034,3095..3112,3377..3379,3413..3415,
                     3422..3424,3446..3457,3653..3655)
                     /locus_tag="Caur_0002"
                     /note="putative active site [active]"
                     /db_xref="CDD:213314"
     misc_feature    order(2786..2788,2948..2953,2960..2962,3029..3031,
                     3446..3454,3635..3637,3653..3655)
                     /locus_tag="Caur_0002"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213314"
     gene            4062..5996
                     /locus_tag="Caur_0003"
                     /db_xref="GeneID:5824892"
     CDS             4062..5996
                     /locus_tag="Caur_0003"
                     /note="TIGRFAM: acetate--CoA ligase;
                     PFAM: AMP-dependent synthetase and ligase;
                     KEGG: rca:Rcas_3935 acetate--CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate--CoA ligase"
                     /protein_id="YP_001633650.1"
                     /db_xref="GI:163845606"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="GeneID:5824892"
                     /translation="MTETRDVALPDTSELYYPDPALVEQSNVMAYARSKGFNSYDELY
                     QWTISHREEFWADMASQLEWFKPWDKVLDDSNKPFYQWFVGGKTNIVYNAIDRHLKTW
                     RKNKLALIWEGEDGSQRTYSYYQLNYEVSRIANVLKSMGVKKGDIVTIYMPRIPELMF
                     SMLACAKIGAAHSVVYGGFSEAALADRLADAKSKVLITADGGYMRGKVVELKKIVNEA
                     LSRTPTVQTCLVFRHTNHGAPMEQGRDFWMHDLLGLPIANGHCPTEEMDAEDMLFILY
                     TSGTTGKPKGVVHTHGGYMVGTYTTLKFVFDIKDEDRYWCAADPGWITGHSFIVYAPL
                     INGATSFMYEGAPNYPYPDRWWSMVAKHGITILYTAPTAIRGLMRFGDLWPSRHDLST
                     LRLLGSVGEPINPEAWKWFYEKIGHGRCPIMDTWWQTETGHFMITPTPAVPLKPGSAT
                     RPFLGIEADVVHEDGSPCAPDEDGLLVIKNPWPGMMRTILNDPQRYVEGYWQKVPPYY
                     AAGDSARKDKDGYIWVIGRLDDVIKVSGYRLGTAEVESALVSHPAVAEAAAIGLPHEV
                     KGNAIHAFVILRAGYEPSHDLEEKLRAHVGHELGPIARPDSITFVTSLPKTRSGKIMR
                     RVLRARALGLPEGDVSTLEE"
     misc_feature    4104..5993
                     /locus_tag="Caur_0003"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     misc_feature    4191..5993
                     /locus_tag="Caur_0003"
                     /note="Acetyl-CoA synthetase (also known as acetate-CoA
                     ligase and acetyl-activating enzyme); Region: ACS;
                     cd05966"
                     /db_xref="CDD:213313"
     misc_feature    order(4587..4595,4671..4673,4680..4682,4686..4688,
                     5013..5015,5028..5033,5097..5105,5175..5180,5187..5189,
                     5256..5267,5331..5348,5595..5597,5631..5633,5640..5642,
                     5664..5675,5847..5849,5862..5867)
                     /locus_tag="Caur_0003"
                     /note="active site"
                     /db_xref="CDD:213313"
     misc_feature    order(4587..4595,4671..4673,4680..4682,4686..4688,
                     5013..5015,5031..5033,5097..5105,5175..5180,5187..5189,
                     5664..5672,5847..5849,5862..5864)
                     /locus_tag="Caur_0003"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    order(4881..4883,4890..4907,4911..4916)
                     /locus_tag="Caur_0003"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213313"
     misc_feature    order(5028..5033,5256..5267,5331..5348,5595..5597,
                     5631..5633,5640..5642,5673..5675)
                     /locus_tag="Caur_0003"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    order(5028..5033,5256..5261,5340..5342)
                     /locus_tag="Caur_0003"
                     /note="acetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213313"
     gene            complement(6173..7702)
                     /locus_tag="Caur_0004"
                     /db_xref="GeneID:5824893"
     CDS             complement(6173..7702)
                     /locus_tag="Caur_0004"
                     /note="PFAM: protein kinase;
                     SMART: tyrosine protein kinase; serine/threonine protein
                     kinase;
                     KEGG: rrs:RoseRS_3893 protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="YP_001633651.1"
                     /db_xref="GI:163845607"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="GeneID:5824893"
                     /translation="MAEVTEILCPICHKPNLRRAKFCQHCGHDVVLNNDRPTDRRRYV
                     ITRIVKRGGQGAVYEGIDQDGQVYAIKEMLDRFADPNERAEAVERFNAEAELLQRLRH
                     PRIPRVYSHFTDEGRHYLTMDFIRGEDLEQIIEREGRIDEQRVLRWADEICDVLGYLH
                     GKGFIYRDMKPSNVMIEPSGDVKLIDFGIAKLFKPTERGTQIGTPGYAPPEQYQGLAT
                     PQSDVYALAATLHHLLTGRDPTQEMPFSFPPARTLVPTISERTSAALERALQKVPADR
                     FATMDEFRAALIPARQPQPVQVQVSRPASPRAPAAPAAARPAGQTPSAASVSPPRPRP
                     PIFADPPISIQGGGAASSASTRRSAPPATVSPVQPPPSPTTSSRSRLGGQIVLSLILL
                     GLIALTLFSGYVIVTRPAWAAPVIELILGNSGSLSGELQTIEYELEATVPVGTSNREL
                     LEVFRTMYQERVQRELGNQAQINPNVPISYVGTPTEIARDGDQITYRARLTGTVWVTA
                     P"
     misc_feature    complement(7613..7678)
                     /locus_tag="Caur_0004"
                     /note="zinc-ribbon domain; Region: zinc_ribbon_2;
                     pfam13240"
                     /db_xref="CDD:257597"
     misc_feature    complement(<7622..7678)
                     /locus_tag="Caur_0004"
                     /note="Double zinc ribbon; Region: DZR; pfam12773"
                     /db_xref="CDD:257289"
     misc_feature    complement(6872..7576)
                     /locus_tag="Caur_0004"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(6875..7552)
                     /locus_tag="Caur_0004"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(7085..7096,7136..7138,7145..7147,
                     7178..7180,7184..7189,7193..7195,7199..7201,7310..7312,
                     7316..7318,7328..7339,7385..7387,7490..7492,7496..7498,
                     7532..7534,7544..7552))
                     /locus_tag="Caur_0004"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(7145..7147,7178..7180,7184..7189,
                     7193..7195,7199..7201,7316..7318,7328..7339,7385..7387,
                     7490..7492,7496..7498,7532..7534,7544..7552))
                     /locus_tag="Caur_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(7085..7096,7136..7138,7187..7189,
                     7193..7195,7199..7201,7310..7312,7316..7318,7544..7546))
                     /locus_tag="Caur_0004"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(7085..7096,7130..7150))
                     /locus_tag="Caur_0004"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(7817..9226)
                     /locus_tag="Caur_0005"
                     /db_xref="GeneID:5824894"
     CDS             complement(7817..9226)
                     /locus_tag="Caur_0005"
                     /note="TIGRFAM: small GTP-binding protein; GTP-binding
                     protein Era;
                     PFAM: GTP-binding protein HSR1-related; KH type 2 domain
                     protein; Miro domain protein;
                     KEGG: rrs:RoseRS_2181 GTP-binding protein Era"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein Era"
                     /protein_id="YP_001633652.1"
                     /db_xref="GI:163845608"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005289"
                     /db_xref="InterPro:IPR005662"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="GeneID:5824894"
                     /translation="MKYCSLDPDVGTLYLYFTDIEEGQATAVMEYPVSLLLDAQGAIF
                     GCRLDLDDEVILSQLELVLEGSYNWLDGEYGHLYIRIADEDPVETITLSETAILDLDD
                     DDLVLGIELALPEEWRTPERLQRLTPLMVTFDDEPVDGEGPVVFTPPAISADDLPDSD
                     EEPATPVAEEPLQWRSGFVALVGKPNVGKSTLLNALLGEKVAIVSPRPQTTRVPVRGI
                     LSRPGEQIIFIDTPGIHEPSHRLGKLMVELAERTLPNADVICFMVDISQPPTRLDRMI
                     AQQVQRARGHKLLVLNKVDQKPKRPGENYLPAYRELGQWEMEIAISARRRLGLTALLS
                     EISARLPEGPPLYPLDQMTDQTEQQLAAEFVREKALFYLQQEVPHAIAIEVEEWQEKE
                     TATYIRMTINVEKESQKGILIGAGGGMLKKIGSAARASIERMLGRPVYLDLWVKVRPN
                     WRDDPSALGWLGYRAKNFL"
     misc_feature    complement(7838..8704)
                     /locus_tag="Caur_0005"
                     /note="GTPase Era; Reviewed; Region: era; PRK00089"
                     /db_xref="CDD:234624"
     misc_feature    complement(8207..8704)
                     /locus_tag="Caur_0005"
                     /note="E. coli Ras-like protein (Era) is a multifunctional
                     GTPase; Region: Era; cd04163"
                     /db_xref="CDD:206726"
     misc_feature    complement(8657..8680)
                     /locus_tag="Caur_0005"
                     /note="G1 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(order(8258..8263,8342..8344,8348..8353,
                     8528..8530,8594..8602,8612..8614,8654..8674))
                     /locus_tag="Caur_0005"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206726"
     misc_feature    complement(order(8585..8629,8633..8635))
                     /locus_tag="Caur_0005"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(8594..8596)
                     /locus_tag="Caur_0005"
                     /note="G2 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(order(8462..8467,8525..8542))
                     /locus_tag="Caur_0005"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(8528..8539)
                     /locus_tag="Caur_0005"
                     /note="G3 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(8342..8353)
                     /locus_tag="Caur_0005"
                     /note="G4 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(8255..8263)
                     /locus_tag="Caur_0005"
                     /note="G5 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(7871..8101)
                     /locus_tag="Caur_0005"
                     /note="KH domain; Region: KH_2; pfam07650"
                     /db_xref="CDD:254331"
     gene            complement(9231..10391)
                     /locus_tag="Caur_0006"
                     /db_xref="GeneID:5824895"
     CDS             complement(9231..10391)
                     /locus_tag="Caur_0006"
                     /note="PFAM: protein of unknown function UPF0118;
                     KEGG: rrs:RoseRS_1556 protein of unknown function UPF0118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633653.1"
                     /db_xref="GI:163845609"
                     /db_xref="InterPro:IPR002549"
                     /db_xref="GeneID:5824895"
                     /translation="MGQEERPIRFSYQAKWISSALIVVLTIWLLFAVTHILPPFIGAI
                     ITAYLFNPLIGWLHRRTRIGRAIWIIVLYIVAFFVLYSLFTALWPRIVQQSRDLAANA
                     PVIIRELTIFFEQNQTIEVGDFVISLAPLEAQVIGLIRDVAGWLSGNVPKIVFSALES
                     VIYLLVYLIITFYLLLQAPQLKAWSRSLIPAPYRREIGHLGYQIDRVFSAYIRGQLIL
                     IVIMSVLLYIPLSILQVPYALVIAVASGVLEILPIIGPWSAAGIAMTVALFQPVTPFG
                     LSNVALAVLLGIIYFVLRQIEDHFIIPNVMGPLVRLHPGVVIFAILAGGALAGAFGLF
                     ISIPIAAVIRILLSYIYRKLTDQPETPSDTDQPHTAAQQETVTGEVALGSQG"
     misc_feature    complement(9297..10373)
                     /locus_tag="Caur_0006"
                     /note="Predicted permease, member of the PurR regulon
                     [General function prediction only]; Region: yhhT; COG0628"
                     /db_xref="CDD:223701"
     gene            complement(10490..10765)
                     /locus_tag="Caur_0007"
                     /db_xref="GeneID:5824896"
     CDS             complement(10490..10765)
                     /locus_tag="Caur_0007"
                     /note="works in conjunction with MinC and MinD to enable
                     cell division at the midpoint of the long axis of the
                     cell"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor
                     MinE"
                     /protein_id="YP_001633654.1"
                     /db_xref="GI:163845610"
                     /db_xref="InterPro:IPR005527"
                     /db_xref="GeneID:5824896"
                     /translation="MSFLNGLFGRKRDSSAELAKQRLLTVLIDDRYKLTPEMMAQMKA
                     DLAEVLKRYLPAIDAEQIEVTLSRGEAHDLLKADVPLRRATDHPPNR"
     misc_feature    complement(10505..10765)
                     /locus_tag="Caur_0007"
                     /note="cell division topological specificity factor MinE;
                     Provisional; Region: PRK13991"
                     /db_xref="CDD:172493"
     gene            complement(10781..11581)
                     /locus_tag="Caur_0008"
                     /db_xref="GeneID:5824897"
     CDS             complement(10781..11581)
                     /locus_tag="Caur_0008"
                     /note="TIGRFAM: septum site-determining protein MinD;
                     PFAM: Cobyrinic acid ac-diamide synthase;
                     KEGG: rca:Rcas_3409 septum site-determining protein MinD"
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinD"
                     /protein_id="YP_001633655.1"
                     /db_xref="GI:163845611"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR010223"
                     /db_xref="GeneID:5824897"
                     /translation="MGRVITVTSGKGGVGKTTTTANLGTALAMRGARVAVVDADIGLR
                     NLDVVMGLENRIVYDLVDVVEGRARLRQALIKDKRLPELCLLPAAQTRDKDAVSAQQM
                     IDLTRQLRAEFDFVLIDSPAGIEAGFRNAIAGADEVIIVTTPEVSAVRDADRIVGLIE
                     AAEKGPASLIINRIKPRLVSRGEMLSVEDVLELLAISLLGIVPEDETIVIATNRGEAA
                     VYDPNSLAGRAYINIAQRLAGEDVPVMAIPDQQGMLDRLLSLFGRRRT"
     misc_feature    complement(10793..11581)
                     /locus_tag="Caur_0008"
                     /note="Septum formation inhibitor-activating ATPase [Cell
                     division and chromosome partitioning]; Region: MinD;
                     COG2894"
                     /db_xref="CDD:225447"
     misc_feature    complement(10892..11572)
                     /locus_tag="Caur_0008"
                     /note="Bacterial cell division requires the formation of a
                     septum at mid-cell. The site is determined by the min
                     operon products MinC, MinD and MinE. MinC is a nonspecific
                     inhibitor of the septum protein FtsZ. MinE is the
                     supressor of MinC. MinD plays a pivotal...; Region: MinD;
                     cd02036"
                     /db_xref="CDD:238993"
     misc_feature    complement(11528..11554)
                     /locus_tag="Caur_0008"
                     /note="P-loop; other site"
                     /db_xref="CDD:238993"
     misc_feature    complement(order(10973..10975,11528..11539,11543..11545))
                     /locus_tag="Caur_0008"
                     /note="ADP binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:238993"
     misc_feature    complement(11462..11470)
                     /locus_tag="Caur_0008"
                     /note="Switch I; other site"
                     /db_xref="CDD:238993"
     misc_feature    complement(11213..11227)
                     /locus_tag="Caur_0008"
                     /note="Switch II; other site"
                     /db_xref="CDD:238993"
     gene            complement(11591..12259)
                     /locus_tag="Caur_0009"
                     /db_xref="GeneID:5824898"
     CDS             complement(11591..12259)
                     /locus_tag="Caur_0009"
                     /note="TIGRFAM: septum site-determining protein MinC;
                     PFAM: Septum formation inhibitor MinC;
                     KEGG: rrs:RoseRS_1559 septum site-determining protein
                     MinC"
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinC"
                     /protein_id="YP_001633656.1"
                     /db_xref="GI:163845612"
                     /db_xref="InterPro:IPR005526"
                     /db_xref="InterPro:IPR013033"
                     /db_xref="GeneID:5824898"
                     /translation="MTMSDLISIKGSRDGLRLRLDANVAWSELLHRLDLHLGERQSFF
                     HGANLVIDLGEREVSSAQLDEMLALIRQHGVQATAIDSTERSTRAAARSVGLTARPLS
                     RSPEATPMPEAEALLVMRTLRSGQVLRHTGHITLIGDVNPGGEIIAGGSVVVWGRLRG
                     LVHAGALGDRSAIICALELRPTQLRIADLIARAPDQQALSRPEFARVIAGEIIVDGWE
                     AFKR"
     misc_feature    complement(11594..12259)
                     /locus_tag="Caur_0009"
                     /note="septum formation inhibitor; Reviewed; Region: minC;
                     PRK00513"
                     /db_xref="CDD:179052"
     misc_feature    complement(11633..11914)
                     /locus_tag="Caur_0009"
                     /note="Septum formation inhibitor MinC, C-terminal domain;
                     Region: MinC_C; pfam03775"
                     /db_xref="CDD:146423"
     gene            12961..13968
                     /locus_tag="Caur_0010"
                     /db_xref="GeneID:5824899"
     CDS             12961..13968
                     /locus_tag="Caur_0010"
                     /EC_number="1.2.1.12"
                     /note="KEGG: rca:Rcas_2314 glyceraldehyde-3-phosphate
                     dehydrogenase, type I;
                     TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase, type I;
                     PFAM: glyceraldehyde 3-phosphate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="YP_001633657.1"
                     /db_xref="GI:163845613"
                     /db_xref="InterPro:IPR000173"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="GeneID:5824899"
                     /translation="MAVRVGINGFGRIGRLALRAAWAWPELDIVHINEVGGDAATAAH
                     LLSFDSTQGRWSVEVHGEGNQLLIDDKTVGYSQIRDPGAVPWADAGVDIVLEATGKFR
                     TAEQLAAYFSAGVKKVIVAAPVKGEALNVVMGVNDHWYEPDRHHLLTAASCTTNCLAP
                     IVKVIHEGIGIRHGMITTIHSSTNTQTVHDRPHKDLRRARAASLSLIPTTTGSATAIG
                     LIFPELQGKLDGQAVRVPLLNASLTDCVFEVRRPTTVAEVNGLLQAAAEGALKGILAY
                     ETRPLVSIDFLGNPHSAIVDSLCTMVTNETQVKIYAWYDNEWGYANRYVELARKVALL
                     L"
     misc_feature    12961..13959
                     /locus_tag="Caur_0010"
                     /note="glyceraldehyde-3-phosphate dehydrogenase;
                     Validated; Region: PRK08955"
                     /db_xref="CDD:169599"
     misc_feature    12967..13419
                     /locus_tag="Caur_0010"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase, NAD
                     binding domain; Region: Gp_dh_N; smart00846"
                     /db_xref="CDD:214851"
     misc_feature    13432..13902
                     /locus_tag="Caur_0010"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; pfam02800"
                     /db_xref="CDD:251539"
     gene            13965..15263
                     /locus_tag="Caur_0011"
                     /db_xref="GeneID:5824900"
     CDS             13965..15263
                     /locus_tag="Caur_0011"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: rrs:RoseRS_1225 major facilitator superfamily MFS_1"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_001633658.1"
                     /db_xref="GI:163845614"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:5824900"
                     /translation="MKTTPSTEASATMTQQRADRRNYVLVTIAYWADTLTDGAIRMLV
                     LFYFAQLGYSPFAVASLFLFYEIFGVITNLFGGYIGARFGLKLTLFLGLATQLVALSM
                     LAFAPPSLLVVPYVMAAQALSGIAKDLTKMSSKSAVKLVAGTGEGQLYRWVSVLTGSK
                     NAIKGLGFFVGALLLSLFGFQTALIMLAVLVLTALVGAVSTISGDLGVANKKAKFKQI
                     FSPNRAVNLLAAARIFLFGARDVWFVVGLPVFFITVLGWDFWLAGGFMAAWTIGYGFV
                     QASTPALIRRRIANAQAPDGRTAMWLAFALAAFPAGIAITLHAGLIPTLSVVGGLLAF
                     GIIFALNSAVHSYLILAYADDAKVAMNVGFYYMANALGRLTGTVLSGALYQWGMQSNP
                     FGGLIACLWASAGFILIAGLLSIRLPTPTRTVVGTWKVEE"
     misc_feature    14034..15191
                     /locus_tag="Caur_0011"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(14073..14075,14082..14090,14094..14099,14148..14150,
                     14157..14162,14169..14171,14181..14186,14190..14195,
                     14343..14348,14355..14360,14367..14372,14379..14381,
                     14421..14426,14433..14438,14454..14456,14670..14672,
                     14679..14684,14691..14696,14706..14708,14748..14750,
                     14760..14762,14772..14774,14781..14783,14793..14795,
                     14967..14969,14976..14981,14988..14990,15000..15005,
                     15012..15014,15045..15050,15057..15062,15069..15074,
                     15081..15083)
                     /locus_tag="Caur_0011"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    14088..15095
                     /locus_tag="Caur_0011"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            complement(15276..15677)
                     /locus_tag="Caur_0012"
                     /pseudo
                     /db_xref="GeneID:5828162"
     gene            16693..17049
                     /locus_tag="Caur_0013"
                     /db_xref="GeneID:5828163"
     CDS             16693..17049
                     /locus_tag="Caur_0013"
                     /note="PFAM: regulatory protein ArsR;
                     KEGG: rca:Rcas_3618 transcriptional regulator, ArsR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein ArsR"
                     /protein_id="YP_001633659.1"
                     /db_xref="GI:163845615"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="GeneID:5828163"
                     /translation="MIRAMKTTTTVKQARLFKALMHPVRIQILDILREGEACVCHIEA
                     VLGLRQAYVSQQLAVLRKAGLIRDRREGPNIYYRIGHRDVFTILDVARTLVGEDELVT
                     PTTVRCSCPRCTAPTA"
     misc_feature    16741..16968
                     /locus_tag="Caur_0013"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(16741..16746,16750..16752,16759..16761,16768..16773,
                     16780..16785,16792..16794,16882..16884,16939..16944,
                     16948..16956,16960..16968)
                     /locus_tag="Caur_0013"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(16744..16749,16759..16767,16804..16812,16837..16848,
                     16852..16857,16864..16869,16873..16878,16894..16902,
                     16915..16923)
                     /locus_tag="Caur_0013"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(16804..16806,16813..16815,16939..16941)
                     /locus_tag="Caur_0013"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            17072..17305
                     /locus_tag="Caur_0014"
                     /db_xref="GeneID:5828164"
     CDS             17072..17305
                     /locus_tag="Caur_0014"
                     /note="TIGRFAM: redox-active disulfide protein 2;
                     KEGG: rca:Rcas_3619 redox-active disulfide protein 2"
                     /codon_start=1
                     /transl_table=11
                     /product="redox-active disulfide protein 2"
                     /protein_id="YP_001633660.1"
                     /db_xref="GI:163845616"
                     /db_xref="InterPro:IPR005243"
                     /db_xref="GeneID:5828164"
                     /translation="MVSVKVLGPGCANCRKLEERVRHVIRQHQLEAEIEKVTDYAQIM
                     RWNVMRTPGLVVNDVLVAAGRIPSEEEIAGWLR"
     misc_feature    17075..17302
                     /locus_tag="Caur_0014"
                     /note="Thioredoxin domain; Region: Thioredoxin_3;
                     pfam13192"
                     /db_xref="CDD:257560"
     gene            17362..18450
                     /locus_tag="Caur_0015"
                     /db_xref="GeneID:5828165"
     CDS             17362..18450
                     /locus_tag="Caur_0015"
                     /note="PFAM: permease;
                     KEGG: rca:Rcas_3620 permease"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_001633661.1"
                     /db_xref="GI:163845617"
                     /db_xref="InterPro:IPR005524"
                     /db_xref="GeneID:5828165"
                     /translation="MQKLAYLMENSIMAQTISPTADRRPAWRIWLLVVGGAAVWLIAY
                     NLIQPLANWLTFQVIGLQEGSHLGEAVAFFLYDVPKILLLLSGMIFLISTIRSFFSPE
                     RTRELLGGKREGVGNILAAGLGVLTPFCSCSAVPLFIGFVEAGIPLGVTFSFLIAAPM
                     VNEVALVMLFGLFGWQVALLYLVAGMSVAILAGIVIGRLHLERYVEDFVWQIKGGNGT
                     VALATPTWPDRFAIAWANTREIVGKVWLFVVLGIAVGAGIHGYVPEDALAGILGREAW
                     WSVPMGVLLGVPLYSNAAGVIPVVQALMAKGAALGTVLAFMMSVVALSLPELIILRRV
                     LKLPLIATFVGVVASGIILVGYLFNLMM"
     misc_feature    17554..18444
                     /locus_tag="Caur_0015"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0701"
                     /db_xref="CDD:223773"
     gene            complement(18495..18875)
                     /locus_tag="Caur_0016"
                     /db_xref="GeneID:5828166"
     CDS             complement(18495..18875)
                     /locus_tag="Caur_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633662.1"
                     /db_xref="GI:163845618"
                     /db_xref="GeneID:5828166"
                     /translation="MSGSQFGRRQILSIIAGGYGGLLCAFGALLIFFGLVNYSEVGLG
                     GLAAFLAIIFSVPIILFAVVLIVAAIGLWNNRPWARILLMVLAAIHLAIAVSMIPLGD
                     LWPISLLGIALSVGIFWFVRGLQE"
     misc_feature    complement(<18513..18857)
                     /locus_tag="Caur_0016"
                     /note="lysyl-tRNA synthetase; Provisional; Region: lysS;
                     PRK02983"
                     /db_xref="CDD:235095"
     gene            complement(19929..20099)
                     /locus_tag="Caur_0017"
                     /pseudo
                     /db_xref="GeneID:5828167"
     gene            20916..21719
                     /locus_tag="Caur_0018"
                     /db_xref="GeneID:5828168"
     CDS             20916..21719
                     /locus_tag="Caur_0018"
                     /note="PFAM: protein of unknown function DUF574;
                     KEGG: rrs:RoseRS_1762 protein of unknown function DUF574"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633663.1"
                     /db_xref="GI:163845619"
                     /db_xref="InterPro:IPR006764"
                     /db_xref="GeneID:5828168"
                     /translation="MEPSGAVELSPSETPNAARIYSYTLGGSYYLPVDRAAAEYMFSL
                     VPSTPKWVRMLRSFLQHAARRLWAEGLTHFIDFASGLPTDDHIHHVLPDARVVYSDLD
                     PETYNLARQLVEHLPNVLYLRHDVREARVLLDSPEVQNFLGGERRVAFGLNGITVFLS
                     PDEISHLFHDLYEWAAPGSRLYITYETKMPGLMTPRMEQFIDMFRQAGSPFWLYSLEE
                     CIALSRPWQIPPTGLMPLHEFLGLPADYITESDQEGVGLQFYAAILTKP"
     misc_feature    20949..21629
                     /locus_tag="Caur_0018"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            22044..23089
                     /locus_tag="Caur_0019"
                     /pseudo
                     /db_xref="GeneID:5828169"
     gene            23546..24463
                     /locus_tag="Caur_0020"
                     /db_xref="GeneID:5828170"
     CDS             23546..24463
                     /locus_tag="Caur_0020"
                     /note="TIGRFAM: phosphonate ABC transporter, periplasmic
                     phosphonate-binding protein;
                     KEGG: gur:Gura_0350 phosphonate ABC transporter,
                     periplasmic phosphonate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter periplasmic
                     phosphonate-binding protein"
                     /protein_id="YP_001633664.1"
                     /db_xref="GI:163845620"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR005770"
                     /db_xref="GeneID:5828170"
                     /translation="MKYYLFIIFIILLGISGCQRTTTSLIQLDDLQPLPMPTPVTSPP
                     LRVSVASVISAQGTVQSYQPLLDYLSARLGREVTLIQRRTYTETNELIGRNEVDVAFV
                     CTSAYIDGRDRYGMSLLVAPQVNGETTYHSLLIVPTDSPARSMADLRGKVFAFTDPTS
                     FSGRVYPTALVQELGDSPESFFQDTFFTYSHDAAIEAVANGLADGAAVDSLVFHFALS
                     RHPELREQVKVIHTSPPFGIPPVVVGPGVRPQLRAELQNILLGMADDPSPLAQTALES
                     LGIDRFVMIDDAAYASARLLRSQVGPVSP"
     misc_feature    23684..24415
                     /locus_tag="Caur_0020"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     pfam12974"
                     /db_xref="CDD:257438"
     gene            24460..25935
                     /locus_tag="Caur_0021"
                     /db_xref="GeneID:5828171"
     CDS             24460..25935
                     /locus_tag="Caur_0021"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     histidine kinase HAMP region domain protein; histidine
                     kinase dimerisation and phosphoacceptor region;
                     KEGG: dsy:DSY4128 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase domain-containing protein"
                     /protein_id="YP_001633665.1"
                     /db_xref="GI:163845621"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011712"
                     /db_xref="GeneID:5828171"
                     /translation="MNAGFLPHQVVRWATTLWQIVGSVNIRAKILGIVLGLVVLMGVA
                     ATIEVRTLLEHTLTVQTHERSIAIARDVAARSTDLVLMRDYYRLFRLLQDTQENNPDL
                     RYAFIIDSEGTIVAHTFGSGFPVGLRDANTVTAQEHHRSVLLATNEGDIWDTAVPMFD
                     GRAGIARVGLSLAAREQTVAAVTGQLLITTIMAAAIGITAAAFLTWLLTRPILQLVAL
                     TKAVALGDFSQRARRWANDEIGQLTDAFNAMSEALAQAERERAEREHLRAQYVTQIIT
                     AQEEERKRIARELHDSTSQALTSLLVGLRSLADRHRSPEIAQQVDDLRSIVGQILNDL
                     HALARQLRPSVLDDLGLAAALQRYVAECRARSGLIIDLALPGLDDFRLDPVVETALYR
                     IVQEGLTNIIRHAHASTASVVIERRADRVRAIIEDDGCGFDPNALHGDGHLGLNGIRE
                     RAALLNGQLIIESSPGSGTTLYVEIPLTTRHEECYEQHSLS"
     misc_feature    <25066..25890
                     /locus_tag="Caur_0021"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    25081..25224
                     /locus_tag="Caur_0021"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(25081..25086,25093..25098,25102..25107,25114..25119,
                     25123..25125,25171..25176,25180..25185,25192..25197,
                     25201..25206,25213..25218)
                     /locus_tag="Caur_0021"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    25300..25497
                     /locus_tag="Caur_0021"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    25627..25884
                     /locus_tag="Caur_0021"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(25645..25647,25657..25659,25666..25668,25732..25734,
                     25738..25740,25744..25746,25750..25755,25786..25794,
                     25840..25842,25846..25848,25861..25866,25870..25872)
                     /locus_tag="Caur_0021"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    25657..25659
                     /locus_tag="Caur_0021"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(25744..25746,25750..25752,25789..25791)
                     /locus_tag="Caur_0021"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            25913..26554
                     /locus_tag="Caur_0022"
                     /db_xref="GeneID:5828172"
     CDS             25913..26554
                     /locus_tag="Caur_0022"
                     /note="PFAM: regulatory protein LuxR; response regulator
                     receiver; Sigma-70 region 4 type 2;
                     KEGG: sth:STH3220 two-component response regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="YP_001633666.1"
                     /db_xref="GI:163845622"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="GeneID:5828172"
                     /translation="MSSILLVDDHAVLRAGLRLLLDGQPDLRVIGEAEDVRTAVVQAT
                     TLQPDLILLDLSLTGSSGLAAIPALRAVAPHSRILVLTMHDDEGYVRQALAAGANGYV
                     LKRAADAELIAAIRAVLRGELYIHPALTRQLLEDLLPQTPALNPWESLSEREREVLLL
                     VARGYTAAEIAEQLSLSPKTVETYRTRGMEKLGLRSRAALVQYALNHNLLTPT"
     misc_feature    25922..26548
                     /locus_tag="Caur_0022"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    25925..26269
                     /locus_tag="Caur_0022"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(25934..25939,26072..26074,26096..26098,26156..26158,
                     26213..26215,26222..26227)
                     /locus_tag="Caur_0022"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    26072..26074
                     /locus_tag="Caur_0022"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(26081..26086,26090..26098)
                     /locus_tag="Caur_0022"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    26222..26230
                     /locus_tag="Caur_0022"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    26360..26530
                     /locus_tag="Caur_0022"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(26363..26371,26408..26416,26438..26443,26447..26452,
                     26456..26470,26501..26503)
                     /locus_tag="Caur_0022"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(26396..26398,26402..26404,26408..26410,26501..26509,
                     26516..26518,26525..26530)
                     /locus_tag="Caur_0022"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            26713..27669
                     /locus_tag="Caur_0023"
                     /db_xref="GeneID:5828173"
     CDS             26713..27669
                     /locus_tag="Caur_0023"
                     /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
                     protein;
                     KEGG: deb:DehaBAV1_0265 4Fe-4S ferredoxin, iron-sulfur
                     binding domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_001633667.1"
                     /db_xref="GI:163845623"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:5828173"
                     /translation="MTRQPTIPLTPVSRRGLLGALVAGAGALAAASVQAGLPASTGKS
                     ADTIDVLSPEEALAAYEAEIARLRATKVSGTPLDHLERMRAELLRALAKPVAERRWVM
                     VIDLRACVGCHGCTIACVAENKLPPGVVYRPVIDEEIGRYPNVTRRFIPRPCMQCDNP
                     PCTGVCPVSATFTNEHGVVEVDYEQCIGCRACIAACPYGARTFDFGYTYTADTTDPGV
                     MFGADQAATYETVTTFEYGKAHARRNLHDSPVGNVRKCHFCMHRVLNGQLPACVTTCI
                     GRATFFGDANDPDSLVSELIAKPNVMRLKEDLGTEPRVYYLQ"
     sig_peptide     26713..26820
                     /locus_tag="Caur_0023"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.898 at
                     residue 36"
     misc_feature    27022..27564
                     /locus_tag="Caur_0023"
                     /note="DMSO reductase, iron-sulfur subunit; Region:
                     DMSO_dmsB; TIGR02951"
                     /db_xref="CDD:131996"
     misc_feature    27157..27564
                     /locus_tag="Caur_0023"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            27681..28826
                     /locus_tag="Caur_0024"
                     /db_xref="GeneID:5828174"
     CDS             27681..28826
                     /locus_tag="Caur_0024"
                     /note="PFAM: Polysulphide reductase NrfD;
                     KEGG: det:DET0102 molybdopterin oxidoreductase, membrane
                     subunit, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="polysulfide reductase NrfD"
                     /protein_id="YP_001633668.1"
                     /db_xref="GI:163845624"
                     /db_xref="InterPro:IPR005614"
                     /db_xref="GeneID:5828174"
                     /translation="MLKRLLYLAGTLGLLVGLWGLYDRLVYGHMHANYGSYVVWGLWV
                     ALYMFFAGVATGAFMLATLDLLFELPIFRGSGRMALWGSLVAMPAGLVAIGLDLGHMT
                     RIWKVYLQPNFGSVMAQLVWGYTIFLGIVVISLWLSLRPQPSRWLKPVMAIGLILAIF
                     LSGGIGALLGVNQNRISWHVSNLPAQFPVFNLTSGVALMLIAIGWFGPLRDPRRSQQL
                     RILSLAMVVLLLVKGYYLWSDVSQALYQNSSHGAAAINLVLFGPYGWAFWLLQLGLGM
                     LIPLIVLTMPVGQRGFAAGLMGVCVLIGLAVARANIIFPALSLPELQGLGEAFHGPHL
                     SFTYSPSLMEWAVTAGIVGAATIGFLLGTDRLPLFNRLPTEASSAAD"
     misc_feature    27750..28808
                     /locus_tag="Caur_0024"
                     /note="Polysulphide reductase [Energy production and
                     conversion]; Region: COG5557; cl17901"
                     /db_xref="CDD:248455"
     gene            28879..32139
                     /locus_tag="Caur_0025"
                     /db_xref="GeneID:5828175"
     CDS             28879..32139
                     /locus_tag="Caur_0025"
                     /note="PFAM: molybdopterin oxidoreductase; molydopterin
                     dinucleotide-binding region; molybdopterin oxidoreductase
                     Fe4S4 region;
                     KEGG: deh:cbdb_A118 molybdopterin oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="YP_001633669.1"
                     /db_xref="GI:163845625"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="GeneID:5828175"
                     /translation="MKRQPETSTRTDQSMSRRDFLKTSALLGGGAALLGFGPLAGLAR
                     GEAPALELPLVDAANSIQTVCLQCNTGCGLKVKLIDGVAAKLEGNPYSPWTMEPPLPF
                     STPISASGSIDGALCPKGHAGIQTAYDPYRLMRVLKRKPGTPRGGGQWITIDFDQAIT
                     EIVEGGDLFGEGPVEGLRALYALKDAKLAKEMANAVNAILAARPEEKPALVEQFKRDF
                     ADHLDVLIDPDHPDLGPKNNQFAFVWGRLKNGRGDLVQRFVKKGFGSVNANGHTTVCQ
                     GSLYFTGKAMSEQFDPKTGKFSGGQKFYWQADLGNAEFVIFVGTNHFEANYGPTPQSP
                     RITQGVINSRLRYVVLDPRLSKLASKAWKWLPIKPGTDAAFAMAMIRWIIEQQRYNTR
                     FLAAANKAAAAANGEPSWTNATWLVKVKDGVPGKFLRASEIGLTTVVEETDAEGKKTK
                     AYVTADGTRFSFDPFVALVNGVPTPIDPNDPEAAPVIGDLLVDTELNGIAVKSSLQVI
                     YEAASTHTIEEWAAIADVKAEDIIEIAYEFTSHGTRAVADIHRGPSQHTNGFYTNFAF
                     YTLNALIGNFDHRGGLIKPTTYDRLGTKAKGPFEVEKMTNGANVPFGIDLLRTNTAYE
                     KSTLFNGYPARRPWFPLATDVYQEDIPSMGDAYPYQIKVAMFYMSAINYALPAAQTTI
                     EILADPKKIPLIITSDVMVGETSTYADYIFPDLSFLERWEFHGSHPSVPWKVENIRQP
                     AISLPNWPTVKVFGEEIPLSFEALVLAIAERLELPGFGPNGFGEGIPFTRPEHLYLKL
                     AANIAFGEKEDGSDGVPPADYAELEVFRRARRFLPPSVFDEAKWRAAIGNDEQLWRQT
                     VYVLNRGGRYQAYEKGWKGDLAGNPYAKQINLYQEKTATTINSMTGDHLIGYPTYIPA
                     GLAADGTPIVDEGYDLHLVTYKEAMMAKARGIADYWLLALMPENAILINRLDAERLGL
                     RNGDRVRISSASNPDGVWDLQNGTRKPMIGKVKVIEGIRPGVISFPLGWGHFASGASD
                     IVIDGVTIPADPRRAAGIHANAAMRVDPVLGNVTLSDLVGGSAVFYDTKVKLERVG"
     sig_peptide     28879..29016
                     /locus_tag="Caur_0025"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.982) with cleavage site probability 0.492 at
                     residue 46"
     misc_feature    29047..32133
                     /locus_tag="Caur_0025"
                     /note="tetrathionate reductase subunit A; Provisional;
                     Region: PRK14991"
                     /db_xref="CDD:237883"
     misc_feature    29065..31632
                     /locus_tag="Caur_0025"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:263922"
     misc_feature    order(29233..29235,29692..29694,29698..29706,29830..29835,
                     29839..29841,29848..29853,29926..29934,29992..29994,
                     30526..30528,30880..30888,30967..30975,30982..30984,
                     31018..31023,31036..31038)
                     /locus_tag="Caur_0025"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238218"
     misc_feature    31660..32130
                     /locus_tag="Caur_0025"
                     /note="This CD contains the molybdopterin_binding
                     C-terminal (MopB_CT) region of tetrathionate reductase,
                     subunit A, (TtrA); respiratory arsenate As(V) reductase,
                     catalytic subunit (ArrA); and other related proteins;
                     Region: MopB_CT_Tetrathionate_Arsenate-R; cd02780"
                     /db_xref="CDD:239181"
     misc_feature    order(31663..31689,31933..31935,32020..32022,32110..32115)
                     /locus_tag="Caur_0025"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239181"
     gene            32700..33029
                     /locus_tag="Caur_0026"
                     /db_xref="GeneID:5828176"
     CDS             32700..33029
                     /locus_tag="Caur_0026"
                     /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
                     family;
                     PFAM: Carboxymuconolactone decarboxylase;
                     KEGG: mca:MCA0351 carboxymuconolactone decarboxylase
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="YP_001633670.1"
                     /db_xref="GI:163845626"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR004675"
                     /db_xref="GeneID:5828176"
                     /translation="MSQLPEAYRTFLQDYPTVAGVYEQLGAAAAEAGPLDAKTRELVK
                     LAMAAALGSEGAVHSHVHRALAAGATAAEIEHTLILGVTTLGFPTMMMALRWARTALH
                     QATSPQS"
     misc_feature    32700..33011
                     /locus_tag="Caur_0026"
                     /note="Uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit [Function
                     unknown]; Region: COG0599"
                     /db_xref="CDD:223672"
     gene            33043..33672
                     /locus_tag="Caur_0027"
                     /db_xref="GeneID:5828177"
     CDS             33043..33672
                     /locus_tag="Caur_0027"
                     /note="KEGG: rca:Rcas_2175 formylmethanofuran
                     dehydrogenase subunit E region"
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran dehydrogenase subunit E"
                     /protein_id="YP_001633671.1"
                     /db_xref="GI:163845627"
                     /db_xref="GeneID:5828177"
                     /translation="MSVDDLIDTTSLELLVAPAPLADFLRQSSAMHRHLCPRQVLGAR
                     MGMYAGELLGLTLPQKNKRLYTFVETDGCFADGVSVTTGCWLGRRTMRLMDEGKVAAT
                     FVDTQTGQAFRIAPRPNVRDLARQYAPNARSRWHAYLIAYQLMPLTDLLIAQPITLTV
                     DLKAIISRNGLRTTCDHCGEEIINAREVIRDGQTLCRTCGGEGYYTITG"
     misc_feature    33109..33660
                     /locus_tag="Caur_0027"
                     /note="Formylmethanofuran dehydrogenase subunit E [Energy
                     production and conversion]; Region: COG2191"
                     /db_xref="CDD:225102"
     misc_feature    33130..33507
                     /locus_tag="Caur_0027"
                     /note="FmdE, Molybdenum formylmethanofuran dehydrogenase
                     operon; Region: FmdE; pfam02663"
                     /db_xref="CDD:251455"
     misc_feature    33550..33657
                     /locus_tag="Caur_0027"
                     /note="Prokaryotic dksA/traR C4-type zinc finger; Region:
                     zf-dskA_traR; pfam01258"
                     /db_xref="CDD:250482"
     gene            complement(34058..34501)
                     /locus_tag="Caur_0028"
                     /db_xref="GeneID:5828178"
     CDS             complement(34058..34501)
                     /locus_tag="Caur_0028"
                     /note="TIGRFAM: iron-sulfur cluster assembly accessory
                     protein;
                     PFAM: HesB/YadR/YfhF-family protein;
                     KEGG: rrs:RoseRS_2111 iron-sulfur cluster assembly
                     accessory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly accessory protein"
                     /protein_id="YP_001633672.1"
                     /db_xref="GI:163845628"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="GeneID:5828178"
                     /translation="MTTVDLNQITFQPATPQPLLTISEAASSRLLKMMQEKELEGYAL
                     RVFVAGGGCSGLQYGMTFDDEVREGDNEFYAGNLRVLVDPISAQYLFGASIDFVDTLM
                     GGGFKIDNPNAVSSCGCGHSFRARDTDYSEDDEDAPVGGCSACGM"
     misc_feature    complement(34130..34456)
                     /locus_tag="Caur_0028"
                     /note="Fe-S cluster assembly scaffold protein
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: sufA; COG0316"
                     /db_xref="CDD:223393"
     gene            complement(34623..36386)
                     /locus_tag="Caur_0029"
                     /db_xref="GeneID:5828179"
     CDS             complement(34623..36386)
                     /locus_tag="Caur_0029"
                     /note="TIGRFAM: protoheme IX farnesyltransferase;
                     PFAM: UbiA prenyltransferase;
                     KEGG: rca:Rcas_4304 protoheme IX farnesyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="YP_001633673.1"
                     /db_xref="GI:163845629"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="GeneID:5828179"
                     /translation="MAARSLMRILLVGLGLTLATIISGALVTISASATVCSSWPLCLE
                     ELVQSQNPLVWISLLHRLFVALALLAVFAGLVAVWRSSDTAGLPRITAGIAAAFFLLQ
                     ALAGALLVWGVPAMVADVWHLSGALLAFGAQSLTIALIAVPTPATPERLAGRAAQMQR
                     RLRSLAWWSAAAAGVAALAIGARSVVPGFGMMTAVPTNSVSAVGFAALLSVWMALEAR
                     RRLRPVAETPALALALPRYSLFLPALALLALLGAFIPVAGHLISLTAIALLWAATIIA
                     AVILQRVPFSFATATAGVRSQPAWRTVVADYISLTKPKVISLLLVTTLTTMFITEAGL
                     PSWWLVIWTMIGGYLAAGGAGAINCAFDSDIDINMGRTSRRPVPSGRISRRAAFIFGL
                     ILSVLSIIVLWVFTTPLAAFFALLGIIYYAWFYTGWLKRSTWQNIIIGGGAGAIPPLV
                     GWTAVTGSVSLMAVVLFAIIFYWTPPHFWALALVKQKDYARAGVPMLPVVAGEAETRW
                     QILVYSAIMVAVSLLPVAIGAMSWIYLIGAVVLGLRFMRDAWAVWRVGDQAAIWGLYK
                     YSLLYLALVFAAMVADRLIIG"
     sig_peptide     complement(36279..36386)
                     /locus_tag="Caur_0029"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.995) with cleavage site probability 0.354 at
                     residue 36"
     misc_feature    complement(35991..>36383)
                     /locus_tag="Caur_0029"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; cl19388"
                     /db_xref="CDD:267741"
     misc_feature    complement(34653..35465)
                     /locus_tag="Caur_0029"
                     /note="Protoheme IX farnesyltransferase; Region:
                     PT_UbiA_Cox10; cd13957"
                     /db_xref="CDD:260120"
     misc_feature    complement(order(34923..34925,35289..35291,35301..35303))
                     /locus_tag="Caur_0029"
                     /note="putative active site [active]"
                     /db_xref="CDD:260120"
     gene            complement(36402..36617)
                     /locus_tag="Caur_0030"
                     /db_xref="GeneID:5828180"
     CDS             complement(36402..36617)
                     /locus_tag="Caur_0030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633674.1"
                     /db_xref="GI:163845630"
                     /db_xref="GeneID:5828180"
                     /translation="MIAWLIFWLAAIVAIGGQIPLILAAWRLYRQPFQQAPANVPRSD
                     GRADLGWTILTALATLALFGAAYLALP"
     gene            complement(36999..37940)
                     /locus_tag="Caur_0031"
                     /db_xref="GeneID:5828181"
     CDS             complement(36999..37940)
                     /locus_tag="Caur_0031"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; response regulator
                     receiver;
                     KEGG: rca:Rcas_3221 response regulator receiver modulated
                     diguanylate cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_001633675.1"
                     /db_xref="GI:163845631"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:5828181"
                     /translation="MSEEVHLPTVLFADDDPHIRTLLSDTLTQAGFAVLAAEDGLSLI
                     RIAQEQLPDIILVDLMLPGVDGYEAIRQLRNDTRTAHLPIIIVTARANPSDVVIGFDT
                     GADDYITKPFNEAELVARIRSLLRRITKRPVRNPLTGLPGNVLIGEEIRYRLQRGEPF
                     TLLYTDINEFKAFNDKYGFARGDQVIRLVAELCEQAQQFFAPHAIFVGHIGGDDFVLL
                     CPSTVAADLARWLVDQFEQAALSLYDEEDRQRGYLVGYDRAGNLRHIPLATMAVGGVS
                     SRLDATVDELSREAAAMKHAAKVFGTSAVIIDHVRLR"
     misc_feature    complement(37566..37910)
                     /locus_tag="Caur_0031"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(37608..37613,37620..37622,37677..37679,
                     37743..37745,37767..37769,37896..37901))
                     /locus_tag="Caur_0031"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(37767..37769)
                     /locus_tag="Caur_0031"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(37743..37751,37755..37760))
                     /locus_tag="Caur_0031"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(37605..37613)
                     /locus_tag="Caur_0031"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(37053..37541)
                     /locus_tag="Caur_0031"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(37302..37304,37443..37445))
                     /locus_tag="Caur_0031"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(37299..37310,37314..37316,37392..37394,
                     37404..37406,37416..37421,37428..37430))
                     /locus_tag="Caur_0031"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(37239..37241,37329..37331))
                     /locus_tag="Caur_0031"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(37933..38877)
                     /locus_tag="Caur_0032"
                     /db_xref="GeneID:5828182"
     CDS             complement(37933..38877)
                     /locus_tag="Caur_0032"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein;
                     KEGG: rca:Rcas_3224 alcohol dehydrogenase GroES domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_001633676.1"
                     /db_xref="GI:163845632"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:5828182"
                     /translation="MRAIFFNGDLQYTTDYPDPVRQPGEALIRPHLVGICNTDLEITR
                     GYMNFRGVLGHEFVGTVVASDDPSWQGKRVVGEINAACRRCPTCLRGDVSHCPQRTTL
                     GIYRRDGAMADLFTLPEACLHEVPASVSDEAAVFTEPLAAALEIVEQSHIRPTERVAV
                     VGDGKLGAMIVQVLRLTGCELTLIGRHPERWDVYRQQGITCVRSTDLPGTLFDVVVDC
                     TGNPSGLNIARQIIRPRGRLILKSTFAAETQLNLSMVVVDEIQLIGSRCGPFAPALRL
                     LERGLIATTPLISARYPLAEGLQAFAAAPGQLKVLLSV"
     misc_feature    complement(37936..38877)
                     /locus_tag="Caur_0032"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR_like; cd08242"
                     /db_xref="CDD:176204"
     misc_feature    complement(37942..38877)
                     /locus_tag="Caur_0032"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    complement(order(38077..38085,38152..38157,38215..38217,
                     38221..38226,38272..38274,38308..38310,38320..38325,
                     38377..38394,38452..38454,38464..38466,38755..38757,
                     38764..38772))
                     /locus_tag="Caur_0032"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176204"
     misc_feature    complement(order(38464..38466,38713..38715,38764..38766,
                     38770..38772))
                     /locus_tag="Caur_0032"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176204"
     misc_feature    complement(order(38590..38592,38614..38616,38623..38625,
                     38632..38634))
                     /locus_tag="Caur_0032"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176204"
     gene            39515..40447
                     /locus_tag="Caur_0033"
                     /db_xref="GeneID:5828183"
     CDS             39515..40447
                     /locus_tag="Caur_0033"
                     /note="TIGRFAM: methionyl-tRNA formyltransferase;
                     PFAM: formyl transferase domain protein;
                     KEGG: rrs:RoseRS_3920 methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_001633677.1"
                     /db_xref="GI:163845633"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="GeneID:5828183"
                     /translation="MRILFLGSPSFAVHALEALVAAGHEIVGVVTQPDRPAGRDRRLT
                     PPPVKIAAMAHNLPVLQPETLRDPTVVETLSALQPEVGVVAAYGEILRRAVLSIPPLG
                     YLNIHPSLLPLYRGPTPVAGAILAGETVTGVTIMLLDPSMDSGPILAQAVVDLPPTAR
                     AGQLTDELFRIGADLLVQVLPRYARGEIEPRPQDHSRATVTKMLKKEDGRIDWSLPAI
                     VIERMTRAYDPWPGAYTFWRGQPLRIIKAAVASADGTNVPGTVIGRSGSGHPLVQTGS
                     DALELIEVQPASRRPMSGSAWLAGVHADNIRLGE"
     misc_feature    39515..40441
                     /locus_tag="Caur_0033"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    39515..40126
                     /locus_tag="Caur_0033"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     sig_peptide     39515..39562
                     /locus_tag="Caur_0033"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.788) with cleavage site probability 0.667 at
                     residue 16"
     misc_feature    order(39533..39535,39545..39550,39764..39787,39800..39802,
                     39827..39838,39860..39862,39920..39922,39926..39931,
                     39938..39943)
                     /locus_tag="Caur_0033"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    order(39536..39541,39545..39547,39608..39610,39620..39622,
                     39626..39637,39767..39778,39827..39829,39833..39838,
                     39860..39868,40121..40123)
                     /locus_tag="Caur_0033"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    order(39764..39766,39773..39775,39779..39787,39800..39802,
                     39827..39829,39926..39931,39938..39943)
                     /locus_tag="Caur_0033"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    order(39827..39829,39833..39835,39941..39943)
                     /locus_tag="Caur_0033"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    40133..40396
                     /locus_tag="Caur_0033"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    order(40202..40204,40235..40237,40241..40243,40367..40369,
                     40373..40375,40379..40384,40388..40390)
                     /locus_tag="Caur_0033"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            41293..41727
                     /locus_tag="Caur_0034"
                     /db_xref="GeneID:5828184"
     CDS             41293..41727
                     /locus_tag="Caur_0034"
                     /note="KEGG: rca:Rcas_0831 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633678.1"
                     /db_xref="GI:163845634"
                     /db_xref="GeneID:5828184"
                     /translation="MPFFKDEAELRQILGELYDRVKCDAQIAPRICEGRIVIQFRYEE
                     PHGVVTIDAAHPPTQPGAFCDVFWGEVDLKPDVEMSMKADIAHQFWHGKINLMTALAR
                     RQIIAKGPIPKILKLLPAVEPMYTLYPRMLREMGREDLVLTR"
     gene            41762..42337
                     /locus_tag="Caur_0035"
                     /db_xref="GeneID:5828185"
     CDS             41762..42337
                     /locus_tag="Caur_0035"
                     /note="KEGG: rrs:RoseRS_4479 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633679.1"
                     /db_xref="GI:163845635"
                     /db_xref="GeneID:5828185"
                     /translation="MYERGAADAERGEFNPFYYQHYYYYRQGYDSVRRRNRPGINRVG
                     ILLISGIGVVGLVALVWLIGRIGPAVVAQPVASPTTVATTPQPSPIPPTPTPLPSPTP
                     IPTEAPPTLQVGGRAVVVNVGEAALRLRASPGLTARVIARIPAGREVVLLEGPIEVDG
                     YTWWRVEVGSQSGWCAVATPDGLTFLEPVAP"
     misc_feature    42140..42289
                     /locus_tag="Caur_0035"
                     /note="Bacterial SH3 domain; Region: SH3_3; pfam08239"
                     /db_xref="CDD:254683"
     gene            complement(42729..43412)
                     /locus_tag="Caur_0036"
                     /db_xref="GeneID:5828186"
     CDS             complement(42729..43412)
                     /locus_tag="Caur_0036"
                     /note="PFAM: phospholipid/glycerol acyltransferase;
                     KEGG: rca:Rcas_2771 phospholipid/glycerol acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_001633680.1"
                     /db_xref="GI:163845636"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="GeneID:5828186"
                     /translation="MFAYVVYGILYLIINFFRLIGWWRWSISGIERLPPREQGGMILV
                     MNHINWVDIPAVGAMLPFRYRLSWLAKIEIFSHPLAGWFFRNMDVIPIRRGKRDLAAL
                     DAAAQALRNGAVLLIFPEGHRSRNGILQPGRGGAVRLAMQAGVPLVPMAITGTEHGFR
                     GTLLRKPVHITIGEPYRVEPLPDNKIPADVMEQLTNEMMLKIAAMLPPAQRGPYAALL
                     EAAAVKEQV"
     misc_feature    complement(42831..43373)
                     /locus_tag="Caur_0036"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(43044..43052,43194..43205,43257..43259,
                     43263..43265,43272..43274))
                     /locus_tag="Caur_0036"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(43420..43860)
                     /locus_tag="Caur_0037"
                     /db_xref="GeneID:5828187"
     CDS             complement(43420..43860)
                     /locus_tag="Caur_0037"
                     /note="KEGG: rrs:RoseRS_2830 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633681.1"
                     /db_xref="GI:163845637"
                     /db_xref="GeneID:5828187"
                     /translation="MYALHPATVHIPIGLLLASSLFTFIALRTGRMQWEQSSFHCLIF
                     GLLGAVIAMVSGLIDAARQVTSPQIAPDDPVIMWINGHAAASLAATLCYGRVWLMRRR
                     QPGLLTDSTQRNAYLGWHVAGIVLLVLGGWLGGRLVFEFNLGRL"
     misc_feature    complement(<43678..43860)
                     /locus_tag="Caur_0037"
                     /note="Predicted membrane protein (DUF2231); Region:
                     DUF2231; cl01730"
                     /db_xref="CDD:242671"
     gene            complement(43869..44489)
                     /locus_tag="Caur_0038"
                     /db_xref="GeneID:5828188"
     CDS             complement(43869..44489)
                     /locus_tag="Caur_0038"
                     /note="PFAM: protein of unknown function UPF0029; Domain
                     of unknown function DUF1949;
                     KEGG: mxa:MXAN_2845 conserved hypothetical protein
                     TIGR00257"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633682.1"
                     /db_xref="GI:163845638"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR015269"
                     /db_xref="InterPro:IPR015796"
                     /db_xref="GeneID:5828188"
                     /translation="MTSPHYPVPAGTARTELIVRGSRFIAQLFPTPTVDAAREAIAMV
                     RAAMPDATHHCYAYLVGYGQSTIAGMSDDGEPAGSAGRPMMAVLRGADLGDVTVVVTR
                     YFGGTLLGIGGLVRAYSDATRAVLEIVPRTQRVIYQRIIVHLQYSDYTAIRRLLEAHA
                     AVIVEEVFAVDVVITADLPTDHVAVVNHQIGEISAGRARLETAPMV"
     misc_feature    complement(43887..44477)
                     /locus_tag="Caur_0038"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1739"
                     /db_xref="CDD:224653"
     misc_feature    complement(44109..44435)
                     /locus_tag="Caur_0038"
                     /note="Uncharacterized protein family UPF0029; Region:
                     UPF0029; pfam01205"
                     /db_xref="CDD:250442"
     misc_feature    complement(43902..44066)
                     /locus_tag="Caur_0038"
                     /note="Domain of unknown function (DUF1949); Region:
                     DUF1949; pfam09186"
                     /db_xref="CDD:255222"
     gene            complement(44486..45361)
                     /locus_tag="Caur_0039"
                     /db_xref="GeneID:5828216"
     CDS             complement(44486..45361)
                     /locus_tag="Caur_0039"
                     /note="KEGG: rrs:RoseRS_2063 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633683.1"
                     /db_xref="GI:163845639"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="GeneID:5828216"
                     /translation="MRTFISGIPTPKPALFFSRAARDQAVIFDPACAPLLRPVVDRES
                     LQPWYTPTGERWLLTLPHGYSQRLGINSFADLVRHHPGLQRHLREYADDPEPYWWELP
                     AAATAVLTAPTPRICIGDGDQVCLSWDAGQAVVLAPVRMVAPADHLTLALLASTKGKQ
                     MIRQAHDTFTLPPVPTAIGGRLAELAAQAVTMAHERHTLSREFARRLLADFGPPGSTL
                     SPLLERWWELEFRDLLAEVARALRNPIPEPFQPFWLARHTEGRARYYTLTAEIAALEA
                     AIDEIVHPLWPEELP"
     gene            45522..49011
                     /locus_tag="Caur_0040"
                     /pseudo
                     /db_xref="GeneID:5828217"
     gene            49439..50515
                     /locus_tag="Caur_0041"
                     /db_xref="GeneID:5828218"
     CDS             49439..50515
                     /locus_tag="Caur_0041"
                     /EC_number="1.1.1.85"
                     /note="catalyzes the oxidation of 3-isopropylmalate to
                     3-carboxy-4-methyl-2-oxopentanoate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="YP_001633684.1"
                     /db_xref="GI:163845640"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="GeneID:5828218"
                     /translation="MQAVIAVLPGDGIGPEVVAEGVKVLQAIARRFGHQFTFHEALIG
                     GCAIDATGEPLPAATITLCQSADAVLLGAVGGPKWDDPQARVRPEQGLLGIRKALGLF
                     ANLRPVRIYPQLINASPIRPERLQGVDLIVVRELTGGIYFGEKRRERTADGEWASDLC
                     IYTEEEIVRVVRVAARLARQRRGKVTLVDKANVLETSRLWRSITTRLMQTEFPDLQFE
                     TMLVDACAMHLIRRPADFDVIVTENMFGDILTDEASMLAGSMGMLPSASLADGRLGLY
                     EPIHGSAPDIAGQGKANPLATILSVAMLLRYSLDLPAEADCVEAAVASVIERGIVTAD
                     IAVPGQAAYSTAAVGDAVVAAIAA"
     misc_feature    49439..50473
                     /locus_tag="Caur_0041"
                     /note="3-isopropylmalate dehydrogenase; Provisional;
                     Region: PRK00772"
                     /db_xref="CDD:234832"
     gene            50585..50992
                     /locus_tag="Caur_0042"
                     /db_xref="GeneID:5828219"
     CDS             50585..50992
                     /locus_tag="Caur_0042"
                     /note="PFAM: cobalamin B12-binding domain protein;
                     KEGG: rca:Rcas_2998 cobalamin B12-binding domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin B12-binding domain-containing protein"
                     /protein_id="YP_001633685.1"
                     /db_xref="GI:163845641"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006159"
                     /db_xref="GeneID:5828219"
                     /translation="MERKIRVLVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLQQTP
                     QMIVEAALQEDVDVIGLSILSGAHMTLLPKVMQLLREQGMTDVLVVAGGIISDEDAEI
                     LKREHGIAEVFGPGSSTQAIIDFIRSHVELTRG"
     misc_feature    50600..50965
                     /locus_tag="Caur_0042"
                     /note="methylmalonyl CoA mutase B12 binding domain. This
                     domain binds to B12 (adenosylcobamide), which initiates
                     the conversion of succinyl CoA and methylmalonyl CoA by
                     forming an adenosyl radical, which then undergoes a
                     rearrangement exchanging a hydrogen atom...; Region:
                     MM_CoA_mut_B12_BD; cd02071"
                     /db_xref="CDD:239022"
     misc_feature    order(50624..50644,50651..50653,50762..50770,50774..50782,
                     50864..50866,50921..50923,50930..50932,50948..50950)
                     /locus_tag="Caur_0042"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239022"
     misc_feature    50633..50635
                     /locus_tag="Caur_0042"
                     /note="cobalt ligand [ion binding]; other site"
                     /db_xref="CDD:239022"
     gene            50996..51946
                     /locus_tag="Caur_0043"
                     /db_xref="GeneID:5828220"
     CDS             50996..51946
                     /locus_tag="Caur_0043"
                     /note="TIGRFAM: LAO/AO transport system ATPase;
                     PFAM: ArgK protein;
                     SMART: AAA ATPase;
                     KEGG: rrs:RoseRS_2025 LAO/AO transport system ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="LAO/AO transport system ATPase"
                     /protein_id="YP_001633686.1"
                     /db_xref="GI:163845642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005129"
                     /db_xref="GeneID:5828220"
                     /translation="MSEHELVTRLRNGERRALARAISLVEQGGPTARALLAAAYPYGS
                     AHRVGITGPPGAGKSTLVTALAQEWRKRGVPVGIVAVDPSSPFSGGAVLGDRIRMQAL
                     GGDPGVFIRSMASRGRMGGLARATADAVTLIAAAGFPVILIETVGAGQDEVDIAQAAD
                     TTIVVEVPGMGDDVQSIKAGMLEIADVFVVNKADRPGVDQTVRQLRTMLNLGAPPVDG
                     WMPPVLTAIATTGEGCAQIVDAVEQHRQHLIASNSQSQRALSAAERELTAAVQELVLE
                     RLRGSRWSELVQQIAARQRDPYAAANELLTADVIVRDGEE"
     misc_feature    50996..51916
                     /locus_tag="Caur_0043"
                     /note="Putative periplasmic protein kinase ArgK and
                     related GTPases of G3E family [Amino acid transport and
                     metabolism]; Region: ArgK; COG1703"
                     /db_xref="CDD:224617"
     misc_feature    51023..>51241
                     /locus_tag="Caur_0043"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:266541"
     misc_feature    51134..51577
                     /locus_tag="Caur_0043"
                     /note="The function of this protein family is unkown. The
                     protein sequences are similar to the ArgK protein in E.
                     coli. ArgK protein is a membrane ATPase which is required
                     for transporting arginine, ornithine and lysine into the
                     cells by the arginine and...; Region: ArgK-like; cd03114"
                     /db_xref="CDD:239388"
     misc_feature    51149..51175
                     /locus_tag="Caur_0043"
                     /note="Walker A; other site"
                     /db_xref="CDD:239388"
     gene            52177..53520
                     /locus_tag="Caur_0044"
                     /db_xref="GeneID:5828221"
     CDS             52177..53520
                     /locus_tag="Caur_0044"
                     /EC_number="5.4.2.8"
                     /note="PFAM: phosphoglucomutase/phosphomannomutase ;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain I; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain II;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain III;
                     KEGG: rca:Rcas_1218 phosphomannomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="YP_001633687.1"
                     /db_xref="GI:163845643"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="GeneID:5828221"
                     /translation="MQVNPTIFKAYDIRGIYPTELNEEVAYLIGRAFVTFLGAETVIV
                     GRDMRTSGPALFDAVTRGIMDQGADVADIGMVSTDQYYFACTQLGFPGMMVTASHNPK
                     QYNGFKMVRRMPYLLSGDEGIQDLRRLVESEAFPTPTRRGQRREYDFKEQFVQKVLSL
                     IDVDAIKPLKVIVDTGNGMVGPILQEVYARLPIQLTGMYLDPDGTLPNHGLDPLMPEN
                     RAELQQRVKDEGADIGFAFDGDGDRFFAIDDRGEFISGDFLTAILGRYLLEKEPGAKI
                     LYDVRASWAVPDEVRAAGGVPLVERVGHAFIKRRMANEDAIFAGEVSGHYYFKAFAFA
                     DSGIIPSLYLLEMLSKRGVKMSELLGRLESRYFISGEINSRVSDVAAKLNEIAERYSD
                     GKIERIDGVSVSYDTWHFNVRGSNTEPLIRLNLESIASREEMEAKRDEVLAVIRS"
     misc_feature    52195..53511
                     /locus_tag="Caur_0044"
                     /note="The phosphomannomutase/phosphoglucomutase (PMM/PGM)
                     bifunctional enzyme catalyzes the reversible conversion of
                     1-phospho to 6-phospho-sugars (e.g. between
                     mannose-1-phosphate and mannose-6-phosphate or
                     glucose-1-phosphate and glucose-6-phosphate) via a...;
                     Region: PMM_PGM; cd03089"
                     /db_xref="CDD:100091"
     misc_feature    52198..53517
                     /locus_tag="Caur_0044"
                     /note="phosphomannomutase/phosphoglucomutase; Reviewed;
                     Region: manB; PRK09542"
                     /db_xref="CDD:236557"
     misc_feature    order(52201..52203,52207..52209,52216..52218,52468..52476,
                     52498..52500,52888..52890,52894..52896,52900..52905,
                     53017..53019,53080..53088,53137..53139,53143..53145,
                     53149..53151,53413..53415,53419..53427)
                     /locus_tag="Caur_0044"
                     /note="active site"
                     /db_xref="CDD:100091"
     misc_feature    order(52207..52209,52216..52218,52468..52470,52903..52905,
                     53017..53019,53080..53082,53086..53088,53137..53139,
                     53143..53145,53149..53151,53413..53415,53419..53427)
                     /locus_tag="Caur_0044"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100091"
     misc_feature    order(52468..52470,52888..52890,52894..52896,52900..52902)
                     /locus_tag="Caur_0044"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100091"
     gene            53777..54850
                     /locus_tag="Caur_0045"
                     /db_xref="GeneID:5828222"
     CDS             53777..54850
                     /locus_tag="Caur_0045"
                     /note="KEGG: rrs:RoseRS_2617 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633688.1"
                     /db_xref="GI:163845644"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="GeneID:5828222"
                     /translation="MSVKKIGILVGREWSWPPAYIEEVNRRNAGVRAEFIKLGGTRMA
                     EFCDYDVIIDRISHEIPYYRTFLKTAALSGTRIVNNPFWWSADDKFFGASLATALGIP
                     HPRTVALPSHSYIEGIVEESLRNLQYPIPWKEHVDYVGGFPVILKPAWGGGFKKVYKV
                     HSYEELWRAYNETGIECMMLQEYIAWEKYVRCIVIGRRHIMTIKFDANAPWPHRYFRD
                     DNYLTPEEGLQVVEGALKLNQALGYDMNTVEFAIRNGVAYAIDFTNPAPDFDVNSLTP
                     HYFDWVVRTMADFTIELALQGRAKPEEFAWHRLLNGPMAPATSPSAPVTTDSANNDPP
                     AAEASATPKRRRTTRKKTAEEPS"
     misc_feature    54032..54508
                     /locus_tag="Caur_0045"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            54907..56289
                     /locus_tag="Caur_0046"
                     /db_xref="GeneID:5828223"
     CDS             54907..56289
                     /locus_tag="Caur_0046"
                     /note="PFAM: protein of unknown function DUF407;
                     KEGG: rrs:RoseRS_2616 protein of unknown function DUF407"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633689.1"
                     /db_xref="GI:163845645"
                     /db_xref="InterPro:IPR007302"
                     /db_xref="GeneID:5828223"
                     /translation="MTLAQAIADYHALLEPTLAVESWQRLTAEMRARRLYFGERPLAT
                     VLRPRLITASQYELLRRGTQQVAEAARAIVAAALDSSEAGQAVREVLMLTPLEERLIE
                     MHPGYLEPSAHSRMDTFLTVDGSSLQFVEYNAESPAAIAYEDLLAQAFLAMPVMQEFA
                     KRYPILPLPARQYLLRTLLDCWRAAGSPGHEPQVAIVDWHGVPTATEFEMFRQYFVEH
                     GLPAVICAPQDLSFRDGQLLAPTPDGGEMPVTIVFKRVLTSEFLTHYGEEALSHPLVQ
                     AYAAGACVIVNSFRAKLLHKKSLFALLSDERFHDPLSADQRAAVAAHVPWTRVVRPGT
                     TTYQGEQIDLLSFARANRERLLLKPNDEYGGKGITIGWEVSADEWDAALQAALSSPFV
                     VQERVTIAYEPYPALIDGKVVIGERLVDSDPFLFGTEVNGCLCRLSTVTLLNVTAGGG
                     STVPVFIIDE"
     misc_feature    54913..56286
                     /locus_tag="Caur_0046"
                     /note="Circularly permuted ATP-grasp type 2; Region:
                     CP_ATPgrasp_2; pfam14403"
                     /db_xref="CDD:206571"
     gene            56310..57092
                     /locus_tag="Caur_0047"
                     /db_xref="GeneID:5828224"
     CDS             56310..57092
                     /locus_tag="Caur_0047"
                     /note="PFAM: periplasmic binding protein;
                     KEGG: rca:Rcas_2937 periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein"
                     /protein_id="YP_001633690.1"
                     /db_xref="GI:163845646"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:5828224"
                     /translation="MLVYDALGREIELAGTPQRIVSLVPSVTEWLFSVGAGERVIGIT
                     DYCIEPAAALQHLPRLRGTKNPDRAAIIALQPDLIIAEQEENRERDVQALTAAGLAVY
                     VTAIRSVADAMTQLAALAEVLDVTDGAAPITQAIEQTVTAPPPPSRRVLALIWRDPWM
                     AIGRDTYAGDLLRLSGGFNVAATLPGRYPRAALADFLALDPDIILLPNEPYPFSERDL
                     PAFNAVAYRGRIVLCDGMALTWPGPRTATAITTFRRILEQTT"
     misc_feature    56322..57056
                     /locus_tag="Caur_0047"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    56361..57056
                     /locus_tag="Caur_0047"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(56583..56588,56595..56597,56670..56672)
                     /locus_tag="Caur_0047"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            57089..57967
                     /locus_tag="Caur_0048"
                     /db_xref="GeneID:5828225"
     CDS             57089..57967
                     /locus_tag="Caur_0048"
                     /note="PFAM: protein of unknown function DUF547;
                     KEGG: gur:Gura_3347 protein of unknown function DUF547"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633691.1"
                     /db_xref="GI:163845647"
                     /db_xref="InterPro:IPR006869"
                     /db_xref="GeneID:5828225"
                     /translation="MNPFIRLREAVIDTVLSINEQQVLNAGTGTVPAPTDDGVALAAA
                     LRQAMQQFKAQAMDEEGKLVAYQRLRNDPAYLAYRSELTPQLQRFDPASLPDRATRLA
                     FWINLYNALVIDAVIAFGITTSVADQWSGLRFFRAAAYQIGGLRCSLDDIEHGILRAN
                     RGHPFIPGPQFAASDPRLGWIIDPPDPRIHFALNCASLSCPPIGVYRAEQIDQQLDLA
                     LRAFVAADVAIDPTRAEIHLSRIFDWYREDFGGTDGIIQLLRQALPADERRAWLLQAR
                     QARLIYRPYDWRLNLA"
     misc_feature    57350..57757
                     /locus_tag="Caur_0048"
                     /note="Protein of unknown function, DUF547; Region:
                     DUF547; pfam04784"
                     /db_xref="CDD:252798"
     gene            57978..58508
                     /locus_tag="Caur_0049"
                     /db_xref="GeneID:5828226"
     CDS             57978..58508
                     /locus_tag="Caur_0049"
                     /note="KEGG: gur:Gura_0093 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633692.1"
                     /db_xref="GI:163845648"
                     /db_xref="GeneID:5828226"
                     /translation="MTDDWRKQSLKELYRLTGQIFSQIPALARLWGSAYRALNFDEIP
                     FTPFRKPLHEARLALITTGGVHLRDQPPFDMADPRGDPTYRRIPATTPLSDLTITHDY
                     YDHSDAERDLNILFPLDLVRTLVQRGIIGSLADCYGFMGHIEPPHLTTLLQQTAPEVA
                     TFLKQEQVDAVLLTPA"
     misc_feature    <58092..58499
                     /locus_tag="Caur_0049"
                     /note="Glycine/sarcosine/betaine reductase selenoprotein B
                     (GRDB); Region: GRDB; cl19416"
                     /db_xref="CDD:267769"
     gene            58527..58823
                     /locus_tag="Caur_0050"
                     /db_xref="GeneID:5828227"
     CDS             58527..58823
                     /locus_tag="Caur_0050"
                     /note="KEGG: bbr:BB4888 putative reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative reductase"
                     /protein_id="YP_001633693.1"
                     /db_xref="GI:163845649"
                     /db_xref="GeneID:5828227"
                     /translation="MGLIARIIEAAGISTVCIVSLKPIAEQVRPPRTLHLAWPFGHPL
                     GEPGNRAQQLSVLHAALQALATAEPGAIIEPGWRWRREIYTPPPDWLGEGKERL"
     gene            58908..59567
                     /locus_tag="Caur_0051"
                     /db_xref="GeneID:5828228"
     CDS             58908..59567
                     /locus_tag="Caur_0051"
                     /note="KEGG: rca:Rcas_2036 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633694.1"
                     /db_xref="GI:163845650"
                     /db_xref="GeneID:5828228"
                     /translation="MVNKDHPLSIGRTIRHAIFFNARNWQSGRPIMDELLQSVNELFA
                     MLTERNVRYTLVGGIAMLQYIQGRNTEDIDIVISITSLRKLPEVTITQKDIFFARGMY
                     RQLQIDFLLTKNPLFAHIQKHHVVELPFAERTIPTATVRGLILLKLYALPSLYRQGDF
                     ARVGLYENDIATLMFAYAPPIDDILHELSAFISQPDRDIAQGIVHNLEQRILRFKALR
                     G"
     gene            60158..61117
                     /locus_tag="Caur_0052"
                     /db_xref="GeneID:5828189"
     CDS             60158..61117
                     /locus_tag="Caur_0052"
                     /note="KEGG: rrs:RoseRS_2582 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633695.1"
                     /db_xref="GI:163845651"
                     /db_xref="GeneID:5828189"
                     /translation="MEGTTNPTTAPTAQLAPAEAIDPRPLDTAGMEECSIISDSDLES
                     IVNSVPIYSQPTYAEYGTLGCTYTFEGDKDVSIRIELDSPGRQVYDSVMQYVDVSADA
                     EPVNIGDIAVIKEKDGLVSLDAVLNGWYVSLSTRGFPRASALTLAQWLTGRLIPRPDD
                     IVAEQPTATAPGPVSGSLIDMQVTIESPAEAAGVTTLAEIKAIGFMGFSMCSRPYNVP
                     FIVAFNAPPGTQPPTPVGVFSITAEAGVTPGQPSPATIIIGIGPSDAAEETLWQGTIV
                     VAADGTSGTFEVPGQVKVPGRACLRRERGTTISVILVWRGIEA"
     gene            complement(61181..62830)
                     /locus_tag="Caur_0053"
                     /db_xref="GeneID:5828190"
     CDS             complement(61181..62830)
                     /locus_tag="Caur_0053"
                     /note="PFAM: Methionine biosynthesis MetW protein;
                     Methyltransferase type 11; Methyltransferase type 12;
                     KEGG: vha:VIBHAR_01393 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_001633696.1"
                     /db_xref="GI:163845652"
                     /db_xref="InterPro:IPR010743"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:5828190"
                     /translation="MADAETIRSYDQLAREQAAFQRHLQPTAIYRLVETFFHPGRPTI
                     DIGSGSGRDVAWLNQHGYQAIGLEPSAGMIAEARAAYAGIEIRQGALPDLAGIADASF
                     DNVLCVAVLMHLPAAELIGAVINLARILRPGGRLIVSYRTPPPEGERAHDGRLYTVIP
                     PARLMLLLESSGLQILFSEDLPDPHRPSIRWFNMVAEKSDRDVSRGLERVGSVLAHDR
                     KTATYKLALLRALCIIARNAFNLVEWSSDVVYVLLRAIATQWLIFYWPLLTSSEFIAQ
                     IRGEHPLSPKPIAFRPAITSLAKQLGGAAGLYNVLRILEEDPHRYDDILKLIANTIRK
                     GPVTYSGSIHSPIFSYRPGKSDTFGWVAVPIDIWLDICRFNHWIEDSIVLRWAYLTDE
                     LNRTADPGRYLSLLVAKPLHERDTQEVRQALNRSPELFCVWTGQRLGHGYEVDHVIPY
                     SVWGNNDLWNLLPAHPRINQTKRDALPARSILLARREAIIDYWQRYAQIDVFQPRFAV
                     QIHRALGCNLRHADWPKLAFAGLEEVVERTAIVRGLPRWSP"
     misc_feature    complement(62114..62830)
                     /locus_tag="Caur_0053"
                     /note="SAM-dependent methyltransferases [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: SmtA; COG0500"
                     /db_xref="CDD:223574"
     misc_feature    complement(62411..62701)
                     /locus_tag="Caur_0053"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(62507..62509,62558..62566,62624..62629,
                     62675..62695))
                     /locus_tag="Caur_0053"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    complement(61415..61582)
                     /locus_tag="Caur_0053"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(61424..61426,61433..61438,61448..61453,
                     61484..61486,61490..61498,61502..61504))
                     /locus_tag="Caur_0053"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            complement(62849..64306)
                     /locus_tag="Caur_0054"
                     /db_xref="GeneID:5828191"
     CDS             complement(62849..64306)
                     /locus_tag="Caur_0054"
                     /note="PFAM: glycoside hydrolase family 57; Domain of
                     unknown function DUF1957;
                     KEGG: rrs:RoseRS_3734 glycoside hydrolase, family 57"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633697.1"
                     /db_xref="GI:163845653"
                     /db_xref="InterPro:IPR004300"
                     /db_xref="InterPro:IPR015293"
                     /db_xref="GeneID:5828191"
                     /translation="MPIAFVIEVHVPYLRHPGRQPIGEERLHAFTAHTLIPLLDLIGE
                     LQRHSLPLSITLACSPIALEQWRDPVVHKHFVQWLEGRITHHQNELSRFEHEGNQHGA
                     YLARFYLDWDRQLLRSFTIRYQRNPLGRLQELVAAGLITPLCVPASYAILPFLGHEGM
                     VRAQLEHGLLYISRYLKRPEGLWLPGSAWRDGLERIILELDLRYVIVDPSNVQLQHGH
                     LPGWLVPRRLAAIGVEADLARHIWSVELGYPGDPLYRNPADPTGYTANGADAPQPYDP
                     YDALRRAQEHANHFVDQLLFRLSQLPSETTLVVPIDARLWSRNWFEGPTWLQAVLTRC
                     ATDPRLRLTQPGSLLHHLSSNDTVVLQATAQADASATSWQSPFTDHYRQSLYEAERRF
                     AELVTYYPAAEGLRERVLTQAARELLLAEMSDWLMESDPGWQRYLDRFDHLLLLARQE
                     SLSATDLFALEQIESHDSIFPVLNYRLFGEKHHRS"
     misc_feature    complement(62873..64300)
                     /locus_tag="Caur_0054"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1543"
                     /db_xref="CDD:224460"
     misc_feature    complement(63233..64300)
                     /locus_tag="Caur_0054"
                     /note="Catalytic domain of glycoside hydrolase (GH)
                     families 38 and 57, lactam utilization protein LamB/YcsF
                     family proteins, YdjC-family proteins, and similar
                     proteins; Region: GH38-57_N_LamB_YdjC_SF; cl17191"
                     /db_xref="CDD:266542"
     misc_feature    complement(62873..63154)
                     /locus_tag="Caur_0054"
                     /note="Domain of unknown function (DUF1957); Region:
                     DUF1957; pfam09210"
                     /db_xref="CDD:204166"
     gene            complement(64394..66088)
                     /locus_tag="Caur_0055"
                     /db_xref="GeneID:5828192"
     CDS             complement(64394..66088)
                     /locus_tag="Caur_0055"
                     /note="PFAM: protein kinase;
                     SMART: tyrosine protein kinase; serine/threonine protein
                     kinase;
                     KEGG: rca:Rcas_1479 serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="YP_001633698.1"
                     /db_xref="GI:163845654"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000976"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="GeneID:5828192"
                     /translation="MTGGSGRRIGRYELIEELGRGGMARVYRARDTQLQRIVALKVLA
                     AQLSMDAEFIKRFEREARTAANLRHPHIVTVYDIGEDQGLHYIAMEYIDGRPLHAILE
                     QYGSLGLKYAIAILEPIALALDYAHQAGAVHRDVKPHNILIDRNGRVVLTDFGIAQTP
                     EADEQRLTRTGVFMGTPEYISPEQAEARRVDGRSDLYSLAVVAYEIIAGRVPFSGATP
                     QLIVAHAQLPPPPITSFAPDLPTDLDLVLTRALAKRPERRFQTGAAFIAALRDIAERN
                     GIVPATTAELVALLNPSLQVESTIPGLVQSSATPKPVAPPLLSSTPTASRQPKQPDGL
                     AVNQDQRATPLPPAPVIPRRHLPEPAVAEPKPRNNRSDQWPFFIIGGLLFIIVGALVV
                     LIMRNFDDSDAPTPTPIVPAGPSPTLAVPLPTATATFTAVPTLTPTLTPSVEPTPTPV
                     LPTPVPPTSPPPPPPPPPPSPTPTVTATPTETVTPTVSLTPTEPATPTETATPTETAT
                     PTETATPTETTTPTVSPTPTETATPTVSPTPTETTTPTVSPTPTETATPTVSPTPT"
     misc_feature    complement(65312..66055)
                     /locus_tag="Caur_0055"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(65471..66037)
                     /locus_tag="Caur_0055"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(65555..65566,65621..65623,65630..65632,
                     65663..65665,65669..65674,65678..65680,65684..65686,
                     65795..65797,65801..65803,65813..65824,65870..65872,
                     65966..65968,65972..65974,66011..66013,66023..66037))
                     /locus_tag="Caur_0055"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(65630..65632,65663..65665,65669..65674,
                     65678..65680,65684..65686,65801..65803,65813..65824,
                     65870..65872,65966..65968,65972..65974,66011..66013,
                     66023..66037))
                     /locus_tag="Caur_0055"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(65555..65566,65621..65623,65672..65674,
                     65678..65680,65684..65686,65795..65797,65801..65803,
                     66023..66025))
                     /locus_tag="Caur_0055"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(65555..65566,65615..65635))
                     /locus_tag="Caur_0055"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            66229..66888
                     /locus_tag="Caur_0056"
                     /db_xref="GeneID:5828193"
     CDS             66229..66888
                     /locus_tag="Caur_0056"
                     /note="PFAM: Forkhead-associated protein; transcriptional
                     regulator domain protein;
                     KEGG: rca:Rcas_1480 putative two component transcriptional
                     regulator, winged helix family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator domain-containing
                     protein"
                     /protein_id="YP_001633699.1"
                     /db_xref="GI:163845655"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5828193"
                     /translation="MQSAPAPQLIVKRSNGDYREIVWDQPVITVGRDGANDIIIDHPL
                     ASRRHARFERTDEGFFIRDLDSTNGTFLNQERLIGTRSLHHSDQIMIADTVIIFNDPA
                     ATMKGTLDPTLLRAVRAEIRVDEPTKSVYIRGELLSPPLTVKEFQLLALLYRRQGEVV
                     SKEEIANQVWDYAIFDYNAIDALVYRLRQRIEPDPSKPRYLITQRGFGYKLIVAPELE
                     S"
     misc_feature    <66238..66516
                     /locus_tag="Caur_0056"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    66298..66522
                     /locus_tag="Caur_0056"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    order(66322..66324,66358..66360,66364..66369,66427..66435)
                     /locus_tag="Caur_0056"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     misc_feature    <66577..66861
                     /locus_tag="Caur_0056"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    66586..66861
                     /locus_tag="Caur_0056"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(66652..66654,66709..66714,66763..66765,66772..66774,
                     66796..66801,66835..66837,66850..66852)
                     /locus_tag="Caur_0056"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            66922..68229
                     /locus_tag="Caur_0057"
                     /db_xref="GeneID:5828194"
     CDS             66922..68229
                     /locus_tag="Caur_0057"
                     /note="catalyzes the formation of
                     5-O-(1-carboxyvinyl)-3-phosphoshikimate from
                     phosphoenolpyruvate and 3-phosphoshikimate in tryptophan
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="YP_001633700.1"
                     /db_xref="GI:163845656"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="GeneID:5828194"
                     /translation="MKGITLTAPKRLRGVIEVPGDKSISHRSVLFNAIATGSAHITHF
                     LPGADCLSTVACIRALGVTVEQPAERELIVHGVGLGGLREPADVLDCGNSGTTLRLLA
                     GLLAGHPFFSVLTGDASLRSRPQRRIVVPLRAMGAQIDGRDDGDRAPLAIRGNRLRGG
                     HYELSIASAQVKSALLLAALNAEQPLTLTGRIDSRDHTERMLAAMGLEITVTADQITI
                     QPPSEATAPTALSLRVPGDPSSAAFWWVAAAIHPDAELVTPGVCLNPTRIGAIEVLQA
                     MGADLTVMNERLEGSEPVGDVVVRSSSLRGTTIAGTLIPRLIDEIPVLAVAAACASGE
                     TVIRDAQELRAKETDRIATVAAGLSAMGAVVEPTADGMVIVGQPGQLQGTTLNSFHDH
                     RLAMAWAIAAMVARGETTILEPAAAAVSYPEFWQTLAMVQEAA"
     misc_feature    66922..68214
                     /locus_tag="Caur_0057"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase;
                     Provisional; Region: PRK02427"
                     /db_xref="CDD:235037"
     misc_feature    66955..68214
                     /locus_tag="Caur_0057"
                     /note="EPSP synthase domain. 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EC
                     2.5.1.19) catalyses the reaction between
                     shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP)
                     to form...; Region: EPSP_synthase; cd01556"
                     /db_xref="CDD:238797"
     misc_feature    order(66973..66984,67621..67632)
                     /locus_tag="Caur_0057"
                     /note="hinge; other site"
                     /db_xref="CDD:238797"
     misc_feature    order(66985..66990,67000..67002,67198..67200,67204..67209,
                     67288..67290,67423..67431,67492..67494,67501..67503,
                     67876..67878,67945..67947,67957..67962,67969..67971,
                     68095..68100,68176..68178)
                     /locus_tag="Caur_0057"
                     /note="active site"
                     /db_xref="CDD:238797"
     gene            68226..68810
                     /locus_tag="Caur_0058"
                     /db_xref="GeneID:5828195"
     CDS             68226..68810
                     /locus_tag="Caur_0058"
                     /note="KEGG: rca:Rcas_1482 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633701.1"
                     /db_xref="GI:163845657"
                     /db_xref="GeneID:5828195"
                     /translation="MNDGFTFTVEIFTPTLLCTGSYTLPMYRRVSDALNNRLSRFVNL
                     HDVSIAPLWRPQQAQRVQHALVAWGDALLVAVLAEPEPPPDYHPVAPPRETHPVMFFT
                     AEFAVRAEMYKRPDMDLEEMLSGLTDDFIPLRNVTIFPINGGAPLHRSFVCLAQRAIQ
                     VLYSVRGHTPADHHSEPPADTTATVPESNTNAEA"
     gene            68831..69814
                     /locus_tag="Caur_0059"
                     /db_xref="GeneID:5828196"
     CDS             68831..69814
                     /locus_tag="Caur_0059"
                     /note="TIGRFAM: UDP-glucose 4-epimerase;
                     PFAM: NAD-dependent epimerase/dehydratase; short-chain
                     dehydrogenase/reductase SDR; 3-beta hydroxysteroid
                     dehydrogenase/isomerase; polysaccharide biosynthesis
                     protein CapD; dTDP-4-dehydrorhamnose reductase;
                     KEGG: rca:Rcas_2654 UDP-glucose 4-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="YP_001633702.1"
                     /db_xref="GI:163845658"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="GeneID:5828196"
                     /translation="MRILVTGGAGYIGSITSAELIRAGHEVIVIDNLYQGHRAAVPPE
                     ATFIQADLANRQELSEIFAAYPGIDGIMHFASYTLVGESMEKPMLYLRDNVTNAGNLL
                     EVAIAAGVRRFILSSTANLFDQPERIPIAEHERIVPGSPYGESKFFIERMLHWMARIY
                     GMRYACLRYFNACGDTPERGEDHDPETHLIPIVLQVALGQRPHVTIFGDDYPTRDGTC
                     VRDYIHVLDLASAHILAMEALDRLGERRYNLGNGQGFTVREVIETARKVTGHPIPAVV
                     GPRRPGDPAVLVASSETIRAELGWQPRFPDLESIIASAWEWHRTHPHGYDD"
     misc_feature    68831..69805
                     /locus_tag="Caur_0059"
                     /note="UDP-glucose 4-epimerase [Cell envelope biogenesis,
                     outer membrane]; Region: GalE; COG1087"
                     /db_xref="CDD:224012"
     misc_feature    68834..69787
                     /locus_tag="Caur_0059"
                     /note="UDP-glucose 4 epimerase, subgroup 1, extended (e)
                     SDRs; Region: UDP_G4E_1_SDR_e; cd05247"
                     /db_xref="CDD:187558"
     misc_feature    order(68849..68851,68855..68866,68921..68938,68978..68986,
                     69050..69058,69062..69064,69107..69109,69176..69184,
                     69254..69256,69266..69268,69335..69340,69344..69346)
                     /locus_tag="Caur_0059"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187558"
     misc_feature    order(69080..69082,69086..69094,69101..69106,69113..69118,
                     69125..69130,69134..69139,69146..69148,69251..69253,
                     69260..69262,69272..69274,69281..69286,69290..69298)
                     /locus_tag="Caur_0059"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187558"
     misc_feature    order(69110..69112,69182..69184,69254..69256,69266..69268)
                     /locus_tag="Caur_0059"
                     /note="active site"
                     /db_xref="CDD:187558"
     misc_feature    order(69182..69190,69254..69256,69335..69343,69389..69397,
                     69440..69451,69482..69484,69488..69490,69494..69496,
                     69599..69601,69668..69670,69677..69679)
                     /locus_tag="Caur_0059"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187558"
     gene            69804..71756
                     /locus_tag="Caur_0060"
                     /db_xref="GeneID:5828197"
     CDS             69804..71756
                     /locus_tag="Caur_0060"
                     /note="PFAM: protein kinase;
                     SMART: tyrosine protein kinase; serine/threonine protein
                     kinase;
                     KEGG: rca:Rcas_4117 serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="YP_001633703.1"
                     /db_xref="GI:163845659"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="GeneID:5828197"
                     /translation="MTTNPVSVPSLPRFYGHYEVEQQIGRGESSRVFRAHHRQIKEHK
                     VALKVLLSQEAARIKRFEQEAQIAARLRHPHISRLLDYGIQNPFHYAVFEYIPGSSLR
                     DLIKGHDQRLPPDQVMAYFQQIADALDYAHSLDIIHRDLSPGNILIDTENHKAYLIDF
                     GIARNPDQSLTSTNVTMGTPGFIAPECMHSATNATHLSDIFSLGVILFLMLTGEKPWY
                     EMPQPGSSLDPFLRIRTLADTGVKLPSEVDRIIRVMLAFEPAHRYTSAGAAAIDFVAV
                     MQRHLSVTQIQSSEPVKVDQTATRRKHIVLIEPNEVELALSGSLFREPLERALMRARQ
                     LDETTIKSLIEQWAKRQRFYQPHLGRIAQIQDTKHHNVFFFQLRLLIEQRLDAGTEEE
                     PDSQQKQIPPQRELERWQVELPPPKDFQKHPGGRVIVPGSERVVTCPSCKGHGVHICA
                     MCKGSRRVTVTDQAATTTENAADSSSVARQRVVPCPECQGRGSLPCKRCDSFTRVIQR
                     KLIEWSRWPVEDQAHTDLPDVDEMWLRRTCKAELVYKKRVDRIPKEWLEITEIKEILE
                     QRRKNLNNDSRIVLAELQIHFIPLTEVTLDLGKQGPGERLAIYGFEHNIPPDWRFLHW
                     ERIICLSVIALLSIFLMISLAFIING"
     misc_feature    69855..70625
                     /locus_tag="Caur_0060"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    69873..70595
                     /locus_tag="Caur_0060"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    order(69873..69887,69897..69899,69939..69941,69945..69947,
                     70032..70034,70080..70091,70101..70103,70107..70109,
                     70221..70223,70227..70229,70233..70238,70242..70244,
                     70278..70280,70287..70289,70335..70346)
                     /locus_tag="Caur_0060"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(69873..69887,69897..69899,69939..69941,69945..69947,
                     70032..70034,70080..70091,70101..70103,70221..70223,
                     70227..70229,70233..70238,70242..70244,70278..70280)
                     /locus_tag="Caur_0060"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(69885..69887,70101..70103,70107..70109,70221..70223,
                     70227..70229,70233..70235,70287..70289,70335..70346)
                     /locus_tag="Caur_0060"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(70275..70295,70335..70346)
                     /locus_tag="Caur_0060"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    71115..71300
                     /locus_tag="Caur_0060"
                     /note="Zinc finger domain of DnaJ and HSP40; Region:
                     DnaJ_zf; cd10719"
                     /db_xref="CDD:199908"
     misc_feature    order(71115..71117,71124..71126,71148..71150,71157..71159,
                     71256..71258,71265..71267,71289..71291,71298..71300)
                     /locus_tag="Caur_0060"
                     /note="Zn binding sites [ion binding]; other site"
                     /db_xref="CDD:199908"
     gene            72070..73017
                     /locus_tag="Caur_0061"
                     /db_xref="GeneID:5828198"
     CDS             72070..73017
                     /locus_tag="Caur_0061"
                     /note="PFAM: ATPase associated with various cellular
                     activities AAA_3; ATPase associated with various cellular
                     activities AAA_5;
                     SMART: AAA ATPase;
                     KEGG: rrs:RoseRS_1835 ATPase associated with various
                     cellular activities, AAA_3"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_001633704.1"
                     /db_xref="GI:163845660"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011703"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:5828198"
                     /translation="MQTAQLASALLNEARKTLVGQEENLTLLLTALLSGGHVLLEGPP
                     GTAKTLMAKTLAQMIQADFRRIQFTPDLMPADVIGIQVFDMKSGEFRLYRGPIFTQIL
                     LGDEINRAPAKTQSALLEAMEERQVTIEGQRLPLPEPFFVIATQNPIEYDGTYPLPEA
                     QLDRFLFKIVIGYASRDVETEVLRRYHLGFDAHQLTASGLRPIVSPEALATCRAEITQ
                     VQVEQGILDYIVSIIQATRNSPELLVGASLRAGVAMLLAAKTLAAIHDRNYVTPDDVK
                     LLARPVLRHRIILRPEAEIEGLNPDMAINRILNRIEVPR"
     misc_feature    72070..73014
                     /locus_tag="Caur_0061"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    72169..72588
                     /locus_tag="Caur_0061"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    72193..72216
                     /locus_tag="Caur_0061"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(72196..72219,72382..72384,72508..72510)
                     /locus_tag="Caur_0061"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    72370..72387
                     /locus_tag="Caur_0061"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    72559..72561
                     /locus_tag="Caur_0061"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            73019..75568
                     /locus_tag="Caur_0062"
                     /db_xref="GeneID:5828199"
     CDS             73019..75568
                     /locus_tag="Caur_0062"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: rca:Rcas_1858 protein of unknown function DUF214"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633705.1"
                     /db_xref="GI:163845661"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="GeneID:5828199"
                     /translation="MLSRMLVRSSLRWIRQHPWQMLLCIIGVALGVAVVVAIDLANAS
                     ARRAFQLAGDTVAGQATHQIVGGPTGLPETVYPTIRRQFPTLAAAPVVEGYLTAPALG
                     PGVYQLFGVDPFAEAPFRPYLAGNGAVDLAALLVEPGAALLARTTSEQAGLQPGDQLP
                     VQIGARQTALRIVGVLDPADDLSRRSLAGLVIVDISSAQELLDNTGRLSRIDLIVPEA
                     FDLAALTAQLPAGVTVQPVAARAGTLQQMTAAFELNLTALSLLALIVGMFLIYNTMTF
                     SVVQRRGLWGTLRCVGVSRGQLAGMVLIEAFIISLVGVAAGLVLGVVLGRGLVGLVTQ
                     TINDLYFVVTVRDLAIEPLVLIKGTALGIIATLLAALAPTLEAMYTPPRTVLRRSSLE
                     ERIRRAIPRLAGGGVGLLLLGGGLLLIPATADTSSLYIAFGGLFAIVIGTALLTPLIL
                     MTLMAVLRPILGRAAGMLGNMAARDVVNSLSRTAVAVAALMVAVSVTIGVGIMIGSFR
                     QTVINWLEQSLIADIYLSPPSNVANRIDTTIDPALPAALASLPEVEAITTFRSVQIDL
                     PTGPTTLVAVGSTTDRGRRALRFQQGGDEATWTAWENGAVLISEPLAFRSGLGVGDTL
                     TVRTDRGLRELPIAGVYYDYTSDRGVVRINEATYRQLWDDTALSSLAIYVREGYEVDA
                     VMERVRAISAAYGTIIVNSSRALREGTLIVFDRTFAITSVLQLLATIVAFIGILSALM
                     ALQLERTRELGVLRAIGLTPGQLWGVVLGQTSLMGLAAGLLAAPLGLALAVVLTYVIN
                     KRSFGWTLEFTLDPTLFVQALAVAIVAALLAGIWPALQMSRTSPAVALRDE"
     sig_peptide     73019..73132
                     /locus_tag="Caur_0062"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.967) with cleavage site probability 0.762 at
                     residue 38"
     misc_feature    <73328..74131
                     /locus_tag="Caur_0062"
                     /note="ABC-type antimicrobial peptide transport system,
                     permease component [Defense mechanisms]; Region: SalY;
                     COG0577"
                     /db_xref="CDD:223650"
     misc_feature    73787..74164
                     /locus_tag="Caur_0062"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     misc_feature    74432..75088
                     /locus_tag="Caur_0062"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    74507..75565
                     /locus_tag="Caur_0062"
                     /note="ABC-type antimicrobial peptide transport system,
                     permease component [Defense mechanisms]; Region: SalY;
                     COG0577"
                     /db_xref="CDD:223650"
     misc_feature    75179..75544
                     /locus_tag="Caur_0062"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            75650..75916
                     /locus_tag="Caur_0063"
                     /db_xref="GeneID:5828200"
     CDS             75650..75916
                     /locus_tag="Caur_0063"
                     /note="PFAM: acyl-coA-binding protein ACBP;
                     KEGG: rrs:RoseRS_0103 acyl-coA-binding protein, ACBP"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA-binding protein"
                     /protein_id="YP_001633706.1"
                     /db_xref="GI:163845662"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="GeneID:5828200"
                     /translation="MSDLQAAFERAAQEVQQLPRRPDNETLLQLYALYKQATVGDVQG
                     SRPGVLDMTGRLKYDAWAKLKGVTAADAMQRYIELVERLKQSLA"
     misc_feature    75659..75913
                     /locus_tag="Caur_0063"
                     /note="Acyl CoA binding protein (ACBP) binds thiol esters
                     of long fatty acids and coenzyme A in a one-to-one binding
                     mode with high specificity and affinity. Acyl-CoAs are
                     important intermediates in fatty lipid synthesis and fatty
                     acid degradation and play a...; Region: ACBP; cl00221"
                     /db_xref="CDD:260274"
     misc_feature    order(75683..75685,75692..75697,75701..75703,75710..75715,
                     75719..75721,75728..75733,75737..75742,75749..75754,
                     75803..75808,75815..75820,75875..75877)
                     /locus_tag="Caur_0063"
                     /note="acyl-CoA binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238248"
     misc_feature    order(75695..75697,75740..75742,75749..75754,75818..75820,
                     75875..75877)
                     /locus_tag="Caur_0063"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:238248"
     gene            complement(76425..76709)
                     /locus_tag="Caur_0064"
                     /db_xref="GeneID:5828201"
     CDS             complement(76425..76709)
                     /locus_tag="Caur_0064"
                     /note="PFAM: RNP-1 like RNA-binding protein;
                     KEGG: mca:MCA1010 RNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNP-1 like RNA-binding protein"
                     /protein_id="YP_001633707.1"
                     /db_xref="GI:163845663"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="GeneID:5828201"
                     /translation="MLVKLFVGNLPWNVGDAELGSIFEPHGEVQSARVINDRDTGRSR
                     GFGFVEIETNNVAAVIRATDGLEVGGRNLRVNEAEDKPRNAPRGGFGRRY"
     misc_feature    complement(76473..76700)
                     /locus_tag="Caur_0064"
                     /note="RNA recognition motif in Helicobacter pylori HP0827
                     protein and similar proteins; Region: RRM_HP0827_like;
                     cd12399"
                     /db_xref="CDD:240845"
     gene            77165..77749
                     /locus_tag="Caur_0065"
                     /db_xref="GeneID:5828202"
     CDS             77165..77749
                     /locus_tag="Caur_0065"
                     /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
                     antioxidant/ Mal allergen; Redoxin domain protein;
                     Contains selenocysteine;
                     KEGG: gvi:glr0029 hypothetical protein"
                     /codon_start=1
                     /transl_except=(pos:77405..77407,aa:Sec)
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="YP_001633708.1"
                     /db_xref="GI:163845664"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:5828202"
                     /translation="MSRPFIPMTAKWRQEFIKPRGPANVPAVGSEAPDFTLPYAQFLS
                     GPPEDRVEYGRTITLSALRGRPVVLNLTRIVSDRFFUPHCAPQLDALREHYDLFVQRN
                     AHLLVVSSTDLEMTSYVAEVLRAPYPILSDPEWGVFYRYGMGSAMGVPLPGVFVIDAD
                     GIIRWSWAAPLSVVFTPPRPAELAAVLDALASEG"
     misc_feature    77246..77662
                     /locus_tag="Caur_0065"
                     /note="AhpC/TSA family; Region: AhpC-TSA; pfam00578"
                     /db_xref="CDD:249974"
     gene            complement(77807..78511)
                     /locus_tag="Caur_0066"
                     /db_xref="GeneID:5828203"
     CDS             complement(77807..78511)
                     /locus_tag="Caur_0066"
                     /note="KEGG: rca:Rcas_1013 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633709.1"
                     /db_xref="GI:163845665"
                     /db_xref="GeneID:5828203"
                     /translation="MWLIAEYEAVSLFSLRPSFTTASGGKTLLAPTPFAIKMAIFDAL
                     CRAQSLDVARSHWPAIARLEVALRPAAQAVVSNVFQRVLRPSRSEAKPNDPDFEGFFQ
                     RTIGYREYVHLFGDFAIGLGWEGSDQRDWLRDALLHITYLGKRGGFVQVLSVPAYNEV
                     LPAEFVSLTRPETNFPLDGTMQVVDDCAPNLSFEKIDVYNPAKKLSKGDRTERHVVLP
                     YRLKRSSKSFSWYERV"
     gene            complement(78514..79503)
                     /locus_tag="Caur_0067"
                     /db_xref="GeneID:5828204"
     CDS             complement(78514..79503)
                     /locus_tag="Caur_0067"
                     /note="TIGRFAM: CRISPR-associated autoregulator DevR
                     family;
                     PFAM: CRISPR-associated regulatory Csa2 family protein;
                     KEGG: rca:Rcas_1012 CRISPR-associated autoregulator, DevR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated autoregulator DevR family
                     protein"
                     /protein_id="YP_001633710.1"
                     /db_xref="GI:163845666"
                     /db_xref="InterPro:IPR002764"
                     /db_xref="InterPro:IPR010154"
                     /db_xref="GeneID:5828204"
                     /translation="MKPVFSLSIAARAVLNLHSLNNEGGEGNQIQTRMVNVFADGRLH
                     SVNAISGDMFKHIQSEHLHRLAVQADLPLSMGARLFNANRINYDLDLDKEFLNQLQTA
                     KSNAGELDLILQRCAVTDMAGALITAGNRSLPRKSVVEFGWVVGVPGSVKTDSYFHVK
                     FESERGGGSAGVDESGSIAGKQTPFHRPASSGVYAIVVQVEAARIGFNDISQRYAVDA
                     DQRRKRLRALLESILYTFIEPAGAMRTAQNPHILDVSGVMTVSSNVIPAPCISPLKDD
                     FVSDVQRVAESLNQLHPDAIELFSFDSLGAFAEQMSRLIQEAEPFTLPAVNGA"
     misc_feature    complement(78661..79476)
                     /locus_tag="Caur_0067"
                     /note="CRISPR-associated negative auto-regulator
                     DevR/Csa2; Region: DevR; pfam01905"
                     /db_xref="CDD:250956"
     gene            complement(79534..81093)
                     /locus_tag="Caur_0068"
                     /db_xref="GeneID:5828205"
     CDS             complement(79534..81093)
                     /locus_tag="Caur_0068"
                     /note="KEGG: rca:Rcas_1011 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633711.1"
                     /db_xref="GI:163845667"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="GeneID:5828205"
                     /translation="MVGVVEDYEQAKADNETYWTWRKSVGGQQPQLHPPVEPHPDWEL
                     FRAINPTALQAANSAAAEWFQGRVAFPALLETVLIYASTLPNDQEGAEKHWAAVCKQH
                     GLHHTKQLSASQVINPTQGKGTANGKAIFAKPGNLSNFWLTEYLKWVGLRWAGFTRLI
                     RDSKDRKIYVLAPNQLDWHDHRGIREEFRRLMVGSGGAIQLDVLAALRYTRAVLDYAA
                     VTQSERLLTQIFGSHQGVNRLVYGLDSAYYKNLGQSAAVMNIARIGLPAWVQPRVRQD
                     IQLYQNMIDEHIRIVRNLDEKRGEDYELLRLYRDFLSTNELTALLAFTDAYSGFVIQR
                     DKLAPQFTVHHLEVIMSSIAPPLSKITQSRGFRNLAYAIRMATVEAHRRNLKRNQGRY
                     DVSYEVRYGLGQELLRKSAYPNEFITALSEFIHDYNAENARMRERLERQGYSQPRGAR
                     SDVSIKDIDELLALMDEYRDPQMIASLLVAYGYASTFQRDETYTPDSDAEEVTEPVSS
                     DGDDDNSPEAE"
     gene            complement(81155..81394)
                     /locus_tag="Caur_0069"
                     /db_xref="GeneID:5828206"
     CDS             complement(81155..81394)
                     /locus_tag="Caur_0069"
                     /note="KEGG: rca:Rcas_1011 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633712.1"
                     /db_xref="GI:163845668"
                     /db_xref="GeneID:5828206"
                     /translation="MNASIYRSKYYVEKRTGTFADNLVAFGLAYVLDGIADSRARVTI
                     ADHGSHFAVICDPPLREDWVKNCQFFYRRFSFSHC"
     gene            complement(81409..83814)
                     /locus_tag="Caur_0070"
                     /db_xref="GeneID:5828207"
     CDS             complement(81409..83814)
                     /locus_tag="Caur_0070"
                     /note="KEGG: rca:Rcas_1010 CRISPR-associated helicase
                     Cas3;
                     TIGRFAM: CRISPR-associated helicase Cas3;
                     PFAM: helicase domain protein; DEAD/DEAH box helicase
                     domain protein;
                     SMART: DEAD-like helicases"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated helicase Cas3"
                     /protein_id="YP_001633713.1"
                     /db_xref="GI:163845669"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006474"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5828207"
                     /translation="MQLYPYQQRVKDIILAGENVVLQAPTGAGKTRAALVPFIEGFFD
                     RPDTTPRKCLYVTPMRVLANQFYAEYRELAARYQRLHGRQLDVRIQTGEQPEDRRFEG
                     DLIFCTVDQFLSSYLMMPYSLPYRLANVNAGALAGAYLVFDEFHLFDPDAALPTILHV
                     LRQLHGLAPFMLMTATFSSAMLQSLATLLQPAQVVTLSAAEIAAINTRGGQPARQRVW
                     QVADQPLQAAAVLAHHQHASLVICNTVRRAREVYAELKQQAPPETEVLLLHSQFLPDD
                     RRQIEAKLRSRLGVSSQRQQANLIVVATQVVEVGVDISVEVLHTELAPPASLIQRAGR
                     CARYPGDTGTVIVYPVETYVPYAFKPDEILKHEMDATLAWLKERQGAVFDFDHEQELV
                     NAVSAARDQNIIAGIQADRHNRRASIQGCLEGQRAGASRLLVRDVDSRLVLIHPDPDQ
                     LLASPYDAVGLNIPLYSLRSMGKDWLQRPTDAPWRVRRLDESDAGDQAESNRPLYRWV
                     DVHDSKELAQSAIIVVHPALAGYSAHEGFSPETGNLPFISTLPPARPLIDRPRSSLYV
                     ETYAEHIQRVLDAFQELVLPELRFAASALECAAGWSPGSVLRAAWLACLFHDVGKLSK
                     GWQQWAHAYQQAIGQPVAKTIALAHTTFDFQNPTHRQAEREVSRSTPRPRHAAEGALA
                     VAQILAGAFNISHEKELVQAILTAIARHHAPFVQDCQAFSLVSEAGNLIQNTLQFLPE
                     EVNYSLNINDLWVNSHHHQQFAELLIKPTSRYGWIAYTLLARALRRADQRGTEMGAGQ
                     TLP"
     misc_feature    complement(82684..83757)
                     /locus_tag="Caur_0070"
                     /note="CRISPR/Cas system-associated protein Cas3; Region:
                     Cas3_I; cd09639"
                     /db_xref="CDD:187770"
     misc_feature    complement(82684..83757)
                     /locus_tag="Caur_0070"
                     /note="CRISPR-associated helicase Cas3; Region: cas3_core;
                     TIGR01587"
                     /db_xref="CDD:233483"
     misc_feature    complement(81436..82065)
                     /locus_tag="Caur_0070"
                     /note="CRISPR/Cas system-associated protein Cas3'';
                     Region: Cas3''_I; cd09641"
                     /db_xref="CDD:193608"
     gene            complement(83818..84846)
                     /locus_tag="Caur_0071"
                     /db_xref="GeneID:5828208"
     CDS             complement(83818..84846)
                     /locus_tag="Caur_0071"
                     /note="KEGG: rca:Rcas_1009 regulatory protein, DeoR"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein, DeoR"
                     /protein_id="YP_001633714.1"
                     /db_xref="GI:163845670"
                     /db_xref="GeneID:5828208"
                     /translation="MGKGRGLSRAERLSEMKRLYVQRAFSDAEIAERLEIDRTTAYRD
                     RIALEQEYPFVEESPGRYRIDRSRLVSEVRLNPHEALFLYLPARRLLRQTRFANVHVV
                     QAVEKLAACLQQPMTERLLQLSTSVLKQQKQPQRLSILEQITMAWLNQRKVRITYRAL
                     RARRPLIHTICPYLIEPALWSDSVYVVAYSDIARDIVPFKLERIEDAVTTLETFDIPD
                     DFDEQQLLRHTWGIWLGDEEPVTVRLRFMPGEVTRRVQETIWHPSQQITLLDDGGCEW
                     QAQVTDWREMLPWVRGWGAGVEVLEPLEFRETLMGEARALAERYGWHVSSVPTPTGST
                     TLHDFFGG"
     misc_feature    complement(83884..84825)
                     /locus_tag="Caur_0071"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    complement(83896..84432)
                     /locus_tag="Caur_0071"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            85231..86709
                     /locus_tag="Caur_0072"
                     /db_xref="GeneID:5828209"
     CDS             85231..86709
                     /locus_tag="Caur_0072"
                     /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="YP_001633715.1"
                     /db_xref="GI:163845671"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:5828209"
                     /translation="MTTSHLPLDHLVRCCKQERQSYRDSGELASPCCMHLFRRAFAGE
                     QEAWGYVIDIFQPLIDSWLRRVRGTRLDFIDDDDLTAVAHDALLKLRDSANRLPELTT
                     GDDLSRLLAYLKRCAIREVQTLFRRRNRSREISYIKDDTPHVAHFLDAETRITLYQRL
                     REVLNEDELFVIEHLFFKGYKPQDIIHYFSERFVDVDHIYQIRQNALRRLRNDPVIRD
                     LVFPQEQSSDHRDPPIDSPQDRRQKPRGPDSLKIELDQEQKEPGLMGTPCTLDEQILL
                     DYAAGRLSVEQRLLVEANPDCVAQAQRLAAEIAAIEASLYRLQCPDVDTLHAYYYREL
                     EATQHLIVHRHVEDCLFCREELALLQVMDETPLIEPSPFERVRQVVEAILQPALALQL
                     RGQALIYAAPEVLLTLTVRRTKQGVPQWTVIGELKMPDGAPTDQPIEQVVATVTDSHT
                     ITAEIDEDGVFVIRDLPPGTYRLTVYTPDKEIVIRSLQIGND"
     misc_feature    85366..85866
                     /locus_tag="Caur_0072"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    86491..>86664
                     /locus_tag="Caur_0072"
                     /note="Middle domain of rhamnogalacturonan lyase, a family
                     4 polysaccharide lyase; Region: RGL4_M; cl18200"
                     /db_xref="CDD:266939"
     gene            86711..89500
                     /locus_tag="Caur_0073"
                     /db_xref="GeneID:5828210"
     CDS             86711..89500
                     /locus_tag="Caur_0073"
                     /note="PFAM: TPR repeat-containing protein;
                     Tetratricopeptide TPR_4;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: sus:Acid_3454 tetratricopeptide TPR_4"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide-repeat containing protein"
                     /protein_id="YP_001633716.1"
                     /db_xref="GI:163845672"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:5828210"
                     /translation="MDDLIAELIDLPEAEWPGWLTTHASRLSLETVARLKQRSDQFIK
                     SDSARADRISRAAIAVAEQLPTEPIARALAYWARGNWAVYRRPEEAVDLYQKALVVYE
                     QIGDSEAIARLSSNLILACTTLGRFADALTFAERAQRLLEEIAAGPVIYRVKFGMNYG
                     LLLYECGRYQEALDVNEKMIALARNHGLQEELAELQVNQAFTLAAMGRLAECERLLID
                     SRQRLEQLTPKPVLTIARIDLNLGDYYSATANLSAALNHFRDASKGFQEENVAMDYAT
                     VLLYEANLLKRLGALREARRAYDRAYQAFREDNLTQYAAQALLAGAAVRREINPADPE
                     LPEMLNRACDMFTNLQLPIWRNETLLEQARLALLFGNYAQAESLLTTAWSEDADTVLH
                     LAIDHQLLWGRLRMAQGDEAGALTAFTSALTQSQNGAQIWSEREALVALGNLLAARQP
                     DSAIQYLQDAVRIDELMRAELSVAELTADFQSRRNDALPLLAKLEWQAGHFQTALQTV
                     WRWKGGALIDLIRRHDGYTDVNPTIAQLQQRIAVLRWELERKQRDEESEERLDELRRQ
                     IRDLEAQAYHERRYHIHKPGQSDASIYNWQTVLSKLDADCLIEYVSIDNELYAWCLTR
                     NGDCTITTLGSTSTISELLQRLELKNLNALRLNDEQRQQRGETLIRDARVLLQRLYRT
                     LIEPLPIPVEGKLLIAPCAPIHLAPFAALWNGNNYLMERYLIEQIPTGALLGIPVPAG
                     PSGPALVIGASADGMLAAVQREINAIAGILADAEVYLDDPAALTALHNLTTAPRILHF
                     SAHTTFDEEPTIFAGLHLADRTFTIEECYRLNLAGTELVTLNGCTTAYGMESGGALIA
                     FQSAFLIAGAQRLLVSLWPIKDEPAAGLMARFYQNLMQTQSPAVALRQTQRDLLHDPA
                     LAHPAIWSAFAVMRR"
     misc_feature    86924..87139
                     /locus_tag="Caur_0073"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    <88310..88429
                     /locus_tag="Caur_0073"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3937"
                     /db_xref="CDD:226447"
     misc_feature    88727..89497
                     /locus_tag="Caur_0073"
                     /note="CHAT domain; Region: CHAT; pfam12770"
                     /db_xref="CDD:257286"
     gene            89548..91068
                     /locus_tag="Caur_0074"
                     /db_xref="GeneID:5828211"
     CDS             89548..91068
                     /locus_tag="Caur_0074"
                     /note="PFAM: polysaccharide biosynthesis protein;
                     virulence factor MVIN family protein;
                     KEGG: gvi:gll3709 polysaccharide transporter, PST family"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="YP_001633717.1"
                     /db_xref="GI:163845673"
                     /db_xref="InterPro:IPR002797"
                     /db_xref="InterPro:IPR004268"
                     /db_xref="GeneID:5828211"
                     /translation="MPTPHSPHPHPNPPPALLATRAVRGSLWVVASSYWTIGFGFLAN
                     MLLMRLLSPDVYGEFALAMFFFSLFQVRSKIALNYAFAQQRAITGETVGTLFVLDVLA
                     GWGGVLLAFSVAPLLRWLGYPAAVIEIMLVLTILSGIESLLGVFQIVLESDLHFKPIS
                     IINGIAMPLSYIPAFVCAFTDLKRYSILAQSTSFTLLSLIGIGLYALYTQRHLLRLRW
                     RYQSTLAVAYLRFGMTSGLGQAIAGLTTQVDNMILGTIAGTVHLGYYDRAYRVAQWPA
                     LLLSAVLGRAAIFTYSQLRDDVIRLQRAVTRVLWGSLHLAVPVALAVMLSANELVPLL
                     FGAQWEPAIPLLRVLILLAVIRPVWDNLSAWFIGSGEPQRVVALSAIQLLLLVLIGTP
                     LTLMGGEFGMAIGAVIAAGCSLLIAYWQVRRQLVVDLRQVLGNPLLAALGTLLIFWLL
                     DRLVGSGQPLWLAVGWKAGVAFGGFFCWAYVLQPALFRRQIGEVWRAIRGKGERDA"
     misc_feature    89611..91020
                     /locus_tag="Caur_0074"
                     /note="colanic acid exporter; Provisional; Region:
                     PRK10459"
                     /db_xref="CDD:236697"
     misc_feature    89611..90846
                     /locus_tag="Caur_0074"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            91216..92115
                     /locus_tag="Caur_0075"
                     /db_xref="GeneID:5828212"
     CDS             91216..92115
                     /locus_tag="Caur_0075"
                     /note="PFAM: D12 class N6 adenine-specific DNA
                     methyltransferase;
                     KEGG: rrs:RoseRS_0743 D12 class N6 adenine-specific DNA
                     methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="D12 class N6 adenine-specific DNA
                     methyltransferase"
                     /protein_id="YP_001633718.1"
                     /db_xref="GI:163845674"
                     /db_xref="InterPro:IPR002294"
                     /db_xref="InterPro:IPR012327"
                     /db_xref="GeneID:5828212"
                     /translation="MKHQRTPSPILQRRTRRLIAFGWYGGKYSHLDWLLPLLPPCHHY
                     CEPFGGSAAVLLNRDPAPVETYNDIDGEVTNFFRVLRDQPDQLTRAIALTPFSREEFA
                     LACEIDPSLEPIERARRFYVRARQVRTGLAQSASLGRWANCKQTSRSGMAGAISRWFG
                     AIEDLPDIAIRLLRVQIENRPALEVIRLYDSPDTLFYCDPPYVHETRGDNNAYAYEMS
                     NEEHQQLADVLNSVQGFVAISGYDCDLMNELYSPPKWIKHVGPTRTIHSTKDQRTEIL
                     WTNYDPILYQSHTLFGVELGKSS"
     misc_feature    91276..92061
                     /locus_tag="Caur_0075"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dam; COG0338"
                     /db_xref="CDD:223415"
     gene            92099..93226
                     /locus_tag="Caur_0076"
                     /db_xref="GeneID:5828213"
     CDS             92099..93226
                     /locus_tag="Caur_0076"
                     /note="KEGG: rrs:RoseRS_0742 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633719.1"
                     /db_xref="GI:163845675"
                     /db_xref="GeneID:5828213"
                     /translation="MENPHEILKRILEYVSVDLSRSSITDQEIRTRIESVCRQISNRA
                     CTRMLMACLLAKIHRPEIDPRKPYTEIGGEDSFSGRTYDEKYITHFINTYQLPLNPTT
                     AFLTPAFRNLDKPLTTDLELVGRPRRTYKDTLQLLDDVYRGRVSAEDMLAEIIRILVV
                     IREENRNRIRTLLAGLASTEDPLPLSSEDIVSLIEQHLKCKNSSRLPVLIIAAAYLSV
                     SEKIGEYIQPLQKHNAADEQTGSFGDVEVCLANDDRVVTVYEMKMKQVTIDDIDRARE
                     KVARARDKIHNYIFITTDVITDDVKFYAAKCYEETNDTEITVLDCIGFLRHFLHLFHR
                     SRIQFLNHYQQLLLNEPDSAVNQPLKEAFLTLRRAAEIDKG"
     gene            93459..94595
                     /locus_tag="Caur_0077"
                     /db_xref="GeneID:5828214"
     CDS             93459..94595
                     /locus_tag="Caur_0077"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: rrs:RoseRS_3120 glycosyl transferase, group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001633720.1"
                     /db_xref="GI:163845676"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5828214"
                     /translation="MKILFIARYHHPTTQRKVEYLAQAPDIDLCHIVPAYQPQSADLR
                     PLDEQRRYRQLTIPMLGSVSDPHRALYRTVTFHLHRFRPDIIHAEEEPDSLSALQIVW
                     ARRIWAPQARLLLHTWQNQDRRKSRAVRWVIRQTLEAADLVFCANSEAITLLRRFGFT
                     GPAPLLPAIGVDTTLFRPCAAYNGLSEQSAAKSSYTIGYIGRLVWEKGIDLLLQAVAA
                     LTSAMPDRQIQVWVTGAGPLQAELQSLARQLGIEERVVWKGAQPPHEIAKILCHLDVL
                     VLPSRTTNVWKEQLGRVLLEAMACGVPVIGSTSGAIPEVIGDAGLIVPEGDVQALTQA
                     LKHLLSTPDLRQTLAQRGRIRAETYYTQRHLAEQTLAIYREIVA"
     misc_feature    93459..94592
                     /locus_tag="Caur_0077"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    93462..94580
                     /locus_tag="Caur_0077"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     gene            96498..96884
                     /locus_tag="Caur_0078"
                     /db_xref="GeneID:5828215"
     CDS             96498..96884
                     /locus_tag="Caur_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633721.1"
                     /db_xref="GI:163845677"
                     /db_xref="GeneID:5828215"
                     /translation="MTSQPPQTAQKNPVEMLQDQVTLLAHIHQTQQEQLRFLATDIYR
                     TQQEQLQVLRSLSEQLASLQVEVSQFAQSVHRVQVEDFDMPFTSMVPFLLKRSFALGI
                     VSIILGVIGLCIFFALITFAGPYFRF"
     gene            96990..97862
                     /locus_tag="Caur_0079"
                     /db_xref="GeneID:5828014"
     CDS             96990..97862
                     /locus_tag="Caur_0079"
                     /note="PFAM: glycosyl transferase family 2;
                     KEGG: rca:Rcas_0463 glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001633722.1"
                     /db_xref="GI:163845678"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5828014"
                     /translation="MHHSDMRQNTSLLPPASVIVLTHNTCELTITCLKQFYQQALDHG
                     WQVIVVDNGSTDGTYQRLTGLFPSVEVMRSEQNRGFAAGNNLGLRRAMGQAVILLNSD
                     VLASFATLSRLPEFLAHYPQVGVVSPQLQTASGLPQAFAYGCDPTLPYLLQRGLCWLI
                     WRKPLHDWGVAAPIEVDWVSGACMCVRRAAIEQVGLLDEGFFLYFEDNDWCLRMRNAG
                     WKVMYVPTYAVTHLGGQSWPTPRQAGQHYRQSLRYFYQKHYGPLATGLLGVGLLGYQV
                     LLKLMAFRLRKEED"
     misc_feature    97038..97763
                     /locus_tag="Caur_0079"
                     /note="Predicted glycosyltransferases [General function
                     prediction only]; Region: COG1216"
                     /db_xref="CDD:224137"
     misc_feature    97041..97688
                     /locus_tag="Caur_0079"
                     /note="Subfamily of Glycosyltransferase Family GT2 of
                     unknown function; Region: GT_2_like_c; cd04186"
                     /db_xref="CDD:133029"
     misc_feature    order(97143..97145,97290..97295)
                     /locus_tag="Caur_0079"
                     /note="Probable Catalytic site; other site"
                     /db_xref="CDD:133029"
     misc_feature    order(97293..97295,97608..97610,97614..97616)
                     /locus_tag="Caur_0079"
                     /note="metal-binding site"
                     /db_xref="CDD:133029"
     gene            complement(98452..103038)
                     /locus_tag="Caur_0080"
                     /db_xref="GeneID:5828015"
     CDS             complement(98452..103038)
                     /locus_tag="Caur_0080"
                     /note="TIGRFAM: conserved repeat domain protein;
                     KEGG: sat:SYN_01127 RTX family of calcium-binding
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633723.1"
                     /db_xref="GI:163845679"
                     /db_xref="InterPro:IPR001434"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="GeneID:5828015"
                     /translation="MRFRINVWAILGTTVLVSGFLLASRSVWSATIPVLPPPHTQAVI
                     SVCDPITTDTTWTTGNVYVVGDCALVVQSGATLTIQPGVIVKFFWVSAYGGSRGGGIR
                     VDGRLIAQGTADQPIVFTSLADDSAGGDTNGNGPSSGAPGDWHGLILNTGSQTTLDHV
                     SIRYAGGNLINSSLDGWSEAQIEVKAGAQFSLTNSEVRDGGRIGIYLNGAGLSPTIQH
                     VQLSGHTATGSSYGYTVLQSTINMQPTYSNLTFSNNTRNEVTIGSFEGEITQNATLGG
                     TNFGATCGSTLCQLIIPNGRTLTIRPGTRLALGPAFGITIASGGTLNAEGTATQPVIF
                     TSAAAATTPPGGTVPSNSEWLGLWAQAGSTLRLAYCDISYATDSNYGNGGLEINTDDA
                     QVQNCKIHHNKRTGLYLASKNNSTIRPVLSNVEVSDNGQYGVYLEAQRGTVLAPTWEG
                     GAIRRNGWSGIFGYTYEGILEPTLRNLTIAGNGASGGLDREKHGIYFNNHNINPVLEG
                     VSFNNNTGAAVLWYCNGSITARNLTATGNTQNELVLPGCDISGGRRWDLGDAGIPVRV
                     AGDINVTPNALLSILSGTILRFDKNQYNSPTWLEVQDQATLNASGTVTRPVVFTGATQ
                     TPGWWIGIQARQRATLMLRHCEIGYGGAQTTGSLLIRWGYPRTGIPVANIQNCEIHHS
                     STRGVHFYFDNEPPASPPVFRYNHLHDNAELAVAAWGTPPIDARYNYWGHATGPYHAT
                     QNPTGQGNGVGDNILFYPWLSAPSSGEVAGEMIVRTGAPTRVSPGETVDYAIQYYNGM
                     SITVENAVLLIQLPRAAEYVDSTGGGIYWSDRHQVFWKLGDLLPQAEAFVSVRVRFQW
                     GLPADYKDGSITLLAADNYNAGAFNTAEYLAHQMEEVITGKTIVSQTEFDALRRTVPD
                     LQTLYEEAIAQGYRYLEAGRITYDDGTSVTGAVFRTPDRRAVRLLTLYEGMALAMTSA
                     DGLYTLHDTTGGITMTLNGLSRSYWGDWMPGADSQTVGLRASTGCSVSDCNFNCIGQQ
                     VNFKVMADSLTKMFMWTIATGGSGGTVALALEVLDVTKMIYDCYTECEADPNSNCCTT
                     TGQVRWTVPGWSKLLGDACVKEECNGTTGTYGTPGVIYCAGGQRCVAGYGNEGGCKSC
                     VEATASYSAVSLASPGICAAGETSRCSELELLRAKDPNDITGPTGDLLPGQVVTYTIR
                     YENEGEGRAYGVFVVNPLPAVFDERTLTFVHGSGQYLTATREIVWTVGELAPKGQAGS
                     SGVLTYTVALTNGLPSGTVVANQATVYFPSVPEETPTNTWVNVVTPLVAEPQSLTTAY
                     MAPLPITLSGREVSGLPLTYEIVDRPHGGTLTGTAPNLTYTPGENFTGADAFTFRVSN
                     GTSTSRAAQISVMVTAQGDTTSPRVLWTSPADGAKGVVVLATPVYTDTAGPIYVPEIL
                     VGMSEPLDATTVTTTTVILRRSDGTVVPAWVRYDAAVHQIVMMPRTVLANGTYRAEVT
                     TGVKDSAGNTLSAPYTIQFTVGSERKVYVPVIQR"
     sig_peptide     complement(102949..103038)
                     /locus_tag="Caur_0080"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.983 at
                     residue 30"
     misc_feature    complement(101425..101973)
                     /locus_tag="Caur_0080"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    complement(99169..99453)
                     /locus_tag="Caur_0080"
                     /note="fimbrial isopeptide formation D2 domain; Region:
                     RrgB_K2N_iso_D2; TIGR04226"
                     /db_xref="CDD:234511"
     misc_feature    complement(98494..98850)
                     /locus_tag="Caur_0080"
                     /note="Bacterial Ig-like domain; Region: Big_5; pfam13205"
                     /db_xref="CDD:257572"
     gene            103793..104938
                     /locus_tag="Caur_0081"
                     /db_xref="GeneID:5828016"
     CDS             103793..104938
                     /locus_tag="Caur_0081"
                     /note="KEGG: rca:Rcas_0440 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633724.1"
                     /db_xref="GI:163845680"
                     /db_xref="GeneID:5828016"
                     /translation="MPRLNPAIHLTFLLILTCFVRLLASIFANDIIDVRNYQQVAEVI
                     DRFGVSGLYRHTPDIYPYPPLWAGFEVAAYWLAQNNILSFSLAIRLPIIAADAGIVAV
                     IWQWVHRHSGSSRQAMQAAMIYALNPVSIIVSCWHGQFDALPLFWAALAMICTAWQWQ
                     AIALSIGIALKSFPVLLVPAFLWHLQPLRRQVQFGLLALVPVLLLLAPFVVDDASAVV
                     RELFGYRGHALLGIMVPVRTVYVPLVGERFPVETTRLLISLSAYGFLILYALTVWSMK
                     RRSMSVPMQATLIVLLFYVVYAGIAPQYLLWVLPFMIMAARPGAVLVYSAVSTLALLG
                     FYLYAVPDIFPFALTVSPRLAQVAYGLFGSLWWLTCGGLLVWFWRQR"
     sig_peptide     103793..103879
                     /locus_tag="Caur_0081"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.808) with cleavage site probability 0.468 at
                     residue 29"
     gene            complement(105018..105093)
                     /locus_tag="Caur_R0001"
                     /note="tRNA-Arg5"
                     /db_xref="GeneID:5828017"
     tRNA            complement(105018..105093)
                     /locus_tag="Caur_R0001"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:5828017"
     gene            complement(105220..106434)
                     /locus_tag="Caur_0082"
                     /db_xref="GeneID:5828018"
     CDS             complement(105220..106434)
                     /locus_tag="Caur_0082"
                     /note="PFAM: Arsenical pump membrane protein; Citrate
                     transporter;
                     KEGG: rrs:RoseRS_0950 citrate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate transporter"
                     /protein_id="YP_001633725.1"
                     /db_xref="GI:163845681"
                     /db_xref="InterPro:IPR000802"
                     /db_xref="InterPro:IPR004680"
                     /db_xref="GeneID:5828018"
                     /translation="MTIISILTLGIVAATIIGVAVGRWPLLRADRTTITLIGAALLLG
                     IGAMSLEEAYAALDLDTIVLLFSMMVINGSLFLAGFFGVITQRVVQFARGPRSLLALV
                     IGASGILSALFLNDTIVLMMTPIVLDVTRALRRNPLPYLIGLAVAANVGSTATITGNP
                     QNIIIGSASKISYLDFAAALSPTALIGLVICWIVVLLVYRDEFRGGPLTTPDVLRTRV
                     YRPLLRKAALVISLMLIAFLVGVPVPLAAFVAAATLLATRRLRPERVFKTIDWNLLTF
                     FAGLFVVTHALDVQGWTDILFTNLAPLAQAGMVPFGLVSVVLSNLISNVPAVLLLQSL
                     IPAFADQERAWLTLAATATLAGNLTLLGSVANLIMAELAARWGVRVTFGAYLRVGLPV
                     TILTVAVSLILV"
     sig_peptide     complement(106366..106434)
                     /locus_tag="Caur_0082"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.906) with cleavage site probability 0.864 at
                     residue 23"
     misc_feature    complement(105442..106410)
                     /locus_tag="Caur_0082"
                     /note="Citrate transporter; Region: CitMHS; pfam03600"
                     /db_xref="CDD:252049"
     misc_feature    complement(105223..106380)
                     /locus_tag="Caur_0082"
                     /note="Putative anion permease YbiR.  Based on sequence
                     similarity, YbiR proteins are predicted to function as
                     anion translocating permeases in eubacteria, archaea and
                     plants. They belong to ArsB/NhaD superfamily of permeases
                     that have been shown to translocate...; Region:
                     YbiR_permease; cd01117"
                     /db_xref="CDD:238537"
     misc_feature    complement(order(105229..105267,105343..105402,
                     105469..105516,105574..105630,105667..105711,
                     105715..105753,105844..105888,105952..106023,
                     106033..106086,106090..106140,106207..106260,
                     106303..106344,106369..106380))
                     /locus_tag="Caur_0082"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238537"
     gene            complement(106505..107578)
                     /locus_tag="Caur_0083"
                     /db_xref="GeneID:5828019"
     CDS             complement(106505..107578)
                     /locus_tag="Caur_0083"
                     /note="PFAM: PHP domain protein;
                     SMART: phosphoesterase PHP domain protein;
                     KEGG: rrs:RoseRS_2550 PHP C-terminal domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase domain-containing protein"
                     /protein_id="YP_001633726.1"
                     /db_xref="GI:163845682"
                     /db_xref="InterPro:IPR003141"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="GeneID:5828019"
                     /translation="MNYPFIYPGAIHMHTTYSDGSATFPHLIAAAREAGLRWVIVTDH
                     DTLEGLPFAGWHDDVLVIVGHEITPDHNHFLALNVDTVISNELPPQQFIDEVYQRGGF
                     GIIAHPDERVRNSFKDIYRWDDWTIDGPSQRTGRVVGLELWNFMSDWGEHLTERNKLA
                     LVLYPQLGLSGPTLATLAWWDRLNMVGRRTFGIGGVDAHGFKRKAPWGEIEVFPYPWI
                     FRTLTNYLLLPEPLSSDATTATNQVYAALTAGRCYFVNRLDGDAPSIIFRLSRPGDLA
                     EIGDTISLAGGPLLVEVDVGADAYARLIVNGEVMTSGIRRIRQTVTDDGVYRVEAYWG
                     GKPWLFTNPIFVTAADAGREGSL"
     misc_feature    complement(107075..107545)
                     /locus_tag="Caur_0083"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     Histidinol phosphate phosphatase; Region: PHP_HisPPase;
                     cd07432"
                     /db_xref="CDD:213987"
     misc_feature    complement(<107240..107545)
                     /locus_tag="Caur_0083"
                     /note="Predicted metal-dependent phosphoesterases (PHP
                     family) [General function prediction only]; Region:
                     COG0613"
                     /db_xref="CDD:223686"
     misc_feature    complement(order(107258..107260,107381..107383,
                     107447..107449,107537..107539,107543..107545))
                     /locus_tag="Caur_0083"
                     /note="active site"
                     /db_xref="CDD:213987"
     gene            107630..108739
                     /locus_tag="Caur_0084"
                     /db_xref="GeneID:5828020"
     CDS             107630..108739
                     /locus_tag="Caur_0084"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: rca:Rcas_4314 glycosyl transferase group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001633727.1"
                     /db_xref="GI:163845683"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5828020"
                     /translation="MIVIDIDASRVTVAQRTGTERYSYELIAALDRIAPSDIHFRLYV
                     NGRRDQLPPVSERATIHDIRLPRLWTHLRLGPTSWRARPHVLFVPAHVVPLLHPPTVV
                     TIHDVGYRAFPETHTARRRLELELTTRWSLRAARHVITISHATKRDLINWYGADPNRI
                     TVTHLGCSSIFAPPADPRVVAAVTAHYGLDQRPYLLYIGTVQPRKNLSRVIDALALTI
                     AAGYDLDLVIAGKRGWLSEPIERRAGELGIANRVHFTGFVADADLPALLAGALAFVFP
                     SLYEGFGMPVVEAMACGTPVITSTSSSLPEIAGDAALLVDPLDTNAIAAAIMRLSDDQ
                     DLRATLRQRGLARAHLFNWETCARQTLAVLLQQSR"
     misc_feature    107630..108721
                     /locus_tag="Caur_0084"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    107645..108715
                     /locus_tag="Caur_0084"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. mtfB (mannosyltransferase
                     B) in E. coli has been shown to direct the growth of the
                     O9-specific polysaccharide chain. It transfers two
                     mannoses into the position 3 of the...; Region:
                     GT1_mtfB_like; cd03809"
                     /db_xref="CDD:99981"
     gene            109679..110044
                     /locus_tag="Caur_0085"
                     /db_xref="GeneID:5828021"
     CDS             109679..110044
                     /locus_tag="Caur_0085"
                     /note="PFAM: protein of unknown function DUF309;
                     KEGG: rca:Rcas_1756 protein of unknown function DUF309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633728.1"
                     /db_xref="GI:163845684"
                     /db_xref="InterPro:IPR005500"
                     /db_xref="GeneID:5828021"
                     /translation="MGSSDHQCSEAADALVCGIHLFNQGEFWHAHEQWEICWRAAQGM
                     DADFYQALIQSAAALVKWRQGNLRGLRLNWAKAQRRLSRLPSFYRGIDLARLQTAMTA
                     LVNDPELASAPVLDLPPAQ"
     misc_feature    109718..109900
                     /locus_tag="Caur_0085"
                     /note="Domain of unknown function (DUF309); Region:
                     DUF309; pfam03745"
                     /db_xref="CDD:252143"
     gene            complement(110797..113220)
                     /locus_tag="Caur_0086"
                     /db_xref="GeneID:5828022"
     CDS             complement(110797..113220)
                     /locus_tag="Caur_0086"
                     /EC_number="3.4.21.53"
                     /note="KEGG: rrs:RoseRS_1605 ATP-dependent protease La;
                     TIGRFAM: ATP-dependent protease La;
                     PFAM: peptidase S16 lon domain protein; AAA ATPase central
                     domain protein; ATPase associated with various cellular
                     activities AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease La"
                     /protein_id="YP_001633729.1"
                     /db_xref="GI:163845685"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:5828022"
                     /translation="MTTTPANEQSPSPSGTTLYERPVLPLLDSVLFPQMLAPLFVSDE
                     RAINAVEQAVAEDRLVLAVAVRGPVDELTLGIDDLYPVGVEATVQRVRRLPDGTLSVV
                     LEGRQRMQIVSVVTEHPALRVLATPLETPPLDEDAALMVEALSRTILTTFEKIVRLSR
                     NLPDDAYLSALNSAEPGELADIIAALLPISVEDRQRILALADIQQRLRQLEILLAKEL
                     DLLELENRIHSQVQQEVDRSQRELFLREQLRAIQRELGQEDPSRREIMLLRERAAAAG
                     LPAHAMARFEEELARLELISPMSPEHGMLRTYLDWLISLPWSNASPENRDLRAAAAVL
                     ERNHYGLRKVKDRILEYIAVRQLAGPSRRAPILCFVGPPGVGKTSLGQSIAEALGRRF
                     VRLSLGGVHDEAEIRGHRRTYIGAMPGRILQRMKVAGTINPVFMLDEVDKLGSDFRGD
                     PAAALLEVLDPEQNSTFSDHYLDLPYDLSQTLFITTANVADDIPDPLLDRMELVELPG
                     YTEDEKLHIARRFLIPRQMTDSGLPPATIRFGDATIHTIIRNYTYEAGVRNLEREIGA
                     ICRKIARRIAEGRRYPRQITPRALPKLLGPPRFEIGKIDPRDQVGVAIGMVYTSAGGD
                     IMPVEVVLMDGKGNLLLTGQLGEVMQESAQAALSFARANASRLGIEIRHFDKLDIHVH
                     VPEGATPKDGPSAGVTIATALISALTGRTVRHDIAMTGEITLHGRVLPIGGVKEKVLG
                     AYRAGIRQIILPRRNEHDLVEIPVALRRQLTIHLIERIEQALELVLGPPPPKEPRRAP
                     RVIPRRDED"
     misc_feature    complement(112573..113163)
                     /locus_tag="Caur_0086"
                     /note="ATP-dependent protease La (LON) domain; Region:
                     LON; pfam02190"
                     /db_xref="CDD:251146"
     misc_feature    complement(110851..113157)
                     /locus_tag="Caur_0086"
                     /note="ATP-dependent Lon protease, bacterial type
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: Lon; COG0466"
                     /db_xref="CDD:223542"
     misc_feature    complement(111694..112188)
                     /locus_tag="Caur_0086"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(112087..112110)
                     /locus_tag="Caur_0086"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(111763..111765,111907..111909,
                     112084..112107))
                     /locus_tag="Caur_0086"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(111904..111921)
                     /locus_tag="Caur_0086"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(111721..111723)
                     /locus_tag="Caur_0086"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(110857..111471)
                     /locus_tag="Caur_0086"
                     /note="Lon protease (S16) C-terminal proteolytic domain;
                     Region: Lon_C; pfam05362"
                     /db_xref="CDD:191262"
     gene            113440..114276
                     /locus_tag="Caur_0087"
                     /db_xref="GeneID:5828023"
     CDS             113440..114276
                     /locus_tag="Caur_0087"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: gka:GK2874 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold-containing protein"
                     /protein_id="YP_001633730.1"
                     /db_xref="GI:163845686"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="GeneID:5828023"
                     /translation="MRDRHRAEDTTVKITINDITLHIEITGSGPALLAIHGFTGSGQT
                     WQPLVPTLAQDHTLVLVDLIGHGASAAPPDPHRYTIEQCVTDLLTLLDYLGIEHTDLL
                     GYSMGGRIGLLLTAHAPTRIRRQILIGASPGLADPAERTARLASDEALARLIEERGLE
                     WFVDYWAAQPIFASQQRLPPAVLAAQRAQRLAGSAQGYANALRGMSVGRQPSLWATLP
                     TITTPTLLITGALDSKFCAIAAQMTALMPHARHEIVPDAGHAVHLEQPDAVATLVSAF
                     LA"
     misc_feature    113521..114270
                     /locus_tag="Caur_0087"
                     /note="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase; Region:
                     menH_SHCHC; TIGR03695"
                     /db_xref="CDD:234315"
     misc_feature    113524..114273
                     /locus_tag="Caur_0087"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(114596..115063)
                     /locus_tag="Caur_0088"
                     /db_xref="GeneID:5828024"
     CDS             complement(114596..115063)
                     /locus_tag="Caur_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633731.1"
                     /db_xref="GI:163845687"
                     /db_xref="GeneID:5828024"
                     /translation="MAQAELDDRIKFLLVGVEVLFVYIFGLVRLATMEWLSLFAWIGL
                     LMWPFVHVMIVSAFILSFRLNFKDAVLYIAVHLFFLLAWLLQSDFANNHTWVVFGKFP
                     FIRGLEPFLIEWGSTLFLTTATATLVCYAVIFILVIVRIVQFLVSLNKDAQAA"
     gene            complement(115078..115332)
                     /locus_tag="Caur_0089"
                     /db_xref="GeneID:5828025"
     CDS             complement(115078..115332)
                     /locus_tag="Caur_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633732.1"
                     /db_xref="GI:163845688"
                     /db_xref="GeneID:5828025"
                     /translation="MPLARLLPLGYAMRRMIRLWLIVCASVETEIVQAGGGDCAVFSG
                     DSCVRTAPLPLALSLPFTPADGNCQPDMRNTTTDNVAITI"
     gene            complement(115639..116187)
                     /locus_tag="Caur_0090"
                     /db_xref="GeneID:5828026"
     CDS             complement(115639..116187)
                     /locus_tag="Caur_0090"
                     /note="KEGG: rrs:RoseRS_1736 PBS lyase heat domain protein
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HEAT repeat-containing PBS lyase"
                     /protein_id="YP_001633733.1"
                     /db_xref="GI:163845689"
                     /db_xref="GeneID:5828026"
                     /translation="MILLLPDVLPLDPKERDDWIRRIHLLLKVAKQDNLLDLVKAILE
                     LLDGWRGKDQPEPPQPPSCPTGWSGQQWIVVDFFNLVIAILRVLEEWLVRDQQEPQQP
                     SSRSTGWGVQQWIVVGLLIALAVLVCIVAALLSVIGDVVTTLWMVLLQTPLWLVGAGL
                     VFALVGLVAFLGWWVYVKKRGM"
     gene            complement(116225..119440)
                     /locus_tag="Caur_0091"
                     /db_xref="GeneID:5828117"
     CDS             complement(116225..119440)
                     /locus_tag="Caur_0091"
                     /note="PFAM: HEAT domain containing protein; PBS lyase
                     HEAT domain protein repeat-containing protein;
                     SMART: Armadillo domain protein; AAA ATPase;
                     KEGG: rrs:RoseRS_1736 PBS lyase heat domain protein
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HEAT repeat-containing PBS lyase"
                     /protein_id="YP_001633734.1"
                     /db_xref="GI:163845690"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR007111"
                     /db_xref="GeneID:5828117"
                     /translation="MRQVCPRPERPSLAPSPPISEPSAQQATDTGYVAVGEGHASARS
                     DSVSVSDVASAPVIPLETILHTRRHLAILGEPGAGKSTTLQFIGLSYALATAQQPVER
                     LSITRPAVPVYLRLPVSASTITQQTVREAMVAEVRDRLQCSAAEAEAVLRSWQEWPGV
                     IILLDGLDEVPVALRVQVRERIKTLMRSGIGRVIITSRPSVLLHLGGLDEYTLKPFEH
                     FDRDVLPYLKGWLRVLKPDLQAQVVDNVAQDVMTKLRASPALRSLIGNPLLLRLIVQY
                     FVTTGDIAWNRADLYRQWVTEAWARARWRGAAATEEPHYLIALHTLAWHLHAGRDNTE
                     TALQTVLRTSGLAADDRAAADLLHRLQAQTGLLLRLSTGQDGLAHVRYVFAHQTLREY
                     LVALRLQQAWQRGKHRTWRFLQPRLHLPEWREPLALLVGLLTESEAQHLLRQILHAKS
                     SEERLLCRDLLLTANLAVESGYIHSVWESLAPKLARALRREHLSKETAAVLARVGKPA
                     VPMLAQALNDPSVEVRRAVVQALGLVGDAAVPVLAQALNDAQPEVRWAAVASLVAVGN
                     AAVDTLVQALGDDDAEVRRVIGQALLEIGDAAMPALVKALADKRANVREAAARALGES
                     GYAAAVSALVQSLRDENPWVRQAVAEALGAIGDAAAVVALAQALNDENVWVRQATARA
                     LGRIGGAAAMLPLTVALNDENPWVRQAVAEALGTIGDAAAVLPLTRALSDEHAWVRRS
                     AARALGQIGDGAAVPALAKALSDGDVQVRQQVVEALGCIGDSAAAAALVKALGDTNAE
                     VRWTTMKAFEQIGSRNVATLLRAISDGKWQFPWQDAQAWKIGNQAIEAIGSVFNGGDT
                     GKRMIATLALGETGNSAALPALERALRDTDLWVRRAALEALAKIGDQAVIVPALERAL
                     RDTDQWVRQTAAEMLVKIDDTAAVLPALERALRDADQWVRRTAAEALGKIGDASAVEA
                     LQRALADTESMGAAGRSRGARKDRRCVGGGGAAKGIGRYRSMGAAGRSGGARKDWRCV
                     GSGGAAKGIGRYRSMGAAGRSRGVGEDRRCKSGSITDTVTE"
     misc_feature    complement(118823..119239)
                     /locus_tag="Caur_0091"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    complement(119198..119221)
                     /locus_tag="Caur_0091"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(118850..118852,118946..118948,
                     119018..119020,119195..119203,119207..119212))
                     /locus_tag="Caur_0091"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(118994..118996,118997..119017))
                     /locus_tag="Caur_0091"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(118946..118960)
                     /locus_tag="Caur_0091"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(118937..118945)
                     /locus_tag="Caur_0091"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(118844..118864)
                     /locus_tag="Caur_0091"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(117098..118033)
                     /locus_tag="Caur_0091"
                     /note="FOG: HEAT repeat [Energy production and
                     conversion]; Region: COG1413"
                     /db_xref="CDD:224331"
     misc_feature    complement(117476..117844)
                     /locus_tag="Caur_0091"
                     /note="Armadillo/beta-catenin-like repeats. An
                     approximately 40 amino acid long tandemly repeated
                     sequence motif first identified in the Drosophila segment
                     polarity gene armadillo; these repeats were also found in
                     the mammalian armadillo homolog beta-catenin; Region: ARM;
                     cd00020"
                     /db_xref="CDD:237987"
     misc_feature    complement(order(117479..117484,117491..117493,
                     117500..117502,117584..117586,117593..117595,
                     117605..117607,117716..117718,117764..117766,
                     117776..117778))
                     /locus_tag="Caur_0091"
                     /note="protein binding surface [polypeptide binding];
                     other site"
                     /db_xref="CDD:237987"
     misc_feature    complement(117242..117331)
                     /locus_tag="Caur_0091"
                     /note="E-Z type HEAT repeats; Region: EZ_HEAT; smart00567"
                     /db_xref="CDD:128837"
     misc_feature    complement(117152..117238)
                     /locus_tag="Caur_0091"
                     /note="E-Z type HEAT repeats; Region: EZ_HEAT; smart00567"
                     /db_xref="CDD:128837"
     misc_feature    complement(116897..117181)
                     /locus_tag="Caur_0091"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(116555..116815)
                     /locus_tag="Caur_0091"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(116501..116587)
                     /locus_tag="Caur_0091"
                     /note="E-Z type HEAT repeats; Region: EZ_HEAT; smart00567"
                     /db_xref="CDD:128837"
     gene            complement(119415..119777)
                     /locus_tag="Caur_0092"
                     /db_xref="GeneID:5828118"
     CDS             complement(119415..119777)
                     /locus_tag="Caur_0092"
                     /note="KEGG: rrs:RoseRS_1736 PBS lyase heat domain protein
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HEAT repeat-containing PBS lyase"
                     /protein_id="YP_001633735.1"
                     /db_xref="GI:163845691"
                     /db_xref="GeneID:5828118"
                     /translation="MISLQLQQALQRLRDGICTSSDLEVVRAALQSGQIRLSTPTPGG
                     AIGGSGDAVLVVTRDGNVLQRLRGTAANQVKLADLTVRYLRAVIEDWQYLTVLTRGED
                     RRVPLTGVFIYASGLPAT"
     gene            complement(121577..122044)
                     /locus_tag="Caur_0093"
                     /db_xref="GeneID:5828119"
     CDS             complement(121577..122044)
                     /locus_tag="Caur_0093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633736.1"
                     /db_xref="GI:163845692"
                     /db_xref="GeneID:5828119"
                     /translation="MARKDLDIRIKFLLIGAEVLFVGILSLMRIAITGWLVLIFGFLL
                     IAWVVFHLVLMSVFILNLRSSTMDMVLFITVHLSYLLAWLFQSDADDVRVRWVIQLFP
                     FTGGLEPFLAAWGGTLFLIATAVNLVCYAVIFILVIVRIVQFLVSLNKDAQAA"
     gene            122914..123741
                     /locus_tag="Caur_0094"
                     /db_xref="GeneID:5828120"
     CDS             122914..123741
                     /locus_tag="Caur_0094"
                     /note="TIGRFAM: naphthoate synthase;
                     PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: gtn:GTNG_2771 naphthoate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="naphthoate synthase"
                     /protein_id="YP_001633737.1"
                     /db_xref="GI:163845693"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR010198"
                     /db_xref="GeneID:5828120"
                     /translation="MPIEWVKVHDYTDIIYEHDAAGEGIAKITINRPEKRNAFRPETV
                     NELIDAFSRARDDERIGVILFTGAGDKAFCSGGDQSVRGIGGYVGKDQIPRLNVLDLQ
                     RLIRIIPKPVIALVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGSNL
                     LARMVGDKKAREIWYLCRQYNAQQALEMGLVNAVVPLERLEDEGVQWAREILEKSPLA
                     IRMLKASINAAADGYAGLQQLAGDATLLYYLTEEAQEGKQAFLEKRKPNFRRFRRYP"
     misc_feature    122914..123738
                     /locus_tag="Caur_0094"
                     /note="dihydroxynaphthoic acid synthetase; Validated;
                     Region: PRK07396"
                     /db_xref="CDD:180958"
     misc_feature    122953..123546
                     /locus_tag="Caur_0094"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(123019..123021,123025..123027,123124..123126,
                     123136..123147,123154..123156,123268..123270,
                     123274..123282,123346..123351,123358..123360)
                     /locus_tag="Caur_0094"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(123142..123144,123280..123282)
                     /locus_tag="Caur_0094"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(123229..123231,123244..123246,123307..123318,
                     123352..123363,123379..123381,123385..123393,
                     123397..123402,123415..123420,123424..123429,
                     123433..123438,123445..123447,123478..123480,
                     123487..123489,123532..123534,123541..123546)
                     /locus_tag="Caur_0094"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            124211..125116
                     /locus_tag="Caur_0095"
                     /db_xref="GeneID:5828121"
     CDS             124211..125116
                     /locus_tag="Caur_0095"
                     /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase;
                     PFAM: UbiA prenyltransferase;
                     KEGG: rca:Rcas_2084 1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="YP_001633738.1"
                     /db_xref="GI:163845694"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR004657"
                     /db_xref="GeneID:5828121"
                     /translation="MTTKATSVPPSHLKIWLMASRPATLPAAVVPVLVGSALAYSSDA
                     FQPLVMLAALLGALFIQIGTNLANDYFDAQKGADTSERLGPVRVTQSGLLPARTVLTA
                     ALVSFGLAALAGIYLITVAGWPILVIGLLSIAAGILYTAGPFPLGYHGLGDLFTFVFF
                     GLVAVIGTDFAHTGQFRWIALWAALPIAMLVTAILVVNNLRDAPTDRKAGKRTLAVIF
                     GERFARSEFAILVIGAFVSLPLAWMWGGASPFTLLAWLTAPMALNLIDFVNRERGRAL
                     NKALVGAGRLHLAFGVLFAIGLLFG"
     sig_peptide     124211..124330
                     /locus_tag="Caur_0095"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.982) with cleavage site probability 0.855 at
                     residue 40"
     misc_feature    124259..125101
                     /locus_tag="Caur_0095"
                     /note="1,4-Dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: PT_UbiA_UBIAD1; cd13962"
                     /db_xref="CDD:260125"
     misc_feature    order(124412..124417,124424..124426,124802..124807,
                     124814..124816,124826..124828)
                     /locus_tag="Caur_0095"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     gene            125639..127102
                     /locus_tag="Caur_0096"
                     /db_xref="GeneID:5828122"
     CDS             125639..127102
                     /locus_tag="Caur_0096"
                     /note="TIGRFAM: O-succinylbenzoate-CoA ligase;
                     PFAM: AMP-dependent synthetase and ligase;
                     KEGG: gka:GK2872 O-succinylbenzoic acid--CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate--CoA ligase"
                     /protein_id="YP_001633739.1"
                     /db_xref="GI:163845695"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010192"
                     /db_xref="GeneID:5828122"
                     /translation="MLIPDWLARRAALHPHRPALIYAGTTYTFAELDRWAGAVASHLR
                     QLVTPGARVALLSRNRPGFVAIVHAAPRTAITLVPLNTRLTAAELAFQIQDSDPALLI
                     IEHDLLPVAREAAGNRPLIVLEELTAATTAPTAPAPPIDLDAMHTIIYTSGTTGRPKG
                     AILTAGNHWWNAIGSMLNLGLHEDDRWLAVLPLFHVGGLSILLRGAIYGIPVILHERF
                     DPALVRHDLDAQRITIVSLVAVMLQRLLAIDPSPFPPHLRCVLLGGGPAPQTLLEQCA
                     TRGIPVTQTYGMSEAASQAATLSPAESLIRLGSAGKPLLPVELSIVTPSGQPAAPGEV
                     GEICLRGPNISPGYLGLPPRSPTDWFHTGDLGYLDQEGYLYVVDRRSDLIIAGGENIY
                     PAEIEAILLSHPAIAEAGVVGLPDPEWGQRPVAAIVAQQPTTAEELIAYCRSRLAGYK
                     VPRTIVFLHELPRTAAGKLRRHELRAILLAQMSGNDH"
     misc_feature    125639..127072
                     /locus_tag="Caur_0096"
                     /note="O-succinylbenzoic acid--CoA ligase; Provisional;
                     Region: PRK03640"
                     /db_xref="CDD:235146"
     misc_feature    125714..127066
                     /locus_tag="Caur_0096"
                     /note="O-succinylbenzoate-CoA ligase (also known as
                     O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or
                     MenE); Region: OSB_CoA_lg; cd05912"
                     /db_xref="CDD:213280"
     misc_feature    order(126080..126082,126089..126106,126110..126115)
                     /locus_tag="Caur_0096"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213280"
     misc_feature    order(126089..126091,126425..126430,126488..126505,
                     126728..126730,126764..126766,126773..126775,
                     126806..126808,127040..127042)
                     /locus_tag="Caur_0096"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213280"
     misc_feature    order(126089..126091,126209..126214,126350..126352,
                     126356..126361,126368..126370,126425..126430,
                     126488..126505,126728..126730,126764..126766,
                     126773..126775,126797..126808,126983..126985)
                     /locus_tag="Caur_0096"
                     /note="putative active site [active]"
                     /db_xref="CDD:213280"
     misc_feature    order(126209..126211,126356..126361,126368..126370,
                     126425..126427,126797..126805,126965..126967,
                     126983..126985)
                     /locus_tag="Caur_0096"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213280"
     gene            complement(131222..131860)
                     /locus_tag="Caur_0097"
                     /db_xref="GeneID:5828123"
     CDS             complement(131222..131860)
                     /locus_tag="Caur_0097"
                     /note="PFAM: protein of unknown function DUF1405;
                     KEGG: rca:Rcas_3542 protein of unknown function DUF1405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633740.1"
                     /db_xref="GI:163845696"
                     /db_xref="InterPro:IPR009845"
                     /db_xref="GeneID:5828123"
                     /translation="MRQVRQLIDWIYALITGHPLLFWACMLINLFGVVWGGIVWYGPM
                     LASSPAWAWIFIPDCPAAALYATIAFILLRYGRQVPWFTAFAAFACIKYGLWTLAFWT
                     RHWLGAGTVEPLELMLFVSHIGLTCEGVLLATRIGPLGMTARAAVAAFFSLSILVDYG
                     LGFHPPLTWVVTPTFALWTAVILTSVLGFWLTRPSLVVAQRAEALGLQVPRE"
     misc_feature    complement(131285..131752)
                     /locus_tag="Caur_0097"
                     /note="Protein of unknown function (DUF1405); Region:
                     DUF1405; pfam07187"
                     /db_xref="CDD:254095"
     gene            complement(131916..132455)
                     /locus_tag="Caur_0098"
                     /db_xref="GeneID:5828124"
     CDS             complement(131916..132455)
                     /locus_tag="Caur_0098"
                     /note="PFAM: transferase hexapeptide repeat containing
                     protein;
                     KEGG: rca:Rcas_3543 transferase hexapeptide repeat
                     containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hexapaptide repeat-containing transferase"
                     /protein_id="YP_001633741.1"
                     /db_xref="GI:163845697"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="GeneID:5828124"
                     /translation="MNAMLETFSSDDLGSTATRKARLQSVPVPGPHNALWYFPQLAGG
                     YLRIMRNAALIQLARYTPFIAVKNMIYRWLGVNVAPHASVGLMVMFDIFFPEDITLGE
                     NCVIGYNTTILCHEVTRREWKRGPVVIGPDVTIGANCTILPGVVIGAGATVSAMSLVN
                     RDVPPGAFVGGVPIRRLDR"
     misc_feature    complement(131931..132320)
                     /locus_tag="Caur_0098"
                     /note="Acetyltransferase (isoleucine patch superfamily)
                     [General function prediction only]; Region: WbbJ; COG0110"
                     /db_xref="CDD:223188"
     misc_feature    complement(131925..132215)
                     /locus_tag="Caur_0098"
                     /note="Maltose O-acyltransferase (MAT)-like: This family
                     is composed of maltose O-acetyltransferase, galactoside
                     O-acetyltransferase (GAT), xenobiotic acyltransferase
                     (XAT) and similar proteins. MAT and GAT catalyze the
                     CoA-dependent acetylation of the...; Region: LbH_MAT_like;
                     cd04647"
                     /db_xref="CDD:100053"
     misc_feature    complement(order(131940..131942,131988..131990,
                     132045..132047,132054..132056,132060..132062,
                     132123..132125,132141..132143,132147..132149,
                     132183..132185,132207..132209,132213..132215))
                     /locus_tag="Caur_0098"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100053"
     misc_feature    complement(order(131937..131939,131943..131948,
                     131973..131978,131991..131996,132030..132032,
                     132045..132050,132054..132056,132201..132203,
                     132207..132209))
                     /locus_tag="Caur_0098"
                     /note="active site"
                     /db_xref="CDD:100053"
     misc_feature    complement(order(132201..132203,132207..132209))
                     /locus_tag="Caur_0098"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100053"
     misc_feature    complement(order(131925..131927,131937..131939,
                     131943..131948,131952..131954,131973..131978,
                     131991..131996,132000..132002,132030..132032,
                     132045..132050,132054..132056))
                     /locus_tag="Caur_0098"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100053"
     gene            132456..133331
                     /locus_tag="Caur_0099"
                     /db_xref="GeneID:5828125"
     CDS             132456..133331
                     /locus_tag="Caur_0099"
                     /note="PFAM: regulatory protein IclR; Transcriptional
                     regulator IclR;
                     KEGG: rxy:Rxyl_2850 transcriptional regulator, IclR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator IclR"
                     /protein_id="YP_001633742.1"
                     /db_xref="GI:163845698"
                     /db_xref="InterPro:IPR005471"
                     /db_xref="InterPro:IPR014757"
                     /db_xref="GeneID:5828125"
                     /translation="MLRTTNVSFAVPVGKKDDFPLHYDWKEVLNGEKRMVQSLDRAFD
                     VLEALAFADDDLSVSELSEQLDLPLATVHRLLSSLAARGYVTQEASTRRYGPGPRLLE
                     VAARAARSRRFDLIRIARAELVKLTAETGETSNLIVRQGDLAVYQEQIPSPHMVRMFT
                     EIGQRAPLYCTGGGKAILSALPIAELEQYLAGGHFERWTNRTITDPERLRAELMTARE
                     RGFALDDEEREEGVCCVAAPIFDRRGQVVGAISLSGPSTRLNRARAEELGPRVREAAL
                     ACSRQLGFHTTLTGK"
     misc_feature    132564..133304
                     /locus_tag="Caur_0099"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    132585..>132737
                     /locus_tag="Caur_0099"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(132624..132632,132657..132668,132672..132677,
                     132684..132689,132693..132698,132714..132722,
                     132735..132737)
                     /locus_tag="Caur_0099"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(132624..132626,132633..132635)
                     /locus_tag="Caur_0099"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    132921..133298
                     /locus_tag="Caur_0099"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            complement(134516..135217)
                     /locus_tag="Caur_0100"
                     /db_xref="GeneID:5828126"
     CDS             complement(134516..135217)
                     /locus_tag="Caur_0100"
                     /note="PFAM: iron dependent repressor; FeoA family
                     protein;
                     KEGG: rca:Rcas_3322 iron (metal) dependent repressor, DtxR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="YP_001633743.1"
                     /db_xref="GI:163845699"
                     /db_xref="InterPro:IPR001367"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:5828126"
                     /translation="MTPVEDPNLPGRITPAIEDYLKAIYLLQQQVGAVTTTLLGEQRG
                     SRPASVTGMIKKLAEMNLVQHTPYQGVILTPAGERIALEVIRHHRLLELYLVEALGYS
                     WDEVHEEAERLEHHISEKLEARIAERLGFPDFDPHGDPIPGIDGVLPTTRAIRLADLP
                     LNQVARIVRVRDQAAERLRYLADLGLVPGARVTVVASAPFDGPLTVQIGTNEPTPLDR
                     RLARTIEVEVESEAA"
     misc_feature    complement(134738..135181)
                     /locus_tag="Caur_0100"
                     /note="Mn-dependent transcriptional regulator
                     [Transcription]; Region: TroR; COG1321"
                     /db_xref="CDD:224240"
     misc_feature    complement(135005..135178)
                     /locus_tag="Caur_0100"
                     /note="Iron dependent repressor, N-terminal DNA binding
                     domain; Region: Fe_dep_repress; pfam01325"
                     /db_xref="CDD:110335"
     misc_feature    complement(134789..134998)
                     /locus_tag="Caur_0100"
                     /note="Iron dependent repressor, metal binding and
                     dimerization domain; Region: Fe_dep_repr_C; pfam02742"
                     /db_xref="CDD:251507"
     misc_feature    complement(134534..134758)
                     /locus_tag="Caur_0100"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:252322"
     gene            135421..136197
                     /locus_tag="Caur_0101"
                     /db_xref="GeneID:5828127"
     CDS             135421..136197
                     /locus_tag="Caur_0101"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: rle:RL0373 putative enoyl-CoA hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase"
                     /protein_id="YP_001633744.1"
                     /db_xref="GI:163845700"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="GeneID:5828127"
                     /translation="MSEESLVLSTIEGPIAILTLNRPQALNALSPALIDDLIRHLEAC
                     DADDTIRVIIITGAGRAFAAGADIKAMANATPIDMLTSGMIARWARIAAVRKPVIAAV
                     NGYALGGGCELAMMCDIIIASENAQFGQPEINLGIIPGAGGTQRLTRALGPYRAMELI
                     LTGATISAQEALAHGLVCRVCPPESLLDEARRIAQTIATKSPLAVQLAKEAVRMAAET
                     TVREGLAIELRNFYLLFASADQKEGMQAFIEKRAPNFSGR"
     misc_feature    135421..136194
                     /locus_tag="Caur_0101"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK05862"
                     /db_xref="CDD:180295"
     misc_feature    135439..136011
                     /locus_tag="Caur_0101"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(135496..135498,135502..135504,135598..135600,
                     135610..135624,135733..135735,135739..135747,
                     135811..135816,135823..135825)
                     /locus_tag="Caur_0101"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(135616..135618,135745..135747)
                     /locus_tag="Caur_0101"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(135685..135687,135709..135711,135772..135783,
                     135817..135828,135844..135846,135850..135858,
                     135862..135867,135880..135885,135889..135894,
                     135898..135903,135910..135912,135943..135945,
                     135952..135954,135997..135999,136006..136011)
                     /locus_tag="Caur_0101"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    <135982..136188
                     /locus_tag="Caur_0101"
                     /note="2-enoyl-CoA Hydratase C-terminal region; Region:
                     ECH_C; pfam13766"
                     /db_xref="CDD:258052"
     gene            136350..138815
                     /locus_tag="Caur_0102"
                     /db_xref="GeneID:5828128"
     CDS             136350..138815
                     /locus_tag="Caur_0102"
                     /note="KEGG: ppd:Ppro_2908 multi-sensor hybrid histidine
                     kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: response regulator receiver; ATP-binding region
                     ATPase domain protein; histidine kinase A domain protein;
                     PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
                     fold domain protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS sensor protein"
                     /protein_id="YP_001633745.1"
                     /db_xref="GI:163845701"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5828128"
                     /translation="MDIHERLRSLERENALLRQQLSILRAQISANLAPNQLPFDTLFH
                     QLPIPMVLFSLDGLAVAMNQANAQLVATPIDQVVGVYNIYNDPAAQKHGFVAAFESAR
                     RGQITTMPPTPYNTAEARLEGRVVDQQFWSETTYFPVYDVANRLILIGEINRDVTDWI
                     RVRDEEHRLAIALRDRERRFATLFDQLSLGIVVIEESGRILDCNRAVTAILGVERDEL
                     IGKMILQRTHPDDRERDLELWIELLNGERDSYTIEKRYFHKDGHIVYARMTCLAVRDE
                     NGEITFLVRLVEDVSARREAEAAIETGRRLLQDIIDQIPALIFVKDAEGRYLMVNERL
                     ASFSGYRPEEMIGKSDDELFAPALAAYYRAFDQEVIRERRPIQRDDDRWTADGLTAFT
                     TVKFPLFDHEGNLYGVAGISLDVTERRQLELERERIEQRLREAQRLESLGVMAGGIAH
                     DFNNLLVSVLGNVSLALNEVSADHSLYDLLVQIEQAALRATELTNHLLTYTGRHQPVM
                     QRIDLRRAVDEMQTILRSLVPHRIELIFHPSATPLPIEANIAQVRQVLMNLVINGAEA
                     IDGAGIVRITTELRELSATDMQKMEIGADQPPGRYAALIVQDTGHGMDELTKARIFDP
                     FFSTRFTGRGLGLAAVNGIIRAHRGALKLDTTLHAGTTFTIFWPLATAPDVSDDPPLP
                     SPSTVTSQPETTPGDGRMVLLVDDEPQVRQVAQRMLRRLGFTVHEAENSDIALQLMQE
                     YGSQIVLALIDLTMPGMTGDELATTLLEQFPTLRIILMSGFSQQELPPHLRTSGRVSF
                     LAKPFTLTTLTAAVTTALSSHTV"
     misc_feature    136875..137249
                     /locus_tag="Caur_0102"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    136908..137219
                     /locus_tag="Caur_0102"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(136956..136958,136968..136970,136986..136988,
                     137025..137036,137115..137117,137130..137132)
                     /locus_tag="Caur_0102"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(137016..137018,137028..137030,137052..137054,
                     137061..137066,137151..137153,137157..137159)
                     /locus_tag="Caur_0102"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    137283..137609
                     /locus_tag="Caur_0102"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    137289..137594
                     /locus_tag="Caur_0102"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(137337..137339,137349..137351,137367..137369,
                     137406..137417,137475..137477,137490..137492)
                     /locus_tag="Caur_0102"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(137397..137399,137409..137411,137433..137435,
                     137442..137447,137523..137525,137529..137531)
                     /locus_tag="Caur_0102"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    137661..137852
                     /locus_tag="Caur_0102"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(137679..137681,137691..137693,137703..137705,
                     137712..137714,137724..137726,137733..137735,
                     137784..137786,137796..137798,137805..137807,
                     137817..137819,137826..137828,137838..137840)
                     /locus_tag="Caur_0102"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    137697..137699
                     /locus_tag="Caur_0102"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    138006..138344
                     /locus_tag="Caur_0102"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(138021..138023,138033..138035,138042..138044,
                     138165..138167,138171..138173,138177..138179,
                     138183..138188,138249..138260,138306..138308,
                     138312..138314,138327..138332,138336..138338)
                     /locus_tag="Caur_0102"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    138033..138035
                     /locus_tag="Caur_0102"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(138177..138179,138183..138185,138249..138251,
                     138255..138257)
                     /locus_tag="Caur_0102"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    138453..138758
                     /locus_tag="Caur_0102"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(138462..138467,138600..138602,138624..138626,
                     138684..138686,138741..138743,138750..138755)
                     /locus_tag="Caur_0102"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    138600..138602
                     /locus_tag="Caur_0102"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(138609..138614,138618..138626)
                     /locus_tag="Caur_0102"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    138750..138758
                     /locus_tag="Caur_0102"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            138858..140105
                     /locus_tag="Caur_0103"
                     /db_xref="GeneID:5828129"
     CDS             138858..140105
                     /locus_tag="Caur_0103"
                     /note="KEGG: slo:Shew_0499 Xaa-Pro aminopeptidase family
                     enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro aminopeptidase family protein"
                     /protein_id="YP_001633746.1"
                     /db_xref="GI:163845702"
                     /db_xref="GeneID:5828129"
                     /translation="MTITPIEPSLRRQADVQNQWLAERLATLLPVLMERTGIDLWIVV
                     AREYNEDPVIMTLLPAPAMNARRRTILIFARRDDGVVDRLTLDRYGYGDLYQQVWNPD
                     TESQDDCLARIVGEYDPQRIGINTSATFAFADGISHHEYERLLAALGPLAARCVSAEP
                     LVIGWLERRIPAELAVYAELVALGHRLIATAFSRAVITPGITTTDDVVWWLRQTMHEA
                     GLRAWFQPTVSIQARGMPFNTPATRNRIWPGDLLHCDVGFCHLGLCTDQQQHAYVLAR
                     GETAPPPGLVTALAQANHLQDIVMAEMQVGRTGNQVLAAARERAISAGLQPSIYSHPL
                     GFHGHAAGPTIGLWDRQDGVPGAGDYPLYDETVYAIELNNVAIVPEWDDQPVRIALEE
                     DAVLTGGRMEWLHGRQTQLHVIE"
     misc_feature    139371..140057
                     /locus_tag="Caur_0103"
                     /note="A family including aminopeptidase P, aminopeptidase
                     M, and prolidase. Also known as metallopeptidase family
                     M24. This family of enzymes is able to cleave amido-,
                     imido- and amidino-containing bonds. Members exibit
                     relatively narrow substrate specificity...; Region:
                     APP_MetAP; cd01066"
                     /db_xref="CDD:238514"
     misc_feature    order(139566..139568,139620..139622,139653..139655,
                     139884..139886,139968..139970,140028..140030)
                     /locus_tag="Caur_0103"
                     /note="active site"
                     /db_xref="CDD:238514"
     gene            140184..141551
                     /locus_tag="Caur_0104"
                     /db_xref="GeneID:5828148"
     CDS             140184..141551
                     /locus_tag="Caur_0104"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: rca:Rcas_2058 major facilitator superfamily MFS_1"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_001633747.1"
                     /db_xref="GI:163845703"
                     /db_xref="InterPro:IPR001958"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:5828148"
                     /translation="MAVPETDTRRAIMTVLFVGVFMSALDSAIIGPIVPALRAAFAID
                     NTQVVLVTIIFTLCSLSSTTLMASLSDRYGRRNVYLLNVFGFALGSLIIALSHDLTMV
                     LIGRALQGVCAGGITPTASAVIGDVLPSAERAKALGLIGATSGMAFLVGPVLASLILA
                     VAAWQWIFLLNLPVAAAVIFLGWRALPRATAVHRATAATAFDWPGLTLLVLILVSITL
                     GINQLLDRLLGLTLWPWLFLLVALLTPLLAWREVRAPVPLLPPRLFTNRQLQIVYLLA
                     AGSGIAMGSIIFITSVAVNFGVPISQAGFFLLPLVFLASVTSIIAGRILPRIGGRMAM
                     LIGYGQLMIGTGLLGLPAAPFWLFILATLIMGSGLGIVVGGTLRALVLEEVAAGDRGV
                     AQSVINIAISIGTLIAVALMASIADAFDLSTAYLACTGAMALMTAISLALRRQFSPPS
                     TANAS"
     misc_feature    140220..141512
                     /locus_tag="Caur_0104"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    140229..141407
                     /locus_tag="Caur_0104"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(140262..140264,140271..140279,140283..140288,
                     140337..140339,140346..140351,140358..140360,
                     140370..140375,140379..140384,140520..140525,
                     140532..140537,140544..140549,140556..140558,
                     140592..140597,140604..140609,140625..140627,
                     141015..141017,141024..141029,141036..141041,
                     141048..141050,141090..141092,141102..141104,
                     141114..141116,141123..141125,141135..141137,
                     141282..141284,141291..141296,141303..141305,
                     141315..141320,141327..141329,141360..141365,
                     141372..141377,141384..141389,141396..141398)
                     /locus_tag="Caur_0104"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            141613..142758
                     /locus_tag="Caur_0105"
                     /db_xref="GeneID:5828149"
     CDS             141613..142758
                     /locus_tag="Caur_0105"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: rrs:RoseRS_4045 glycosyl transferase, group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001633748.1"
                     /db_xref="GI:163845704"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5828149"
                     /translation="MRVALVHDYLNQYGGAERVLEALHDLFPTAPVYTSIFDPTTMPA
                     AYRTWDIRTSFMQQLPAWRTQFRRYVALYPTAFERFDLSGYDLIISSSSAFAKGIIPR
                     PGALHICYCHTPMRFAWRTDDYVAREQINGIQAHLLPFLLNYLRIWDTVSANRVDLFV
                     ANSHEVAGRIARYYRRPAKVIPPPVDLPPYEPQPPEEFYLAGGRLIPYKRLELAIEAF
                     NRLRLPLKIFGDGRDRARLERMAGPNIEFLGWVDEATRLDLFARCRAFIFPGEEDFGI
                     TPLEVLAVGRPVIAYAAGGALETLIEGVTGRFFYQPTAAALAAAVALSRTDTIDPLVL
                     RHHAEQFSRERFLNTFRNFVTEALTAQREGRLFEFEQSLTGQRLLAV"
     misc_feature    141613..142686
                     /locus_tag="Caur_0105"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    141616..142665
                     /locus_tag="Caur_0105"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases.  wbaZ in Salmonella
                     enterica has been shown to possess the mannosyl
                     transferase activity. The members of this family are found
                     in certain bacteria and Archaea; Region: GT1_wbaZ_like;
                     cd03804"
                     /db_xref="CDD:99976"
     misc_feature    order(141655..141657,142216..142224,142375..142377,
                     142441..142443)
                     /locus_tag="Caur_0105"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99976"
     gene            142857..143489
                     /locus_tag="Caur_0106"
                     /db_xref="GeneID:5828150"
     CDS             142857..143489
                     /locus_tag="Caur_0106"
                     /note="PFAM: lipopolysaccharide biosynthesis protein;
                     KEGG: rca:Rcas_3666 lipopolysaccharide biosynthesis
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="YP_001633749.1"
                     /db_xref="GI:163845705"
                     /db_xref="InterPro:IPR003856"
                     /db_xref="GeneID:5828150"
                     /translation="MELTTLLRIVRRFWLLMLVPALIAGGLSLWFDLQQPPRYTATAR
                     LLITYPATTATDSAEIWQITEYIIDDMPQVVSSASFAAKVSPLLATRNINLTLAEIQQ
                     GLRINPLHRAVDISGEASSPAAAQALVEAAITVLQTEGLTFWGRTDTQLSVVVLDGVG
                     TPQPATSLRSVVFDAALRTALGLIAGFALAVAATVLYERRENRLWKSATM"
     misc_feature    142857..>143183
                     /locus_tag="Caur_0106"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell envelope biogenesis,
                     outer membrane]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     gene            143468..144121
                     /locus_tag="Caur_0107"
                     /db_xref="GeneID:5828151"
     CDS             143468..144121
                     /locus_tag="Caur_0107"
                     /note="PFAM: lipopolysaccharide biosynthesis protein;
                     KEGG: rrs:RoseRS_4043 lipopolysaccharide biosynthesis
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="YP_001633750.1"
                     /db_xref="GI:163845706"
                     /db_xref="InterPro:IPR003856"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:5828151"
                     /translation="MEIRDYVNVLVKRWWVIVLTAIAAVGSAYVISKLLPQTYRSQAV
                     YLALANQADNGLNIVLRNSMNSYRELVMQPSVLDQISQQIGLDISGERLMEDVNIQPR
                     PDEQKIVIEVDLPRLDQSQALADAVGERIVAEVNRINATLEGTARINVTRIQPARLVE
                     IRPNTRINMLAGAILGLVLGIVLAFVLEYLDDTLKTSEDVERFVGLPTLGAIPLSER"
     misc_feature    143468..144106
                     /locus_tag="Caur_0107"
                     /note="Capsular polysaccharide biosynthesis protein [Cell
                     envelope biogenesis, outer membrane]; Region: COG3944"
                     /db_xref="CDD:226453"
     misc_feature    143468..143806
                     /locus_tag="Caur_0107"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     gene            144194..144838
                     /locus_tag="Caur_0108"
                     /db_xref="GeneID:5828152"
     CDS             144194..144838
                     /locus_tag="Caur_0108"
                     /EC_number="2.7.10.2"
                     /note="TIGRFAM: capsular exopolysaccharide family;
                     KEGG: rca:Rcas_3668 non-specific protein-tyrosine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide tyrosine-protein kinase"
                     /protein_id="YP_001633751.1"
                     /db_xref="GI:163845707"
                     /db_xref="InterPro:IPR005702"
                     /db_xref="GeneID:5828152"
                     /translation="MIVTSSSEQVLITLREPASAAAEAYRTLRTNILFSSLDKPIHTL
                     LITSAEPTPEKSLTAANLAVTMAQAEQRVLLVDCDLRQPMLHTIFGLANEQGLTSAIL
                     DQEAPLAIQPTEVPGLSLLPSGPLPPRPADLLGSRRMEGLLHRLRQAADIVIFDTPPV
                     QNVTDALVLSTRVDGVLLVVQAGRSRRDRVREARQKLEKVKANLLGVVLSNARL"
     misc_feature    144260..144820
                     /locus_tag="Caur_0108"
                     /note="capsular exopolysaccharide family; Region: eps_fam;
                     TIGR01007"
                     /db_xref="CDD:130080"
     misc_feature    144329..144760
                     /locus_tag="Caur_0108"
                     /note="AAA domain; Region: AAA_31; pfam13614"
                     /db_xref="CDD:257927"
     gene            144907..145593
                     /locus_tag="Caur_0109"
                     /db_xref="GeneID:5828153"
     CDS             144907..145593
                     /locus_tag="Caur_0109"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     KEGG: rca:Rcas_1176 two component transcriptional
                     regulator, winged helix family"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="YP_001633752.1"
                     /db_xref="GI:163845708"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:5828153"
                     /translation="MQPTILVVDDEASIRNVAKAYLEHAGYRVLCATTGPEGLQMALE
                     EQPDLIVLDLMLPGMDGMEITARLRERSDVYILMLTARSDEMDRVAGLRVGADDYLTK
                     PFSPRELVARVEAILRRQRNKTAKSSLMRFTHVEIDPEAREARANGQLLELTPTEFDL
                     LLALARNHNRVLSREDLIEKVWGADFFGTDRVVDVYVSQLRRKIEAITGENVIRTARG
                     VGYRFVDTPA"
     misc_feature    144913..145587
                     /locus_tag="Caur_0109"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    144922..145257
                     /locus_tag="Caur_0109"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(144931..144936,145063..145065,145087..145089,
                     145144..145146,145201..145203,145210..145215)
                     /locus_tag="Caur_0109"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    145063..145065
                     /locus_tag="Caur_0109"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(145072..145077,145081..145089)
                     /locus_tag="Caur_0109"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    145210..145218
                     /locus_tag="Caur_0109"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    145297..145575
                     /locus_tag="Caur_0109"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(145366..145368,145423..145428,145480..145482,
                     145489..145491,145513..145518,145549..145551,
                     145564..145566)
                     /locus_tag="Caur_0109"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            145630..146682
                     /locus_tag="Caur_0110"
                     /db_xref="GeneID:5828154"
     CDS             145630..146682
                     /locus_tag="Caur_0110"
                     /EC_number="2.7.13.3"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     histidine kinase HAMP region domain protein; histidine
                     kinase A domain protein;
                     KEGG: rrs:RoseRS_0804 integral membrane sensor signal
                     transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001633753.1"
                     /db_xref="GI:163845709"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:5828154"
                     /translation="MRFWRQLRWQMIGAQMLVVVVGVVTLNLTANILIEQSIAPDQVA
                     TVRTAVVQALTVAAVAATIAGLTTSILLVQVILRSLRSIARSSRRIAAGRYDERVTVP
                     ASDELRAVAESFNQMAEALEQIEQRRITMIGNVAHELRTPLAGIEGYLEGLIDGVLPN
                     TADTFLDMKQEVRRLRRLVDDLQTLSRVEAGQIALHFTTFDVNDVIRRVVAQIQPQVL
                     DSCLQVQFAPDQQPILVHADADRVAQILLNLLGNAVRYTPEGGCITVRSELNNDNVQV
                     IVEDTGIGISAEHLPFIFERFYRADPSRARTSGGSGIGLTIARHLAWAMGGDISAASA
                     GIGKGSTFTLTLPRAG"
     misc_feature    145669..146676
                     /locus_tag="Caur_0110"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    145855..145998
                     /locus_tag="Caur_0110"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(145855..145860,145867..145872,145876..145881,
                     145888..145893,145897..145899,145945..145950,
                     145954..145959,145966..145971,145975..145980,
                     145987..145992)
                     /locus_tag="Caur_0110"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    146002..146190
                     /locus_tag="Caur_0110"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(146020..146022,146032..146034,146044..146046,
                     146053..146055,146065..146067,146074..146076,
                     146122..146124,146131..146133,146140..146142,
                     146152..146154,146161..146163,146173..146175)
                     /locus_tag="Caur_0110"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    146038..146040
                     /locus_tag="Caur_0110"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    146359..146667
                     /locus_tag="Caur_0110"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(146371..146373,146383..146385,146392..146394,
                     146461..146463,146467..146469,146473..146475,
                     146479..146484,146563..146574,146620..146622,
                     146626..146628,146644..146649,146653..146655)
                     /locus_tag="Caur_0110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    146383..146385
                     /locus_tag="Caur_0110"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(146473..146475,146479..146481,146563..146565,
                     146569..146571)
                     /locus_tag="Caur_0110"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            147218..147328
                     /locus_tag="Caur_0111"
                     /db_xref="GeneID:5828155"
     CDS             147218..147328
                     /locus_tag="Caur_0111"
                     /note="KEGG: rrs:RoseRS_3211 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633754.1"
                     /db_xref="GI:163845710"
                     /db_xref="GeneID:5828155"
                     /translation="MQTLQPKNPYVRIALRRAARGTGSSDAFLDQRTALQ"
     gene            147383..147853
                     /locus_tag="Caur_0112"
                     /db_xref="GeneID:5828156"
     CDS             147383..147853
                     /locus_tag="Caur_0112"
                     /note="KEGG: rrs:RoseRS_3211 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633755.1"
                     /db_xref="GI:163845711"
                     /db_xref="GeneID:5828156"
                     /translation="MALRAYAPERLTQDVDIIIHARDEQVARAAFTAAGYRIGNPLPI
                     SRFTAHPQDETGYSIDVLVLNEPWLDEALAQPVCDCAGFPVLARQFLILMKLQAGRAQ
                     DIADITRLLRRTDHTERSIARTTVATYAPDLIDDFDALVVLTDLEFGTESSAAT"
     gene            complement(148444..150741)
                     /locus_tag="Caur_0113"
                     /db_xref="GeneID:5828157"
     CDS             complement(148444..150741)
                     /locus_tag="Caur_0113"
                     /EC_number="2.4.1.129"
                     /note="PFAM: penicillin-binding protein transpeptidase;
                     Penicillin-binding protein dimerisation domain;
                     KEGG: rca:Rcas_1673 peptidoglycan glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan glycosyltransferase"
                     /protein_id="YP_001633756.1"
                     /db_xref="GI:163845712"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR005311"
                     /db_xref="GeneID:5828157"
                     /translation="MARLIALRSILLLVVVVLVSRLAQLQLIETDTQRFGADIEVTTR
                     RYLTNQPRRGEIFDARGVLLAESVPIYNLAVIPGQLPSSSAAPEQRALTLARLAQIAE
                     LPATLVIDPGTAIDTTPGLRSDLRSFGSLPTASDVVTMTIAPSDVLRALDVSQKYRDV
                     ATLVNPIEQLLTQANVRSYQPIVIKEDISPELALALRENANYLPGARVVEGFRRRYPL
                     SGEIPSLSHLLGYVGRINACELVAVNPASSWLRALTDITANAPTCGLMAKSIEPTSVG
                     LPPYLSSDQIGKDGLEGAYESVLRGQMGIDSLLVDALQRPVSGVTTLRAVANGHDLIL
                     TIDTRFQAEVERILQRWINVGEERRLAAREAHKRAYEPIVAGVAVALDPRDGRILAMV
                     SLPDYDNNIWVDPARIAELQALLAPPDAETQQTLQRLAPFTNRAIAGLYPPGSTVKQF
                     VGAVALQQGIIAADTQLRDPGLLRLIERSGAEFILPNSVRNRDNGLINVRDALRLSSN
                     VFFASIAGGNDQAINLDQRALRITGLGIDQLVEGLSWFNFGRPTGVDLVGEASGRVPT
                     QAWKAQVLREAWTTGDTYNTAIGQGYLEVTPLQLAVAAGAVATDGTLYRPHLVDRIVD
                     ENGQLIQQMQPEAIGQVPIDPRHLAAIREGLFASITDGLGVAAREVCSGLRIAGKTGT
                     AEFGPLLTTADGRLVRQSHAWFVGFAPYENPEIVVAVLVEGVGDLNDGSSTIAVPAVT
                     QIMQAYFGITPPANRPAICPVLPGE"
     sig_peptide     complement(150670..150741)
                     /locus_tag="Caur_0113"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.949) with cleavage site probability 0.539 at
                     residue 24"
     misc_feature    complement(149779..150594)
                     /locus_tag="Caur_0113"
                     /note="Penicillin-binding Protein dimerization domain;
                     Region: PBP_dimer; pfam03717"
                     /db_xref="CDD:252119"
     misc_feature    complement(148498..150591)
                     /locus_tag="Caur_0113"
                     /note="penicillin-binding protein 2; Region: pbp2_mrdA;
                     TIGR03423"
                     /db_xref="CDD:234204"
     misc_feature    complement(148510..149616)
                     /locus_tag="Caur_0113"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; pfam00905"
                     /db_xref="CDD:250215"
     gene            complement(150787..151326)
                     /locus_tag="Caur_0114"
                     /db_xref="GeneID:5828158"
     CDS             complement(150787..151326)
                     /locus_tag="Caur_0114"
                     /note="KEGG: rca:Rcas_1672 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633757.1"
                     /db_xref="GI:163845713"
                     /db_xref="GeneID:5828158"
                     /translation="MGNSQPRRLEERLARELGLLLILLVIALIQVTLLTGPTGFSVPI
                     LLVLAIARALVGSSTAEPVRGLIRSLWWAFYGGLALDVLGSLPIGSHAIAQLLAVIVV
                     GLATRRFAVERPIVPLLAVAFGTLIYEAVLWLIVLPPISDWQTYGLIVMLPSLLLALI
                     PTLPVVAIVHRLVRNTEYQ"
     misc_feature    complement(150847..>151119)
                     /locus_tag="Caur_0114"
                     /note="rod shape-determining protein MreD; Region: MreD;
                     cl01087"
                     /db_xref="CDD:242295"
     gene            complement(151299..152207)
                     /locus_tag="Caur_0115"
                     /db_xref="GeneID:5828159"
     CDS             complement(151299..152207)
                     /locus_tag="Caur_0115"
                     /note="in some organisms this protein is a transmembrane
                     protein while in others it is periplasmic; involved in
                     some organisms with other components of the MreBCD complex
                     and with penicillin binding proteins in the periplasm or
                     cell wall"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="YP_001633758.1"
                     /db_xref="GI:163845714"
                     /db_xref="InterPro:IPR007221"
                     /db_xref="GeneID:5828159"
                     /translation="MRDFLDERPLKLRREVAGDRGYWRVFALALSLVLVSVLLIVLDR
                     QGVIAPARLMVRETIQPLAGWLTQRRSELLSWWATPRDAATMQARIAELEAENTRLAA
                     EVLRLEQARVENIFLRQQLAITQSYPWTILGAEVMIRAPDAARRVLTIARGANDGVRV
                     GMAVIGQQPGGPPALIGVVEAVGPRTADVLMITDISSQLSVRLLQADTAPLGLMQGQW
                     QRGSRMRVELIDRSITMREGDHVVTAGISGALNLPLDLASMPTAVPIGVVEAVRQEGQ
                     RQIGEIRPFVDPDQVRYVWVILSQDD"
     misc_feature    complement(151302..152078)
                     /locus_tag="Caur_0115"
                     /note="rod shape-determining protein MreC; Provisional;
                     Region: PRK13922"
                     /db_xref="CDD:237560"
     gene            complement(152211..153290)
                     /locus_tag="Caur_0116"
                     /db_xref="GeneID:5828160"
     CDS             complement(152211..153290)
                     /locus_tag="Caur_0116"
                     /note="functions in MreBCD complex in some organisms"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreB"
                     /protein_id="YP_001633759.1"
                     /db_xref="GI:163845715"
                     /db_xref="InterPro:IPR001023"
                     /db_xref="InterPro:IPR004753"
                     /db_xref="GeneID:5828160"
                     /translation="MGLNPFNTIFGAFSRDLGIDLGTANTLVHVRGKGIVISEPSVVA
                     IDTRTKKVHAVGAEAKAMVGKTPANIVAVRPLKDGVIADFDVVEQMLAYFIKKAHTYA
                     ALPLIDPRPRVVVGVPSGVTEVEKRAAREAALNAKAREAYVVEEPMAAAIGAGLPVEE
                     PIGSMIVDIGGGTTEIAVIALGGIVINHSIRIAGDEIDEAIIQFARREYNLLIGERMA
                     EKAKIAAGSAYPLDEEIKVVLRGRDLLTGLPKAIEVSSVELREGIAGPVNAIVAEVRA
                     ALEETPPELVADIMEHGIMLAGGGSLLHGLDKRIAAETKMPVHIAQDPLSCVARGAGK
                     MVEHFDNSVYQDILMRTQTTRRVRR"
     misc_feature    complement(152271..153263)
                     /locus_tag="Caur_0116"
                     /note="rod shape-determining protein MreB; Provisional;
                     Region: PRK13927"
                     /db_xref="CDD:237562"
     misc_feature    complement(152271..153242)
                     /locus_tag="Caur_0116"
                     /note="MreB and similar proteins; Region: MreB_like;
                     cd10225"
                     /db_xref="CDD:212668"
     misc_feature    complement(order(152307..152309,152316..152318,
                     152382..152387,152391..152399,152622..152627,
                     152634..152636,152706..152711,152772..152783,
                     152787..152789,152853..152855,153054..153056,
                     153216..153227,153231..153233))
                     /locus_tag="Caur_0116"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212668"
     misc_feature    complement(order(152787..152789,153231..153233))
                     /locus_tag="Caur_0116"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    complement(order(152271..152273,152343..152345,
                     152439..152441,152448..152450,152538..152540,
                     152547..152549,152571..152573,152640..152642,
                     152646..152648,152742..152744,152802..152804,
                     152808..152810,153081..153083,153105..153107,
                     153153..153155))
                     /locus_tag="Caur_0116"
                     /note="putative protofilament interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    complement(order(152325..152327,152334..152336,
                     152340..152342,152415..152423,152799..152801,
                     152823..152828))
                     /locus_tag="Caur_0116"
                     /note="RodZ interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212668"
     gene            153639..155729
                     /locus_tag="Caur_0117"
                     /db_xref="GeneID:5828161"
     CDS             153639..155729
                     /locus_tag="Caur_0117"
                     /EC_number="6.6.1.1"
                     /note="KEGG: mba:Mbar_A1776 magnesium-chelatase subunit;
                     PFAM: magnesium chelatase ChlI subunit; von Willebrand
                     factor type A;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase"
                     /protein_id="YP_001633760.1"
                     /db_xref="GI:163845716"
                     /db_xref="InterPro:IPR000523"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5828161"
                     /translation="MNITNLPQRPVYPFSAIVGQERLKRALILNAINSRIGGVLIRGE
                     KGTAKSTAVRALTRLLPSITVVVDCPYSCDPDTPAALCADCQERLKQGPLPTMVRPIR
                     LVELPVSASEDRVVGSLDLEHAITEGQRRFEPGLLAQVNRGVLYVDEVNLLDDHLVDL
                     LLDAAAMGINTVEREGVSVSHPARFILVGTMNPEEGELRPQLLDRFGLAVEVVGLTDV
                     NDRIAVIERRMAYEADPIGFIQQWQAAEETLAQRIAAARALLPHVRIDRTDMAVVASL
                     CIEMGVDGHRADLTILETARTHAAWSGRRTLVAEDIRLAAELALPHRMRRQPFGEVKL
                     DEQRLASILDQYGKRAEEVSVQAEVKKNPDLTDVSETNDEGGNESGGGSTTMPLGGAG
                     QPEATAPVSEQQTGGTQHRAGDLFKPRRLEATPDRTQRRAPGRRSRSRTTRKQGRYIT
                     SRRATKVTDLALDATLREAAIYQRKRRTELLHTVGMPHRRRPKILIKRTDLRQKVRVR
                     RTRNAVCFVVDASWSMAAEERMQATKAAVLSLLRDAYQRRDQVGLVSFQRDYARVLLP
                     LTNSVELAQRRLQSMPTGGKTPLSRGMLTAFELLERARRRDAEVVPLMVLLTDGQANV
                     SISDLPPQQEAYRIAEMIAEHQIHAIVIDTEHPHFERGLSRRLAEYLRGTYYRLEDLH
                     DDGLVRAVRQQMRS"
     misc_feature    153672..155675
                     /locus_tag="Caur_0117"
                     /note="cobaltochelatase subunit; Region: Cob-chelat-sub;
                     TIGR02442"
                     /db_xref="CDD:233870"
     misc_feature    153690..154274
                     /locus_tag="Caur_0117"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    153765..153788
                     /locus_tag="Caur_0117"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(153768..153791,154080..154082,154209..154211)
                     /locus_tag="Caur_0117"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    154068..154085
                     /locus_tag="Caur_0117"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    154251..154253
                     /locus_tag="Caur_0117"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    155172..155714
                     /locus_tag="Caur_0117"
                     /note="Magnesium chelatase: Mg-chelatase catalyses the
                     insertion of Mg into protoporphyrin IX (Proto). In
                     chlorophyll biosynthesis, insertion of Mg2+ into
                     protoporphyrin IX is catalysed by magnesium chelatase in
                     an ATP-dependent reaction. Magnesium chelatase is...;
                     Region: vWA_Magnesium_chelatase; cd01451"
                     /db_xref="CDD:238728"
     misc_feature    order(155193..155195,155199..155201,155205..155207,
                     155397..155399,155493..155495)
                     /locus_tag="Caur_0117"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238728"
     gene            155819..157381
                     /locus_tag="Caur_0118"
                     /db_xref="GeneID:5828042"
     CDS             155819..157381
                     /locus_tag="Caur_0118"
                     /note="PFAM: RNA binding S1 domain protein;
                     KEGG: rrs:RoseRS_3968 RNA binding S1 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S1 domain-containing protein"
                     /protein_id="YP_001633761.1"
                     /db_xref="GI:163845717"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="GeneID:5828042"
                     /translation="MTDQVRREEVAAGELPDTPHTAASAPAAEAAVAAHEQAAEAAAP
                     TPEEEAVLPAATGEADASATAPTAAGESASSGSEATGASFTPVSDDQPHKPRRLKDLQ
                     PGMELEGKVTSIALYGVFVDIGVGRDGLVHISEMSDRRIETPSEVVQIGDTVKVWVKS
                     IEPEARRISLTMRDPARAETPRRARQPQPQQQQPRRQEVDREKLAALRVGDVVEGVIT
                     GFAPFGAFADIGVGKDGLIHVSELAEGRVEKPEDAVKVGERYQFKILEIDGEAARISL
                     SLRRALRTQRMQQLETGQILEGTVSGIAPFGAFVDIGVGRDGLVHISALAPHRVEKVE
                     DVVKVGDKVKVKVLGVDQQSKRISLTMRLEEEQPASETTTEPATTPAEPAPARAGRSN
                     MERFAAAAQAARERSERGERGERGERSERGERGERGERNERRDRRDRRAAQTAPETYV
                     VGEDDDETFEGNATLEDLLTKFGGSSNRRDRDRDRRRRDYDDDEDDMERPTNRRQRDA
                     IRRTLQQIGHDE"
     misc_feature    <156107..156928
                     /locus_tag="Caur_0118"
                     /note="Ribosomal protein S1 [Translation, ribosomal
                     structure and biogenesis]; Region: RpsA; COG0539"
                     /db_xref="CDD:223613"
     misc_feature    156128..156331
                     /locus_tag="Caur_0118"
                     /note="S1_Tex: The C-terminal S1 domain of a transcription
                     accessory factor called Tex, which has been characterized
                     in Bordetella pertussis and Pseudomonas aeruginosa. The
                     tex gene is essential in Bortella pertusis and is named
                     for its role in toxin expression; Region: S1_Tex; cd05685"
                     /db_xref="CDD:240190"
     misc_feature    order(156152..156154,156176..156178,156206..156208,
                     156212..156214)
                     /locus_tag="Caur_0118"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240190"
     misc_feature    156446..156649
                     /locus_tag="Caur_0118"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(156470..156472,156494..156496,156524..156526,
                     156530..156532)
                     /locus_tag="Caur_0118"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    156695..156898
                     /locus_tag="Caur_0118"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(156719..156721,156743..156745,156773..156775,
                     156779..156781)
                     /locus_tag="Caur_0118"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            157515..157688
                     /locus_tag="Caur_0119"
                     /db_xref="GeneID:5828043"
     CDS             157515..157688
                     /locus_tag="Caur_0119"
                     /note="PFAM: ribosomal protein L34;
                     KEGG: rca:Rcas_1423 ribosomal protein L34"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="YP_001633762.1"
                     /db_xref="GI:163845718"
                     /db_xref="InterPro:IPR000271"
                     /db_xref="GeneID:5828043"
                     /translation="MPKRTWQPKRIPRRRKHGFRARMATKDGREVLRRRRLKGRWKLT
                     VSDERRAVRRGHR"
     misc_feature    157518..157649
                     /locus_tag="Caur_0119"
                     /note="Ribosomal protein L34; Region: Ribosomal_L34;
                     pfam00468"
                     /db_xref="CDD:249883"
     gene            157782..158189
                     /locus_tag="Caur_0120"
                     /db_xref="GeneID:5828044"
     CDS             157782..158189
                     /locus_tag="Caur_0120"
                     /note="TIGRFAM: ribonuclease P protein component;
                     PFAM: ribonuclease P protein;
                     KEGG: rca:Rcas_1424 ribonuclease P protein component"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="YP_001633763.1"
                     /db_xref="GI:163845719"
                     /db_xref="InterPro:IPR000100"
                     /db_xref="GeneID:5828044"
                     /translation="MRRAYRLRRPEQFRRVRQEGRTFTSPWLILTVAPARRRTLRCGF
                     VVSRRVGGAVQRNRARRRVREAVRLLLPRLTAGYDMVFTIRTPEVIDAPFTQLQDDIT
                     ALLRQACLLPAPTNETVSPVSDTPLPQHERGSQ"
     misc_feature    157788..158108
                     /locus_tag="Caur_0120"
                     /note="Ribonuclease P; Region: Ribonuclease_P; pfam00825"
                     /db_xref="CDD:250159"
     gene            158186..159130
                     /locus_tag="Caur_0121"
                     /db_xref="GeneID:5828045"
     CDS             158186..159130
                     /locus_tag="Caur_0121"
                     /note="PFAM: 60 kDa inner membrane insertion protein;
                     KEGG: rrs:RoseRS_3965 60 kDa inner membrane insertion
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa inner membrane insertion protein"
                     /protein_id="YP_001633764.1"
                     /db_xref="GI:163845720"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="GeneID:5828045"
                     /translation="MNIWSAFVGLLEQLLLFFSSLTGNMALGIVLFTIAARLFILPLT
                     LSSLRSSRRMQEVQPILKEIQRKYGKDPQRLQEETLRVYREHKINPVGGCLPLLLQLP
                     IFFGVYQAVYHLMVPEQRVNLSAAAAEMLKDERLAQILAAPFFGMDLGVPAFGPNGFA
                     GFAYLILPVLSIVLQLMQQLMATPRVQDPQQKAFTQAMLIMPFVFGYIAFTFPTGAVL
                     YWVVSSVVGVVQQYFTSGWGSLANYLRFLPPDNRPTPTLALASASTGSTSESQPETPK
                     IDFWSVMRPLTEAAVEESDPTHTEQRPSRQHPNPRRRR"
     misc_feature    158255..158887
                     /locus_tag="Caur_0121"
                     /note="membrane protein insertase, YidC/Oxa1 family,
                     C-terminal domain; Region: yidC_oxa1_cterm; TIGR03592"
                     /db_xref="CDD:234272"
     gene            159170..159838
                     /locus_tag="Caur_0122"
                     /db_xref="GeneID:5828046"
     CDS             159170..159838
                     /locus_tag="Caur_0122"
                     /note="PFAM: single-stranded nucleic acid binding R3H
                     domain protein;
                     KEGG: rrs:RoseRS_3964 single-stranded nucleic acid binding
                     R3H domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded nucleic acid binding R3H
                     domain-containing protein"
                     /protein_id="YP_001633765.1"
                     /db_xref="GI:163845721"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="GeneID:5828046"
                     /translation="MKRIEISERTVAEAVELALAQLGRDRDEVAIEVLDPGENGDEAL
                     VRVTVVEDEEEAPSVEKVSEIAQRVLEDLLERMDIHAYVTAVISHATGPNGEPEATIT
                     LHVEGADEEAMGLLIGRRGETLRSLQFLLNLLVSRRVQKWPQLVVDVGNYRQRRQESL
                     ESLARRMAERVRQTGRPIMLEPMAAYERRIVHLALRNDKTIYTESSGEGENRKIVIYP
                     AKHS"
     misc_feature    159179..159826
                     /locus_tag="Caur_0122"
                     /note="Predicted RNA-binding protein [General function
                     prediction only]; Region: Jag; COG1847"
                     /db_xref="CDD:224760"
     misc_feature    159182..159316
                     /locus_tag="Caur_0122"
                     /note="Jag N-terminus; Region: Jag_N; pfam14804"
                     /db_xref="CDD:258941"
     misc_feature    159368..159634
                     /locus_tag="Caur_0122"
                     /note="jag_K homology RNA-binding domain. The KH domain is
                     found in proteins homologous to the Bacillus subtilis
                     protein Jag, which is associated with SpoIIIJ and is
                     necessary for the third stage of sporulation.  The KH
                     motif is a beta-alpha-alpha-beta-beta...; Region: jag_KH;
                     cd02414"
                     /db_xref="CDD:239097"
     misc_feature    159521..159532
                     /locus_tag="Caur_0122"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239097"
     misc_feature    159626..159826
                     /locus_tag="Caur_0122"
                     /note="R3H domain found in proteins homologous to Bacillus
                     subtilus Jag, which is associated with SpoIIIJ. SpoIIIJ is
                     necessary for the third stage of sporulation. The name of
                     the R3H domain comes from the characteristic spacing of
                     the most conserved arginine...; Region: R3H_jag; cd02644"
                     /db_xref="CDD:100073"
     misc_feature    order(159731..159733,159743..159745)
                     /locus_tag="Caur_0122"
                     /note="RxxxH motif; other site"
                     /db_xref="CDD:100073"
     gene            complement(160491..160874)
                     /locus_tag="Caur_0123"
                     /db_xref="GeneID:5828047"
     CDS             complement(160491..160874)
                     /locus_tag="Caur_0123"
                     /note="PFAM: globin;
                     KEGG: rrs:RoseRS_0783 globin"
                     /codon_start=1
                     /transl_table=11
                     /product="globin"
                     /protein_id="YP_001633766.1"
                     /db_xref="GI:163845722"
                     /db_xref="InterPro:IPR001486"
                     /db_xref="GeneID:5828047"
                     /translation="MSEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPADLEPG
                     KEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVP
                     EPARSVMENYFRHAAQAMMNRLGED"
     misc_feature    complement(160506..160862)
                     /locus_tag="Caur_0123"
                     /note="Truncated hemoglobins (trHbs) are a family of
                     oxygen-binding heme proteins found in cyanobacteria,
                     eubacteria, unicellular eukaryotes, and plants. The
                     truncated hemoglobins have a characteristic two-over-two
                     alpha helical folding pattern that is distinct...; Region:
                     Trunc_globin; cd00454"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(160536..160538,160545..160547,
                     160578..160580,160587..160589,160599..160601,
                     160608..160610,160707..160709,160716..160721,
                     160806..160808,160815..160820,160827..160832,
                     160845..160847))
                     /locus_tag="Caur_0123"
                     /note="apolar tunnel; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(160515..160517,160527..160529,
                     160611..160613,160620..160622,160641..160643,
                     160650..160655,160665..160667,160671..160673,
                     160689..160691,160719..160724,160731..160733,
                     160743..160745,160764..160769,160803..160805))
                     /locus_tag="Caur_0123"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(160575..160583,160593..160595,
                     160602..160604,160785..160790,160797..160799))
                     /locus_tag="Caur_0123"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238256"
     gene            160995..161870
                     /locus_tag="Caur_0124"
                     /db_xref="GeneID:5828048"
     CDS             160995..161870
                     /locus_tag="Caur_0124"
                     /note="KEGG: tte:TTE1925 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633767.1"
                     /db_xref="GI:163845723"
                     /db_xref="GeneID:5828048"
                     /translation="MSYETLTITSRRLRLTVLAAGGPRILALHLDNGPNLLAETPNAR
                     WETPWGEFVLLGGHRLWHAPEAFPRSYWPDLNGPAAEQIDHGVTLRSAVDPGYIAKSL
                     TVTLDPEQPRLHLQHTLTNHGLWPVELAPWAITQLAPGGKAILPLHNGQPPANPLLPN
                     RQIAFWPYTPLPDPRLAFCDDFILIDTAIAGPPAKVGAHSAAGWLAYLHQATLFIKRT
                     VYQPAAHYPDNNCNLEIYYDRGCTELETLAPLCRLDPGASVSHTEIWQVIPWTDDLDQ
                     SDLFTTLAQRAAEMV"
     misc_feature    161004..161801
                     /locus_tag="Caur_0124"
                     /note="Domain of unknown function (DUF4380); Region:
                     DUF4380; pfam14315"
                     /db_xref="CDD:258490"
     gene            162312..163511
                     /locus_tag="Caur_0125"
                     /db_xref="GeneID:5828049"
     CDS             162312..163511
                     /locus_tag="Caur_0125"
                     /EC_number="3.6.3.16"
                     /note="KEGG: plt:Plut_1173 anion-transporting ATPase;
                     TIGRFAM: arsenite-activated ATPase ArsA;
                     PFAM: Anion-transporting ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite-activated ATPase ArsA"
                     /protein_id="YP_001633768.1"
                     /db_xref="GI:163845724"
                     /db_xref="InterPro:IPR003348"
                     /db_xref="GeneID:5828049"
                     /translation="MRTLIFTGKGGVGKTSVAAATALRAADRGLKTLVMSTDPAHSLA
                     DSLDLEGPLGPEPVRITKNLDALEVSIYHDIESNWGIVREHFAQLMAEQGVQGILADE
                     MSVLPGMEEAFPLIRIKKHKERGDYDLLVIDCAPTGETLRLLSAPETFKWAINMLRGA
                     ERYVIRPLIRPMSKITPGLNKMVAPPEVYDAVDEMFRQMEGVTATLANPRETSIRLVM
                     NPEKMVIKESQRALTYLSMYGMTVDMVVVNKILPLDQDSGYLNHWRDVQQRYLQDVEH
                     AFVPLPIRRVPYYPEEVVGLEKLRQMGDDIYGDMDPTAVLYDRAPLDIAKVGDKSYRV
                     KIRLPFADVSQLDLYQNGDELVIQIGDFRRVITLPTSLAGLEAGQAEMEGEWLIVPFM
                     APQMAQR"
     misc_feature    162312..163235
                     /locus_tag="Caur_0125"
                     /note="Anion-transporting ATPase; Region: ArsA_ATPase;
                     pfam02374"
                     /db_xref="CDD:251258"
     misc_feature    162321..163169
                     /locus_tag="Caur_0125"
                     /note="ArsA ATPase functionas as an efflux pump located on
                     the inner membrane of the cell. This ATP-driven oxyanion
                     pump catalyzes the extrusion of arsenite, antimonite and
                     arsenate. Maintenance of a low intracellular concentration
                     of oxyanion produces...; Region: ArsA; cd02035"
                     /db_xref="CDD:238992"
     misc_feature    162333..162359
                     /locus_tag="Caur_0125"
                     /note="P loop; other site"
                     /db_xref="CDD:238992"
     misc_feature    order(162342..162344,162348..162359,162423..162425,
                     162708..162710)
                     /locus_tag="Caur_0125"
                     /note="Nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238992"
     misc_feature    order(162423..162431,162708..162731)
                     /locus_tag="Caur_0125"
                     /note="DTAP/Switch II; other site"
                     /db_xref="CDD:238992"
     misc_feature    162423..162431
                     /locus_tag="Caur_0125"
                     /note="Switch I; other site"
                     /db_xref="CDD:238992"
     gene            163594..163836
                     /locus_tag="Caur_0126"
                     /db_xref="GeneID:5828050"
     CDS             163594..163836
                     /locus_tag="Caur_0126"
                     /note="PFAM: bacteriochlorophyll C binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriochlorophyll C binding protein"
                     /protein_id="YP_001633769.1"
                     /db_xref="GI:163845725"
                     /db_xref="InterPro:IPR001470"
                     /db_xref="GeneID:5828050"
                     /translation="MATRGWFSESSAQVAQIGDIMFQGHWQWVSNALQATAAAVDNIN
                     RNAYPGVSRSGSGEGAFSSSPSNGFRPKRIRSRFNR"
     misc_feature    163597..163833
                     /locus_tag="Caur_0126"
                     /note="Bacteriochlorophyll C binding protein; Region:
                     Bac_chlorC; pfam02043"
                     /db_xref="CDD:251055"
     gene            163897..164985
                     /locus_tag="Caur_0127"
                     /db_xref="GeneID:5828051"
     CDS             163897..164985
                     /locus_tag="Caur_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633770.1"
                     /db_xref="GI:163845726"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="GeneID:5828051"
                     /translation="MINLLYYSHTTVPAHLEEITRLDVLDPDEQVLVAIDGVLVDQQG
                     QRLSGPTLHDYCLITDLRVILWARDYGRHLCYAFPLHELTLIDGRGIDPIHGAVTMGF
                     SAPDTDDQIFTLTLVPQAYVPALMVLLRTAAETARSALAAGIDARQAAPDVMTALGAA
                     IYGSEDALRIDETPYRWPGGAARTPAAPNALFAIDPANLPPNQIFTAGRLARSAWDTL
                     RRTLREADLPFDLSPTSIRELTDAIRAVNDLVQTVANNPAAQQIALAFLNRQMGNQQS
                     TAPSPPVEPPTPEATPAPHRYHEIPLRRRATPSREPAMTQPTATASSPLNITDRREIP
                     LRRRTTPLHRTSLAALSGSGDADQDRTT"
     gene            165028..166371
                     /locus_tag="Caur_0128"
                     /db_xref="GeneID:5828052"
     CDS             165028..166371
                     /locus_tag="Caur_0128"
                     /note="KEGG: plt:Plut_0266 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633771.1"
                     /db_xref="GI:163845727"
                     /db_xref="GeneID:5828052"
                     /translation="MRPFLGVNVSMASVEEMQQRGLLEEGETLLALFDGTLLDEQRRR
                     IGGLALADFVALTDRRLILWARGFFNDTVDGFPWSDVDVVRAETWDPWHGRVSLALRI
                     PATPPRKRRVALGEVQEAGQPERVIINTLDYMPVEDVDVLAKMVAWVGDQVVAGVTGE
                     ELIKAFEAEFPAVERKPLPPFFLASEPAPPPMPEPAPQQPKKKPWWKFGAADKEEEAT
                     PASPGNLIAAYERQRSGSGVSPETPPAPVGPLPTLPEQPNMYEVSRSLRLMLEVPRGL
                     ARGMRRASEILSGATELINNMQDPRVRRNAMRGLYYAAAQQEAEGGPLAPVGPVVRAA
                     VRFAEPTEQQSAAEPPQRRIAVRAAVRQSSPAPAPEPTTTAPAATDNPATPANQPVRR
                     AISIRRSETPDSGQDGSVPVRRIVVNRTDRPATVSGSGTGITPETRNGHNDSDAE"
     misc_feature    <165763..>166203
                     /locus_tag="Caur_0128"
                     /note="Protein of unknown function (DUF1032); Region:
                     DUF1032; pfam06278"
                     /db_xref="CDD:253654"
     gene            166418..167641
                     /locus_tag="Caur_0129"
                     /db_xref="GeneID:5828053"
     CDS             166418..167641
                     /locus_tag="Caur_0129"
                     /EC_number="3.6.3.16"
                     /note="PFAM: Anion-transporting ATPase;
                     KEGG: cch:Cag_1412 anion-transporting ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite-transporting ATPase"
                     /protein_id="YP_001633772.1"
                     /db_xref="GI:163845728"
                     /db_xref="InterPro:IPR003348"
                     /db_xref="GeneID:5828053"
                     /translation="MTRVIIYSGKGGTGKTTLSAATAVMLAQAGRRTLVLSSDPAHSL
                     ADVMGIAISRDRPTPLAPHLYGLEVDTIYEWRQNLGGFQQFVTATYSARGIERSTAAE
                     LANQPGLDEILALQRVMDEAQSGRWDAIVLDTAPTGNTLRLLAYPEMIIGGEAGKRLF
                     RVYRGIANVARPFRRDLPDDRFFEEVGKLLERMDQLANFLVSSNVSVRLVLNPERLPL
                     LETRRAYTFLSLYGLQLDAVLVNKILPHRTDLGPYFDYWVNLQQQYLAEIESSFAPTP
                     IFRTVLQGGEPIGVEALLHVGRLTFGEVDPGALLYDERPIWLEQWSDDGEPGQYDLCL
                     RLPFLDPGEAIEVSHSGPDLTIVVGRLERTIALPRVLYDCTLGDYRYEDGVLRLAFYE
                     ANVVRTANKQQVEAA"
     misc_feature    166418..167377
                     /locus_tag="Caur_0129"
                     /note="Predicted ATPase involved in chromosome
                     partitioning [Cell division and chromosome partitioning];
                     Region: ArsA; COG0003"
                     /db_xref="CDD:223082"
     misc_feature    166427..167254
                     /locus_tag="Caur_0129"
                     /note="ArsA ATPase functionas as an efflux pump located on
                     the inner membrane of the cell. This ATP-driven oxyanion
                     pump catalyzes the extrusion of arsenite, antimonite and
                     arsenate. Maintenance of a low intracellular concentration
                     of oxyanion produces...; Region: ArsA; cd02035"
                     /db_xref="CDD:238992"
     misc_feature    166442..166468
                     /locus_tag="Caur_0129"
                     /note="P loop; other site"
                     /db_xref="CDD:238992"
     misc_feature    order(166451..166453,166457..166468,166532..166534,
                     166814..166816)
                     /locus_tag="Caur_0129"
                     /note="Nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238992"
     misc_feature    order(166532..166540,166814..166837)
                     /locus_tag="Caur_0129"
                     /note="DTAP/Switch II; other site"
                     /db_xref="CDD:238992"
     misc_feature    166532..166540
                     /locus_tag="Caur_0129"
                     /note="Switch I; other site"
                     /db_xref="CDD:238992"
     gene            167713..168816
                     /locus_tag="Caur_0130"
                     /db_xref="GeneID:5828054"
     CDS             167713..168816
                     /locus_tag="Caur_0130"
                     /note="PFAM: Anion-transporting ATPase;
                     KEGG: rca:Rcas_0926 ATPase involved in chromosome
                     partitioning-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anion-transporting ATPase"
                     /protein_id="YP_001633773.1"
                     /db_xref="GI:163845729"
                     /db_xref="InterPro:IPR003348"
                     /db_xref="GeneID:5828054"
                     /translation="MRTLIFTAHHQLQQSAAALATACHAARRGYRTLLASSGPGHLIG
                     HLLHQSLGARPLELEPNLAAMEIHPHEEVARRWEQVRPSLRSGLVARLRDLGPDELPA
                     FPGIDAVAAMLVAERARQSGRFDLLILDGPAPDALIRALTLPDVLRWAVRLIFGLDRG
                     PGKSRASQEQAMIPAAILAPSATAPLQELRIELETQRARLETESGARVRMVVLPPELR
                     LPPLRSALTAFGLYGMASDEVIVNGSPDQVDDESRHDFSHETSRARPLLRIGQLDLTP
                     TDRDSWALRGAALYRDGDIFATEPPRPQSSERDMRLLIPFLDPKALDIAVASEEVVVQ
                     LGQMRRHVLLPGLVDGGRLRARVEGEQLRLWVE"
     misc_feature    167791..168465
                     /locus_tag="Caur_0130"
                     /note="transport-energizing ATPase, TRC40/GET3/ArsA
                     family; Region: GET3_arsA_TRC40; TIGR00345"
                     /db_xref="CDD:232932"
     gene            168831..169838
                     /locus_tag="Caur_0131"
                     /db_xref="GeneID:5828055"
     CDS             168831..169838
                     /locus_tag="Caur_0131"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: pvi:Cvib_1124 alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold-containing protein"
                     /protein_id="YP_001633774.1"
                     /db_xref="GI:163845730"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="GeneID:5828055"
                     /translation="MSVLAQPVPFERPPARPVDAPPTAKYVAYANEVATRLAGRLSGR
                     ERRRLEGERALLARARFIELNGVVHHYQDVGPSDGQPLVLIHGWDCSSFWWHHVVDPL
                     AQAGYRVISYDLKGHGFSDTDPRQNYTVAGFSADLQALIRALDLGAVHLAAFSLGAFV
                     GLHVAAHHPDMVRSLIFFNFSLLPYNKLASAFVPRLLDVVFNRVLRPIERRNLWWLPF
                     IYARLVMAQHTPSISDIRLGTLGLRYCDPAAVRVSATELSRPEILNAVAEQARMIRQP
                     LLLVAGANDPIMRPADGRKLVALTPNGSFLEVPKCGHLILFELPEQVIQIMRLFLKSV
                     R"
     misc_feature    169038..>169193
                     /locus_tag="Caur_0131"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    169074..169808
                     /locus_tag="Caur_0131"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    169077..>169325
                     /locus_tag="Caur_0131"
                     /note="Lipase.  Lipases are esterases that can hydrolyze
                     long-chain acyl-triglycerides into di- and monoglycerides,
                     glycerol, and free fatty acids at a water/lipid interface.
                     A typical feature of lipases is 'interfacial activation',
                     the process of...; Region: Lipase; cl14883"
                     /db_xref="CDD:265473"
     misc_feature    169287..169301
                     /locus_tag="Caur_0131"
                     /note="nucleophilic elbow; other site"
                     /db_xref="CDD:238382"
     misc_feature    169293..169295
                     /locus_tag="Caur_0131"
                     /note="catalytic triad; other site"
                     /db_xref="CDD:238382"
     gene            169851..170732
                     /locus_tag="Caur_0132"
                     /db_xref="GeneID:5828103"
     CDS             169851..170732
                     /locus_tag="Caur_0132"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633775.1"
                     /db_xref="GI:163845731"
                     /db_xref="GeneID:5828103"
                     /translation="MQLLLRSGGQQLIIDMERADDRPLTVGQYTYRPRRLAGKVRRLA
                     TKMWPDLPPTVLAERLTFEAMDTVRDTAWSDSGSFSPRSGSVVLLGRWDEDGSVGIAL
                     HELAHEMHLYHGGYDDSDGVVREAVAMLAEREAGLRRTFEREPYHSACQLVEQLESLS
                     AFNRLSFPKRWAEVISVTSMVGLADLVNYYLDRSERLGLARWLDRLTKNIDVRDQLLA
                     RLATTSLRYSLALRRVLIKKLVRCKPETPVEQLLYVLDSIATLDRRYPNDDLEQIINF
                     CFAPYVPQRRRLFAFGS"
     gene            170748..171464
                     /locus_tag="Caur_0133"
                     /db_xref="GeneID:5828104"
     CDS             170748..171464
                     /locus_tag="Caur_0133"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633776.1"
                     /db_xref="GI:163845732"
                     /db_xref="GeneID:5828104"
                     /translation="MNRFNEDNDTVRWLPGFVRRWFGLTDETPQRREAAGPGWMPGWL
                     QRFFGLTYEEPVRYTDEGTPSVSSRTTYTPPPRSYTPGTPSFTPTPRGFAPASYRPTS
                     GEGTPSTPTQRSLAGDELPTDIQPIGYLLRSYARGALPPQGLEAFTREVRTTTEKVFN
                     FYGHWLRFQTEELFRIGGDLCNAVINALPGEPAKPQNQTIRRIKVVADNGNGSSNATS
                     TAQTGSAETTTEPERSEDKE"
     misc_feature    <170937..171230
                     /locus_tag="Caur_0133"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14971"
                     /db_xref="CDD:237874"
     gene            171489..172154
                     /locus_tag="Caur_0134"
                     /db_xref="GeneID:5828105"
     CDS             171489..172154
                     /locus_tag="Caur_0134"
                     /note="KEGG: tel:tlr1982 probable lipase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase"
                     /protein_id="YP_001633777.1"
                     /db_xref="GI:163845733"
                     /db_xref="GeneID:5828105"
                     /translation="MGGWLSSPADYFGMARILAAPPYNRIVYVVNFSRLDWLALRDPN
                     FGPALDALAATVQIALSETGADTIDLIGHSAGGRIARAYLADEPYQGVRYAGHKVVAS
                     LTTLGTAHATSEVWVKQFADWLEARYPGAAFPHIRYRAVAGRSVRGRRFGSPEEMIAY
                     RSYEVSFGNGNLIGDGIVPTAACYLAGADNLILEGARHAPYNAPATWYGARDVVPLWF
                     DAG"
     misc_feature    171495..172091
                     /locus_tag="Caur_0134"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    171495..>171833
                     /locus_tag="Caur_0134"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            172163..172876
                     /locus_tag="Caur_0135"
                     /db_xref="GeneID:5828106"
     CDS             172163..172876
                     /locus_tag="Caur_0135"
                     /note="KEGG: tel:tlr1982 probable lipase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase"
                     /protein_id="YP_001633778.1"
                     /db_xref="GI:163845734"
                     /db_xref="GeneID:5828106"
                     /translation="MVRPLVIIGGYLTSPNDFSALAQALSQPPFDFRVFVTPIGRLRW
                     ALTRDWDFRPVLRIVRETVAQALHETGAETVTILAHSVGGTVARMYLGDQPYKGEIYG
                     GHRFVDHLIMLGTPHHSQEFWTRQTVGFTNRSYPGAYYRHIRYTSIIGRSIQANRKGR
                     WIERMAYNSYVMIDGPAGAQAWGDGITTLRCAALAGAEYLVVPGLHHSPIHGRPWYGD
                     PDGLREWQRVLMRSSPLVV"
     misc_feature    172163..>172516
                     /locus_tag="Caur_0135"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    172175..172804
                     /locus_tag="Caur_0135"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            172910..173410
                     /locus_tag="Caur_0136"
                     /db_xref="GeneID:5828107"
     CDS             172910..173410
                     /locus_tag="Caur_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633779.1"
                     /db_xref="GI:163845735"
                     /db_xref="GeneID:5828107"
                     /translation="MNSTHFDRIILYVMAAVSGVSLACYTAVLYLCRQEARGSQPTRS
                     TLRTRLANLAHALDWLMNLLIALVGIGRLFREEQFGGQHQPRWLKIYFMITGPLPTIG
                     MVGAMITGHRWEKTMHHHPHQRRLHRIFAWVGYFSWWLSFIPIFFQPWLNRMAARTND
                     STSVLS"
     sig_peptide     172910..172981
                     /locus_tag="Caur_0136"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.907) with cleavage site probability 0.651 at
                     residue 24"
     gene            173441..174505
                     /locus_tag="Caur_0137"
                     /db_xref="GeneID:5828108"
     CDS             173441..174505
                     /locus_tag="Caur_0137"
                     /note="TIGRFAM: C-20 methyltransferase BchU;
                     PFAM: O-methyltransferase family 2;
                     KEGG: cte:CT0028 CrtF-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="C-20 methyltransferase BchU"
                     /protein_id="YP_001633780.1"
                     /db_xref="GI:163845736"
                     /db_xref="InterPro:IPR001077"
                     /db_xref="InterPro:IPR014088"
                     /db_xref="GeneID:5828108"
                     /translation="MTTVPSVDATKTNGTDLTQHDLFAATNRAYDMVFKGTVDFFVIK
                     AAKDLGLFDLLASAPRTLADLATLTETVPPRLEKFLITMEQIGLVTRQGDAWQLTPFA
                     DQFFADPERHRNMTMVPFVDYIADLIENYYLRLADVVRGKVDFTSIVPHPPRTREDSL
                     FYETLHRSNIQLFTELLIKRARLADVQTLIDVGGGIGDIAAALCQAFPQLKVTLINLP
                     SALDLVRENVAAKGLADRITPVAIDMYREPYPPGDAVLFSRILYPMNAQFCTMLLRKA
                     YDALPSGGRILILDMVISDPNHPNYDYLTHYLCAIGMGFSVLEFKDHAVYPDLLRQVG
                     FTDVTLDEGYEHVLYQAVKP"
     misc_feature    173549..174466
                     /locus_tag="Caur_0137"
                     /note="C-20 methyltransferase BchU; Region:
                     C20_methyl_CrtF; TIGR02716"
                     /db_xref="CDD:131763"
     misc_feature    173708..174331
                     /locus_tag="Caur_0137"
                     /note="O-methyltransferase; Region: Methyltransf_2;
                     pfam00891"
                     /db_xref="CDD:250208"
     misc_feature    174002..174304
                     /locus_tag="Caur_0137"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(174014..174034,174086..174091,174164..174172,
                     174215..174217)
                     /locus_tag="Caur_0137"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            174564..175481
                     /locus_tag="Caur_0138"
                     /db_xref="GeneID:5828109"
     CDS             174564..175481
                     /locus_tag="Caur_0138"
                     /note="TIGRFAM: bacteriochlorophyll/chlorophyll
                     synthetase;
                     PFAM: UbiA prenyltransferase;
                     KEGG: cch:Cag_1538 bacteriochlorophyll a synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriochlorophyll/chlorophyll synthetase"
                     /protein_id="YP_001633781.1"
                     /db_xref="GI:163845737"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006372"
                     /db_xref="GeneID:5828109"
                     /translation="MISTEQRVSLSRKIRAHIELADPVTWISPVLVCFCGALASGYER
                     GFDWTRPDHWWLMLLGALMTGPLGTGFSQSINDYFDRDLDAINDPQRPIPAGIISLNE
                     ARWNWIVLGAATLLVSLVFGNPLIVLFAVVGIVLSVIYSMPPIKLKKHFWLGPPAVGL
                     GYVSMSWMAGHLIFAPLTWQSVVVALINGGLAAGLLFLNDIKSVEGDRKLGLQSLTVA
                     IGVKRTLIVAYVTINSFEAMLMILALIWGQYWVAAFMFLALVAPIYNQIKLYQEPTQQ
                     NYVRYLLASNPFVALIQIISGFLVGGYFG"
     misc_feature    174612..175454
                     /locus_tag="Caur_0138"
                     /note="Bacteriochlorophyll/chlorophyll synthetase; Region:
                     PT_UbiA_chlorophyll; cd13958"
                     /db_xref="CDD:260121"
     misc_feature    order(174789..174794,174801..174803,174813..174815,
                     175158..175163,175170..175172,175182..175184)
                     /locus_tag="Caur_0138"
                     /note="putative active site [active]"
                     /db_xref="CDD:260121"
     gene            175504..175794
                     /locus_tag="Caur_0139"
                     /db_xref="GeneID:5828110"
     CDS             175504..175794
                     /locus_tag="Caur_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633782.1"
                     /db_xref="GI:163845738"
                     /db_xref="GeneID:5828110"
                     /translation="MTESEGEVRVRSVPVRRNDSFVESAMEFGGGIVRLGFSIFTLPL
                     ALLPPESRQHMHNATKELMYAFASLPRDFAEIAGKSIEKWAEEGEEPKGEAK"
     gene            175833..176270
                     /locus_tag="Caur_0140"
                     /db_xref="GeneID:5828111"
     CDS             175833..176270
                     /locus_tag="Caur_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633783.1"
                     /db_xref="GI:163845739"
                     /db_xref="GeneID:5828111"
                     /translation="MSNETTNERDGLFEMAAGFVGGATRIGLTVASVPLVLLPRNSRR
                     RVRRAMAEVAMAVVAFPKELANVSERVVDDIFAADPPQINLPSPQRVGEQVRSFTERL
                     ARAAEELGTSFSRAAGRAADAVEQGAAKVDEWVETPPKTPPAP"
     gene            176465..177634
                     /locus_tag="Caur_0141"
                     /db_xref="GeneID:5828112"
     CDS             176465..177634
                     /locus_tag="Caur_0141"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: bcy:Bcer98_3646 FAD-dependent pyridine
                     nucleotide-disulphide oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_001633784.1"
                     /db_xref="GI:163845740"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5828112"
                     /translation="MRIVILGAGYAGLRTALDLARLRRAYGLEITIQVVDQNPYHQLV
                     QLLHLTATAGITDQKSIYQLDTLFRGREVERIEGRVEAIHPLERRVVLNTGQTLEYDR
                     LVLALGSETAFQVPGAREYTLPLRTFSDALKLRKHLIEQFTRAASITDPTELRITMTT
                     AIVGGGYTGCELAGELAAWADDLCRQTGAPRKEVRIALIEREDHLLPHLGTWASNEAV
                     RRLERLGVNIFLQTPVVQVEPQRLRFADGRLLRAGTIVWGAGVRAPALLAEAGFPTDR
                     LGRVLVDRYLRVQGHATVFAIGDCAAVPDGRGGTLPPTASYAMRQGEHLAEVLAAEAR
                     GEAPRAYEPVELGEVVSLGPNDAVGNPLGVPITGYPALMLKRGIEEYYRATIESA"
     misc_feature    176465..177622
                     /locus_tag="Caur_0141"
                     /note="NADH dehydrogenase, FAD-containing subunit [Energy
                     production and conversion]; Region: Ndh; COG1252"
                     /db_xref="CDD:224172"
     misc_feature    <176654..176788
                     /locus_tag="Caur_0141"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    176945..177178
                     /locus_tag="Caur_0141"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            177650..178105
                     /locus_tag="Caur_0142"
                     /db_xref="GeneID:5828113"
     CDS             177650..178105
                     /locus_tag="Caur_0142"
                     /note="KEGG: ter:Tery_0501 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633785.1"
                     /db_xref="GI:163845741"
                     /db_xref="GeneID:5828113"
                     /translation="MIVQEQFVSIKAPPATVERYLTDPQLMMEWRSPLVVLDPIEGEL
                     MTLGSKHKLRLKSLALAGSTYTVTERDSNHILLTIDGLWRGQELWRWFADGDRTIVQN
                     RVEYEVPDPSLRVFVVGLGQIFASLDMRIQLDRLRMLIEGKGQPAAQAR"
     misc_feature    177662..178060
                     /locus_tag="Caur_0142"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cd07812"
                     /db_xref="CDD:176854"
     misc_feature    order(177665..177667,177671..177673,177698..177706,
                     177710..177715,177758..177760,177776..177778,
                     177782..177784,177788..177790,177794..177796,
                     177842..177844,177848..177850,177854..177856,
                     177914..177919,177926..177928,177947..177949,
                     177953..177955,177959..177961,177965..177967,
                     178007..178021,178025..178027,178031..178033,
                     178040..178048,178055..178057)
                     /locus_tag="Caur_0142"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            178272..178556
                     /locus_tag="Caur_0143"
                     /db_xref="GeneID:5828114"
     CDS             178272..178556
                     /locus_tag="Caur_0143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633786.1"
                     /db_xref="GI:163845742"
                     /db_xref="GeneID:5828114"
                     /translation="MARQQRFSPRDEVYLTSTSFEVYMAAGGVFIGLFGLLFAISIKI
                     SFAWLVWPALFVSILAGYITLNRLEKRERKRKLAELEAEYAAKEQIAKGD"
     gene            178643..179605
                     /locus_tag="Caur_0144"
                     /db_xref="GeneID:5828115"
     CDS             178643..179605
                     /locus_tag="Caur_0144"
                     /note="PFAM: helix-turn-helix domain protein; peptidase
                     M23B;
                     KEGG: rrs:RoseRS_2287 peptidase M23B"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23B"
                     /protein_id="YP_001633787.1"
                     /db_xref="GI:163845743"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR002886"
                     /db_xref="GeneID:5828115"
                     /translation="MQTLRSIRRTRDLTFVDLALLSGIPARAIAEAEYGLRRLSNHEV
                     EAIALVLGLSPTTLFPPFQQRSSSPNLTPLILTAGLATSLALSPLVMTEWQRAQQQLL
                     STTIHHVGEALNAPDRQPTPDIIRPLPTAPQAARSIPATPTADALAPLVAPLPPRTPT
                     PIPTPSFYLDEAGPHGCPVQPTTGQVVITQGYGVGTHAPAHVWGAVDLAVDGNGDGIA
                     EPGSSWYTPIVATHNGVVRVTLDSYPAGHHVWVMAPDGIWRTGYAHLAVVTVIDGQYV
                     QAGDVIGLMGNTGFASGPHLDYQVWRGDENIDPTTLVGCSTIKP"
     misc_feature    178643..178816
                     /locus_tag="Caur_0144"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     sig_peptide     178643..178735
                     /locus_tag="Caur_0144"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.617) with cleavage site probability 0.512 at
                     residue 31"
     misc_feature    order(178655..178657,178667..178669,178742..178744)
                     /locus_tag="Caur_0144"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(178664..178666,178739..178741)
                     /locus_tag="Caur_0144"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(178685..178690,178721..178723,178730..178732,
                     178742..178747)
                     /locus_tag="Caur_0144"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    <179189..179569
                     /locus_tag="Caur_0144"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    179318..179569
                     /locus_tag="Caur_0144"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(181900..182655)
                     /locus_tag="Caur_0145"
                     /db_xref="GeneID:5828116"
     CDS             complement(181900..182655)
                     /locus_tag="Caur_0145"
                     /note="PFAM: ABC-2 type transporter;
                     KEGG: mth:MTH1092 ABC-2 type transport system permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_001633788.1"
                     /db_xref="GI:163845744"
                     /db_xref="InterPro:IPR000412"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR013526"
                     /db_xref="GeneID:5828116"
                     /translation="MYATYVIWTRHMRKFVQQTEELFGLALQSVLWVVLFGVGMRGMI
                     GAVGGNDYMSFILPGIIALSALGGAVGGGMVLLDERLRGIVKEYLAAPIPRLSILLGS
                     AASTATKALFQAALMLVVGLLMGARLSVNPIGWLGALALLAVFAIGFSGLALGVAAIS
                     RSIAGYHGMIFLFNLPLLFASNALYPLDVLPGWMRVIVLINPATYFIDAVRALAFGTA
                     ATLPLWLSGLILIGFAVLSMMFALTLFQRSLRA"
     misc_feature    complement(181921..182628)
                     /locus_tag="Caur_0145"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     cl17235"
                     /db_xref="CDD:266576"
     misc_feature    complement(181903..182595)
                     /locus_tag="Caur_0145"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: COG0842"
                     /db_xref="CDD:223912"
     gene            complement(182667..183614)
                     /locus_tag="Caur_0146"
                     /db_xref="GeneID:5824901"
     CDS             complement(182667..183614)
                     /locus_tag="Caur_0146"
                     /note="KEGG: mem:Memar_0243 daunorubicin resistance ABC
                     transporter ATPase subunit;
                     TIGRFAM: daunorubicin resistance ABC transporter ATPase
                     subunit;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="daunorubicin resistance ABC transporter ATPase
                     subunit"
                     /protein_id="YP_001633789.1"
                     /db_xref="GI:163845745"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005894"
                     /db_xref="GeneID:5824901"
                     /translation="MDTPAIETIDLVKRYGNLTALDHVNLQAPSGKIYALLGPNGAGK
                     TTLLSILTTLLPPTAGTARILGYDVSREAAEVRRRIGVTFQEMVLDPLLTGRETLDFH
                     GRLYRLPAAVRRQRIRDLVELVQLTDAIDRPVKSYSGGMKRRLELARGLMTDPQVLVL
                     DEPTQGLDPQNRVNIWQYVRDLNRQRGMTILLTTHAMDEAEALADLVGIIDHGRLIVE
                     GQPTDLIASLGSDVIRVRGQGDSHHLTSAICGIDGVQRVETDPTEGLILIYTDNGSRR
                     LPVVLSAVSGNGFAIEDVTLARPSLGDVFLHYTGTALRD"
     misc_feature    complement(182943..183599)
                     /locus_tag="Caur_0146"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(182685..183578)
                     /locus_tag="Caur_0146"
                     /note="daunorubicin resistance ABC transporter ATP-binding
                     subunit; Region: drrA; TIGR01188"
                     /db_xref="CDD:130256"
     misc_feature    complement(183480..183503)
                     /locus_tag="Caur_0146"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(183030..183032,183129..183134,
                     183360..183362,183477..183485,183489..183494))
                     /locus_tag="Caur_0146"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(183360..183371)
                     /locus_tag="Caur_0146"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(183177..183206)
                     /locus_tag="Caur_0146"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(183129..183146)
                     /locus_tag="Caur_0146"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(183111..183122)
                     /locus_tag="Caur_0146"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(183024..183044)
                     /locus_tag="Caur_0146"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(182694..182960)
                     /locus_tag="Caur_0146"
                     /note="Domain of unknown function (DUF4162); Region:
                     DUF4162; pfam13732"
                     /db_xref="CDD:258028"
     gene            183964..184383
                     /locus_tag="Caur_0147"
                     /db_xref="GeneID:5824902"
     CDS             183964..184383
                     /locus_tag="Caur_0147"
                     /note="KEGG: rrs:RoseRS_3147 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633790.1"
                     /db_xref="GI:163845746"
                     /db_xref="GeneID:5824902"
                     /translation="MQQQPIRIEQRSGPNILIRVIYFFVFGLWFSGIWAAIGWILCVT
                     IVGLPVGLWMLNRMPQVVTLAPQRNNLVIVGNQVYQSSVPQRPFLIRALWFVLVGWWL
                     SALWLLVAWALSVSIIGMVFAFWMFDRVPAIITLARR"
     misc_feature    184051..>184332
                     /locus_tag="Caur_0147"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11770"
                     /db_xref="CDD:236975"
     gene            185401..186291
                     /locus_tag="Caur_0148"
                     /db_xref="GeneID:5824903"
     CDS             185401..186291
                     /locus_tag="Caur_0148"
                     /note="KEGG: fno:Fnod_0510 protein of unknown function
                     DUF450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633791.1"
                     /db_xref="GI:163845747"
                     /db_xref="GeneID:5824903"
                     /translation="MIFIVVKKAGMSDWADRQLFEYAFLQGIPMVIFTNGQEWSFYLT
                     NAQGSYDERRVYKLDLLESDIEESIYRLERYLQYDWVCSGEALEATLSDYQNVARTRE
                     IEAALPKAWKSLLEEPDSLLLELLADKVEDLCGYKPDLDVCSRFITTVMRNHVDVPPQ
                     YPTLPRTRNPLPAERIETDDRVRAGSECFIMFEGKTYKPGSAIRTMLKLFQRLAEADP
                     GFLDRFAAMKHGSKRKYIARNRLELYPDRPDLAKQCSVEIIPGWWMGKNFSKRDIKHI
                     IEMALGIISPTLRAKIQYEL"
     gene            186610..188460
                     /locus_tag="Caur_0149"
                     /db_xref="GeneID:5824904"
     CDS             186610..188460
                     /locus_tag="Caur_0149"
                     /note="KEGG: rrs:RoseRS_3857 amino acid
                     permease-associated region"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease-associated protein"
                     /protein_id="YP_001633792.1"
                     /db_xref="GI:163845748"
                     /db_xref="GeneID:5824904"
                     /translation="MFAQLKRILVGRPIATEHQHHERLNKATALAVFSSDALSSVSYA
                     TEAILTILVLGGSVALGLSLPIAAAIAGLLLIVGFSYRQTIHAYPQGGGGYIVTRDNL
                     GDLPGLVAAGALLIDYVLTVAVSISAGVAAITSLATNWGFPTLRDHAVEIALVCILIV
                     TIANLRGAKESGFIFSIPTYAFISGILSMIVFGIAHDLMFGADPVVHSIDPDIPPTGE
                     VLSLWLILRAFAAGCTALTGIEAISDGVQAFKPPEARNAAITLTLMISLLVTMFLGIT
                     WLAYTHQAVPNEFTHETIVSQIARTIFGVGPLYVFIQIATALILVLAANTAFADFPRL
                     ASFLSRDRFLPRQFSSRGDRLVFSNGILVLGLCSAVLVVIFQANEIAMLPLYAVGVFT
                     SFTLSQSGMVRRHFRRKQPGWHYSAMINGIGATLTGIVLVILMVTKFVHGAWMVITAI
                     PILVMVFRAINQHYQRVAEQLSLSGAILPPELRRHTAIVLVSGIHRGVLPALQYARSI
                     APDNVTAVYVDLDPEATAKLRQRWQNWGCDIPLVVLESPYRSLINPILRYIEEVESRY
                     GDDVITVILPEFVPARWWEHLLHNQTGLLIKTALRLRGTVVTSVPYRLAR"
     misc_feature    186649..187989
                     /locus_tag="Caur_0149"
                     /note="Amino acid transporters [Amino acid transport and
                     metabolism]; Region: PotE; COG0531"
                     /db_xref="CDD:223605"
     gene            complement(188477..189307)
                     /locus_tag="Caur_0150"
                     /db_xref="GeneID:5824905"
     CDS             complement(188477..189307)
                     /locus_tag="Caur_0150"
                     /note="PFAM: PfkB domain protein;
                     KEGG: rrs:RoseRS_3963 PfkB domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase-like domain-containing protein"
                     /protein_id="YP_001633793.1"
                     /db_xref="GI:163845749"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:5824905"
                     /translation="MIEFVAIGHVTRDLLPQQTTAPGGTARFAALLAQRLGLRAAIVT
                     ASVEPAPPGVAWISLPTTFSSTFENRYTPAGRQQWLHAIAPSIPVTALPAAWRTAPIV
                     LLGPVLHECSPDLAGAFPGALIGATAQGWLRDWNTDLPTPIRPRRWRPTPAELRHLHV
                     LTLSSEDVAGDDELAAYYARLVPIGIVTHGAAGATLFIHGKPHHIPAFPAQESDPTGA
                     GDVFTTAFLIRLWETGDPVGAAHFAAAAAACVVEGVGDMALPDRVQIAQRMARVPDHG
                     "
     misc_feature    complement(188552..189301)
                     /locus_tag="Caur_0150"
                     /note="Ribokinase-like subgroup D.  Found in bacteria and
                     archaea, this subgroup is part of the ribokinase/pfkB
                     superfamily.  Its oligomerization state is unknown at this
                     time; Region: ribokinase_group_D; cd01937"
                     /db_xref="CDD:238912"
     misc_feature    complement(order(188648..188650,188657..188659,
                     189224..189226))
                     /locus_tag="Caur_0150"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238912"
     misc_feature    complement(order(188567..188569,188576..188578,
                     188642..188644,188651..188656,188663..188665,
                     188744..188746,188870..188872))
                     /locus_tag="Caur_0150"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238912"
     gene            complement(190653..191549)
                     /locus_tag="Caur_0151"
                     /db_xref="GeneID:5824906"
     CDS             complement(190653..191549)
                     /locus_tag="Caur_0151"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: cph:Cpha266_1941 alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold-containing protein"
                     /protein_id="YP_001633794.1"
                     /db_xref="GI:163845750"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="GeneID:5824906"
                     /translation="MSTPTEINTTRKFEIREEYRSGPDGLMRVWMSSPVQGLPVLLIH
                     GYGALIEHWRPVMRAIAGEQTLYALDLYYFGYSARPAGRPSRERWAAQAAALIRNTIG
                     RPAVVVGHSMGGVVSAQLARAYPDLVHALVLVNSSGAQLQARPLSTFDRFMLDAIGSP
                     LIGEALAGVFGNRWGVRQGLLSAYHRKECVTPELVELFSGPLRRYGAGSYLKVSREFA
                     NLVLDLTPGEIKQPTLLIWGAEDRSIPPAHAEIIRQRMIPHAEIKIIPDSGHCPFDET
                     PAAFLDILLPWLRKVGEQTVVA"
     misc_feature    complement(<191037..191438)
                     /locus_tag="Caur_0151"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(190701..191432)
                     /locus_tag="Caur_0151"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    complement(<191133..>191288)
                     /locus_tag="Caur_0151"
                     /note="Novel bacterial esterase that cleaves esters on
                     halogenated cyclic compounds; Region: Esterase_713_like;
                     cl17303"
                     /db_xref="CDD:247857"
     misc_feature    complement(190704..>191249)
                     /locus_tag="Caur_0151"
                     /note="homoserine O-acetyltransferase; Provisional;
                     Region: metX; cl17114"
                     /db_xref="CDD:247710"
     misc_feature    complement(order(191145..191147,191217..191219))
                     /locus_tag="Caur_0151"
                     /note="catalytic site [active]"
                     /db_xref="CDD:214005"
     gene            complement(191655..192728)
                     /locus_tag="Caur_0152"
                     /db_xref="GeneID:5824907"
     CDS             complement(191655..192728)
                     /locus_tag="Caur_0152"
                     /note="KEGG: rca:Rcas_0051 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633795.1"
                     /db_xref="GI:163845751"
                     /db_xref="GeneID:5824907"
                     /translation="MKTVEPPVSPQRPPEYPLRRRLLGIMLIIGGLGWLLFELVSRGS
                     IAGFDLQLARENSAQTLPVQRFAVSRVEVTGVNDQVTLSATDGEEVILRGERRGFGWA
                     ANAAAAAAAQITIEVEQRGDTLFVHVRRQPQIMWYFGRDPYASLELSLPRDVTFNVEL
                     VSGDVTLRQIEASGTITTVSGDVVADRTSGQLTVNTTGGDIELRDHRGGLKVVTIGGD
                     TDVNGQFTDLDIQAIDGDVTLQGSFNTAVIGTVSGRVAVEATEASRLTISTTSGDVRF
                     TGQPAAERQEIETIAGNVELVLREPLDTQMTFTTVSGRINIPSELSALSANSRSFTAT
                     FGQGRTVLKTNTTSGDITLRLYK"
     misc_feature    complement(191667..>192278)
                     /locus_tag="Caur_0152"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3595"
                     /db_xref="CDD:226123"
     misc_feature    complement(191898..192167)
                     /locus_tag="Caur_0152"
                     /note="Domain of unknown function (DUF4098); Region:
                     DUF4098; pfam13345"
                     /db_xref="CDD:257674"
     gene            complement(192841..193362)
                     /locus_tag="Caur_0153"
                     /db_xref="GeneID:5824908"
     CDS             complement(192841..193362)
                     /locus_tag="Caur_0153"
                     /note="KEGG: sfu:Sfum_3916 dual specificity protein
                     phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="dual specificity protein phosphatase"
                     /protein_id="YP_001633796.1"
                     /db_xref="GI:163845752"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="GeneID:5824908"
                     /translation="MLPHPNAYLVTERFIAGEYPFPTAADIQRLAWYQAAGITCFIDL
                     TTPGEAWSYAPALPSPMHHQRFSIPDFGLPATPAQMQAILAAIDEQLNRGATVYLHCL
                     GGVGRTGMTVGCWLVRHGFSGDEALATVARRWQTVAKAAMHPQSPETPDQRAYVLNWP
                     TLQLSLSVRRRME"
     misc_feature    complement(192964..193254)
                     /locus_tag="Caur_0153"
                     /note="Dual specificity phosphatases (DSP); Ser/Thr and
                     Tyr protein phosphatases. Structurally similar to
                     tyrosine-specific phosphatases but with a shallower active
                     site cleft and a distinctive active site signature motif,
                     HCxxGxxR. Characterized as VHR- or...; Region: DSPc;
                     cl00053"
                     /db_xref="CDD:260159"
     gene            193471..193965
                     /locus_tag="Caur_0154"
                     /db_xref="GeneID:5824909"
     CDS             193471..193965
                     /locus_tag="Caur_0154"
                     /note="KEGG: rrs:RoseRS_3314 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633797.1"
                     /db_xref="GI:163845753"
                     /db_xref="GeneID:5824909"
                     /translation="MPILIDGHNLIGQMPDIELSDPDDEAKLVAKLRRYVAKKRGRKI
                     VVVFDGGVYGHPQNLNGFGVETRFVKPPQNADHELIRQIRAIRRCDEWLVVSSDRAVV
                     GEAQARGIRVMSAQEFARRLQMLDQPRINARDKRGDRPLSKAEVEEWLRFFGVDEDED
                     TLYY"
     misc_feature    193477..193809
                     /locus_tag="Caur_0154"
                     /note="LabA_like proteins; Region: LabA_like; cd06167"
                     /db_xref="CDD:199895"
     misc_feature    order(193486..193488,193495..193497,193696..193698,
                     193756..193758,193762..193764)
                     /locus_tag="Caur_0154"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199895"
     gene            193970..194833
                     /locus_tag="Caur_0155"
                     /db_xref="GeneID:5824910"
     CDS             193970..194833
                     /locus_tag="Caur_0155"
                     /note="PFAM: Methyltransferase type 11; Methyltransferase
                     type 12;
                     KEGG: rxy:Rxyl_2574 methyltransferase type 12"
                     /codon_start=1
                     /transl_table=11
                     /product="type 12 methyltransferase"
                     /protein_id="YP_001633798.1"
                     /db_xref="GI:163845754"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:5824910"
                     /translation="MPDPVTEQNRRSWNAVVPAHVSHRADEAAFLRQGGSTLFPEEVA
                     LLGDVRGCRLLHLLCNTGADSLSLAARGAIVTGVDLSDAAIAHARALSVASGIPATFV
                     QADVYEYLAAAAAANTRFERIYAGYGVICWLRDLTAFANGIAHLLAPGGRFVLMEFHP
                     ASNMFNADWQLAYDYPQGGQTLTLPGVGDYVGAADGGLSPSGFLPGVRDFVNPEPCTL
                     YRWGVGEVVTALVQAGLRLHVLREYCYVNGERPFTRMVATPERRMYPPADVPAIPLMY
                     GLAVEKDTSDG"
     misc_feature    194120..>194467
                     /locus_tag="Caur_0155"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    194126..194437
                     /locus_tag="Caur_0155"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(194138..194158,194204..194209,194279..194287,
                     194345..194347)
                     /locus_tag="Caur_0155"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            194826..195209
                     /locus_tag="Caur_0156"
                     /db_xref="GeneID:5824911"
     CDS             194826..195209
                     /locus_tag="Caur_0156"
                     /note="TIGRFAM: dihydroneopterin aldolase;
                     KEGG: rxy:Rxyl_2579 dihydroneopterin aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="YP_001633799.1"
                     /db_xref="GI:163845755"
                     /db_xref="InterPro:IPR006156"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="GeneID:5824911"
                     /translation="MDEWGIGHDRIILSGMQFIGYHGTRPEENRLGQRFVVDVAVQLD
                     LQAAGVSDDLSQTVDYSQIHDRVREIVCGPPLKLTEAVAERIAAAVLHDHPTIVAVAV
                     RVTKPGVRLGETILAGSMVEIVRRR"
     misc_feature    194847..195203
                     /locus_tag="Caur_0156"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(194850..194882,194898..194924,195147..195152,
                     195168..195194)
                     /locus_tag="Caur_0156"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(194892..194900,194907..194909,195054..195065,
                     195141..195143,195186..195188)
                     /locus_tag="Caur_0156"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            195206..195871
                     /locus_tag="Caur_0157"
                     /db_xref="GeneID:5824912"
     CDS             195206..195871
                     /locus_tag="Caur_0157"
                     /EC_number="1.1.1.193"
                     /note="PFAM: bifunctional deaminase-reductase domain
                     protein;
                     KEGG: rxy:Rxyl_2578 riboflavin-specific deaminase-like
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /protein_id="YP_001633800.1"
                     /db_xref="GI:163845756"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="InterPro:IPR011549"
                     /db_xref="GeneID:5824912"
                     /translation="MMRPRVTLCFAQTLDGRVAAVDGSSQWISGPESLRFCHHLRANS
                     DAIMVGVGTVLRDDPRLTTRLVAGPDPLRVIVDTHLRTPTTAAVIRDGAGTGTLLACT
                     AAAPLERRIALQECGATVLTMPEAAGGGVDLAALLTALGERGVASVMVEGGARLITSL
                     LRANLVDALAVTIAPIILGSGPSAIGDLGILTLNQALRLTNVTWTTYGADVVIEGDLA
                     HHQ"
     misc_feature    195206..195847
                     /locus_tag="Caur_0157"
                     /note="Pyrimidine reductase, riboflavin biosynthesis
                     [Coenzyme metabolism]; Region: RibD; COG1985"
                     /db_xref="CDD:224896"
     gene            195897..196919
                     /locus_tag="Caur_0158"
                     /db_xref="GeneID:5824913"
     CDS             195897..196919
                     /locus_tag="Caur_0158"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein;
                     KEGG: rxy:Rxyl_2577 alcohol dehydrogenase, zinc-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_001633801.1"
                     /db_xref="GI:163845757"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="GeneID:5824913"
                     /translation="MKPLPAQAIWFTAPHTVSIREEIAPPPAYGDVRIAAIASLISHG
                     TERLVYRGEVDPTLALDLPTLQGSFAFPIKYGYAIAGRVIDIGPGVEQFQIGDPVAAL
                     HPHQTIFTLPAHLVKRLPDTLDPALGGFYANVETALTICHDAAPRLGETVVVLGQGVV
                     GLLVTQLLQRTGAQVIAVEPDAHRRALATQFGATTLAQADPATIAELTDGRGADIVVE
                     VSGSPAALQQAIELTATEGLVVVASWYGQKPAPLILGGHFHRGRVRLRSSQVGRLAPE
                     TLPRWDYARRSATVMNLLPRLCLNELISHRIPFVQAAAAYDLLDQAPPGLVQVMLTYA
                     DYAPQT"
     misc_feature    195915..196892
                     /locus_tag="Caur_0158"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    195918..>196205
                     /locus_tag="Caur_0158"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     misc_feature    196098..196889
                     /locus_tag="Caur_0158"
                     /note="2-desacetyl-2-hydroxyethyl bacteriochlorophyllide
                     and other MDR family members; Region:
                     2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_;
                     cd08255"
                     /db_xref="CDD:176217"
     misc_feature    order(196101..196103,196290..196292,196302..196304,
                     196362..196379,196431..196436,196446..196448,
                     196491..196493,196551..196556,196560..196562,
                     196620..196625,196701..196709)
                     /locus_tag="Caur_0158"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176217"
     gene            197111..197491
                     /locus_tag="Caur_0159"
                     /db_xref="GeneID:5824914"
     CDS             197111..197491
                     /locus_tag="Caur_0159"
                     /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
                     hypothetical protein;
                     KEGG: rxy:Rxyl_2576 6-pyruvoyl tetrahydropterin synthase
                     and hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 6-pyruvoyl tetrahydropterin synthase"
                     /protein_id="YP_001633802.1"
                     /db_xref="GI:163845758"
                     /db_xref="InterPro:IPR007115"
                     /db_xref="GeneID:5824914"
                     /translation="MYEVGVIAQFEAAHRLEGNFGPATRMHGHTYRLEAIVSGERLQA
                     DGTLFDITRLQEAVNAIVADLHYRDLGTVAGLENVNTTAENVARYCWDRIAAAIRGVG
                     LMTLTVRIWENPQAFASYQSRLEG"
     misc_feature    197117..197470
                     /locus_tag="Caur_0159"
                     /note="6-pyruvoyl tetrahydropterin synthase; Region: PTPS;
                     pfam01242"
                     /db_xref="CDD:250470"
     misc_feature    order(197189..197191,197195..197197,197444..197446,
                     197462..197464)
                     /locus_tag="Caur_0159"
                     /note="active site"
                     /db_xref="CDD:238351"
     gene            197496..198545
                     /locus_tag="Caur_0160"
                     /db_xref="GeneID:5824734"
     CDS             197496..198545
                     /locus_tag="Caur_0160"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: rxy:Rxyl_2575 glycosyl transferase, group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001633803.1"
                     /db_xref="GI:163845759"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5824734"
                     /translation="MALRIAFLTVGDPQRRTGGYLYHREVFRCWQARNQPVEEIVLGP
                     ADVAGQIAASNRAGQLVEAGRYDVIVVDALARAVVAPWLAHWQRLCPLVTLVHELPTV
                     AGASDPREYEWEQMLLRADALVAVSDDGANTLIARGVEAARIHIASGGCDRLLSRMPV
                     GKAREELVIAVAQWIPRKNLAHLVRVWGQVAEHPWRLELIGESDADPVYAGEVWQAIQ
                     HCPANVIVRGVLADDELAERYARASLFALPSRFEGYGLVFAEALACGLPVIAGAVGPV
                     PALVGAGGMLVHPDDEQALSVALRTVMRDAHLRQHLSTAARQRASTLPRWQDTAQHLL
                     CAIEWAYAQRHRVST"
     misc_feature    197535..198497
                     /locus_tag="Caur_0160"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    <197715..198497
                     /locus_tag="Caur_0160"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            198653..199771
                     /locus_tag="Caur_0161"
                     /db_xref="GeneID:5824735"
     CDS             198653..199771
                     /locus_tag="Caur_0161"
                     /note="KEGG: rca:Rcas_4165 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633804.1"
                     /db_xref="GI:163845760"
                     /db_xref="GeneID:5824735"
                     /translation="MTGKKAILSLITTALVLLLTACGGGATSSSQPTPTTEEARPTRT
                     PRPAGNVTSPTTAPTTAPTTDTTVEQAPVLSTNADLTALGNVQVEMKLEGTSQESGQE
                     AEPFNLVMQQIILANGDRSLTMESTSPESGLVRIISVQVGGQVYQYVEDSNQPYCMAM
                     GNFDLFSGSMLTPDALIGSIPEAQLVERGVQVNGFTTDRYTFTINEQTPNYQGEAKGE
                     IWAAQDPAVVVRHIGEFTGTITGVTTEEGGTPLPGQLGNIRWEYNVTQLDANTNITLP
                     ETCAQQQAAGAEIPLPANISNRVQMGDLISFETTESPDNIVSFYQTEMVAQGWQAGEV
                     SQYGSDYQLTFSKDGRTATILVSVIDNKTSVIIMLASS"
     sig_peptide     198653..198745
                     /locus_tag="Caur_0161"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.588 at
                     residue 31"
     gene            200038..200616
                     /locus_tag="Caur_0162"
                     /db_xref="GeneID:5824736"
     CDS             200038..200616
                     /locus_tag="Caur_0162"
                     /note="KEGG: ret:RHE_CH02020 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633805.1"
                     /db_xref="GI:163845761"
                     /db_xref="GeneID:5824736"
                     /translation="MDTTLKQGTLSVWYDEKGYGFIVDPQEERTFVHITAFGRIPRRP
                     VVGDTIFYTTTIDRDGKIRADYAWIEGLPAPRRRSYVHQHRKKGQPWSLTDVVLLLTV
                     IVLFFVAGGLFTVAFAGDTVTTTVAQIFAKRPGPPECVIKGNISIETGEKIYHLPGMR
                     DYDSTRIREEYGERWFCTEQEAIEAGWRRAGR"
     misc_feature    200053..200220
                     /locus_tag="Caur_0162"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    order(200071..200073,200098..200100,200128..200130,
                     200212..200214)
                     /locus_tag="Caur_0162"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    order(200089..200109,200125..200136)
                     /locus_tag="Caur_0162"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            201720..203462
                     /locus_tag="Caur_0163"
                     /db_xref="GeneID:5824737"
     CDS             201720..203462
                     /locus_tag="Caur_0163"
                     /note="TIGRFAM: acetolactate synthase, large subunit,
                     biosynthetic type;
                     PFAM: thiamine pyrophosphate protein domain protein
                     TPP-binding; thiamine pyrophosphate protein central
                     region; thiamine pyrophosphate protein TPP binding domain
                     protein;
                     KEGG: rca:Rcas_1557 acetolactate synthase, large subunit,
                     biosynthetic type"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase large subunit"
                     /protein_id="YP_001633806.1"
                     /db_xref="GI:163845762"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /db_xref="GeneID:5824737"
                     /translation="MTKPLTGAQIMCEALIREGVEVMFGIPGGAIMPFYYAMWDYRDR
                     LRHVLCRHEQGAGHAAEGYARATGKIGVCIGTSGPGATNLVTPIADAMMDSTPLLAIT
                     GQVGSHVLGKDAFQETDITGITMPITKHNYLVKNVDELAYVFKEAIYIATTGRPGPVL
                     IDITKDAMQKTTVPNWDIKLNLPGYKPTYHGNRRQIREAIKLLISAKKPLIIAGHGII
                     MAGAHRELQEFAERLRIPVITTLHGIGAIPENHPLSIGMPGMHGWVHVNRAIQECDVL
                     FNIGGRFDDRVTGKASTFAPNARIIHVDIDPSEIGKNVRVDVPIVGDARLVLQAFLED
                     LPPPSELADLHTHASDWMEHIREMQDKHQGKQQYKNRAAMVNMALPPHDVYEALSRTL
                     NARGNYRVVTDVGQHQMWAAQLIDWNHGPRTHITSGGAGTMGFAVPAAMGVAIACPND
                     TVWAIVGDGGFQMTNQEMATIVQEGLKNVKIAVINNGYLGMVRQWQELFEHKRYSGTP
                     LSGPDFAKLAEAYGWKGLTVERSEDVQDAIDEAHATDGPVLIDFRVEREVNVFPMVPQ
                     NKSIGEMILSESQA"
     misc_feature    201720..203426
                     /locus_tag="Caur_0163"
                     /note="acetolactate synthase 1 catalytic subunit;
                     Validated; Region: PRK07789"
                     /db_xref="CDD:236098"
     misc_feature    201744..202208
                     /locus_tag="Caur_0163"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(201783..201785,201798..201803,201813..201815,
                     201825..201827,201855..201875,201882..201884,
                     201891..201896,201903..201908,201912..201920,
                     201954..201956,201975..201977,201987..201989,
                     201996..202001)
                     /locus_tag="Caur_0163"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(201798..201806,201813..201815,201825..201827,
                     201858..201860,201864..201875,201879..201881,
                     201954..201956,201963..201968,201972..201977,
                     201984..201986,202086..202088,202095..202097)
                     /locus_tag="Caur_0163"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(201798..201800,201876..201878,201954..201956,
                     201966..201968)
                     /locus_tag="Caur_0163"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    202305..202709
                     /locus_tag="Caur_0163"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    202854..203414
                     /locus_tag="Caur_0163"
                     /note="Thiamine pyrophosphate (TPP) family,
                     Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
                     module; composed of proteins similar to the large
                     catalytic subunit of AHAS. AHAS catalyzes the condensation
                     of two molecules of pyruvate to give the...; Region:
                     TPP_AHAS; cd02015"
                     /db_xref="CDD:238973"
     misc_feature    order(202929..202940,203010..203012,203016..203018,
                     203091..203099,203106..203108,203175..203177)
                     /locus_tag="Caur_0163"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238973"
     misc_feature    order(203001..203003,203010..203012,203016..203018,
                     203103..203108,203112..203117,203136..203138,
                     203253..203258,203268..203270,203277..203279)
                     /locus_tag="Caur_0163"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238973"
     gene            203501..204040
                     /locus_tag="Caur_0164"
                     /db_xref="GeneID:5824738"
     CDS             203501..204040
                     /locus_tag="Caur_0164"
                     /note="TIGRFAM: acetolactate synthase, small subunit;
                     PFAM: amino acid-binding ACT domain protein;
                     KEGG: rrs:RoseRS_1967 acetolactate synthase, small
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase small subunit"
                     /protein_id="YP_001633807.1"
                     /db_xref="GI:163845763"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /db_xref="GeneID:5824738"
                     /translation="MKKHTIVALVQDRPGVLSRVTGLVRRRGYNIESLAVGHSETPGV
                     SRLTLVVESEDVEQVVKQLYRLIEVIKVSDVTDDPTVESEMTMIKLHAPPAVRHEIIS
                     MCSVFGARIVDVGSNTMIVEMTGTPGKVENFIEVVRPYGIKEMMRTGRIAMVRGARGH
                     NAGEYVEPATNGASVPVLN"
     misc_feature    203507..203977
                     /locus_tag="Caur_0164"
                     /note="acetolactate synthase 3 regulatory subunit;
                     Reviewed; Region: ilvH; PRK11895"
                     /db_xref="CDD:183365"
     misc_feature    203510..203719
                     /locus_tag="Caur_0164"
                     /note="N-terminal ACT domain of the Escherichia coli
                     IlvH-like regulatory subunit of acetohydroxyacid synthase
                     (AHAS); Region: ACT_AHAS; cd04878"
                     /db_xref="CDD:153150"
     misc_feature    order(203528..203530,203534..203536,203549..203551,
                     203588..203593,203606..203608,203633..203635)
                     /locus_tag="Caur_0164"
                     /note="putative valine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153150"
     misc_feature    order(203540..203545,203552..203554,203573..203575,
                     203582..203584,203594..203608,203636..203638)
                     /locus_tag="Caur_0164"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153150"
     misc_feature    203744..203968
                     /locus_tag="Caur_0164"
                     /note="Small subunit of acetolactate synthase; Region:
                     ALS_ss_C; pfam10369"
                     /db_xref="CDD:255942"
     gene            204138..205160
                     /locus_tag="Caur_0165"
                     /db_xref="GeneID:5824739"
     CDS             204138..205160
                     /locus_tag="Caur_0165"
                     /EC_number="1.1.1.86"
                     /note="catalyzes the formation of
                     (R)-2,3-dihydroxy-3-methylbutanoate from
                     (S)-2-hydroxy-2-methyl-3-oxobutanoate in valine and
                     isoleucine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="YP_001633808.1"
                     /db_xref="GI:163845764"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR013023"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="GeneID:5824739"
                     /translation="MAELYYDNQADLNRLKNKPIAIIGFGSQGHAHARNLADSGLDVR
                     VGLYPGSKSWAKVEAAGLKVMTVAEAAREAQIVMILTPDIGQADLYREHIAPAMEPGK
                     TLMFAHGFNIRFGQIIPPQGIDVSMVAPKAPGHRVREVFVQGGGVPALIAVEQDATGG
                     AFEDALAYAKGLGCTRAGVLRTTFAEETETDLFGEQVVLCGGVSALVKAAFETLVEAG
                     YQPEVAYFECMHELKLIVDLFYQGGLNYMRYSVSDTAEWGDYTAGPKIITDQTRAAMR
                     QILADIQSGAFAEDWIDENHNGRPRFNAYRQADINHPIEQIGRELRRMMPFVNPREVK
                     PGEGGA"
     misc_feature    204138..205127
                     /locus_tag="Caur_0165"
                     /note="ketol-acid reductoisomerase; Provisional; Region:
                     PRK05479"
                     /db_xref="CDD:235491"
     misc_feature    204180..204671
                     /locus_tag="Caur_0165"
                     /note="Acetohydroxy acid isomeroreductase, catalytic
                     domain; Region: IlvN; pfam07991"
                     /db_xref="CDD:116601"
     misc_feature    204687..205124
                     /locus_tag="Caur_0165"
                     /note="Acetohydroxy acid isomeroreductase, catalytic
                     domain; Region: IlvC; pfam01450"
                     /db_xref="CDD:250630"
     gene            205232..206938
                     /locus_tag="Caur_0166"
                     /db_xref="GeneID:5824740"
     CDS             205232..206938
                     /locus_tag="Caur_0166"
                     /note="TIGRFAM: 2-isopropylmalate synthase;
                     PFAM: pyruvate carboxyltransferase; LeuA allosteric
                     (dimerisation) domain;
                     KEGG: rrs:RoseRS_1965 2-isopropylmalate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="YP_001633809.1"
                     /db_xref="GI:163845765"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005671"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="GeneID:5824740"
                     /translation="MSNTTEPSVEYVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLAR
                     LRVDIIEAGFPAASPGDWAAVHEIAREIGTPDGPIIAALARANRDDIDKAWSAIQPAA
                     KKRIHTFMSTSDIHLEYQFRKTRAEALALIHEMVSYARSLCEDVEFSPMDAGRTDPLF
                     LREAVAVAVAAGATTLNIPDTVGYLTPDEYGAMIRDLRENVPGIERCILSTHCHDDLG
                     MAVANSLAGVRAGARQVECTINGIGERAGNASLEEVVMALHTRQQYYGLRTRVETREI
                     ARTSRLVSSFIGVPVPPNKAIVGANAFAHESGIHQDGVLKYRQTYEIMSAETVGLDSN
                     TLVLGKHSGRHAFRKYLEEKGYKLNEEEFQHVFARFKDLCDRKKKVDDRDIEALIAGE
                     MQHTPELYKLDHVQYASGIGMIPTATVRLIGPDGQTRIDSAQGTGPVDAVYQAINRII
                     QRPNELIEFSINAITEGLDAVAEVTVRIREQGAPARLNESSSTATSLTGRRPAQQIFS
                     GYGVHTDTIVAAAQAYMAALNKMLAARQERIKAEAVAYAAGYSGESGTLPVDIFGGST
                     LG"
     misc_feature    205265..206863
                     /locus_tag="Caur_0166"
                     /note="2-isopropylmalate synthase; Validated; Region:
                     PRK00915"
                     /db_xref="CDD:234864"
     misc_feature    205271..206083
                     /locus_tag="Caur_0166"
                     /note="2-isopropylmalate synthase (IPMS), N-terminal
                     catalytic TIM barrel domain; Region: DRE_TIM_IPMS;
                     cd07940"
                     /db_xref="CDD:163678"
     misc_feature    order(205289..205294,205301..205303,205382..205384,
                     205484..205486,205550..205552,205676..205678,
                     205682..205684,205766..205768,205772..205774,
                     205865..205867,205871..205873)
                     /locus_tag="Caur_0166"
                     /note="active site"
                     /db_xref="CDD:163678"
     misc_feature    order(205289..205294,205382..205384)
                     /locus_tag="Caur_0166"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163678"
     misc_feature    order(205865..205867,205871..205873)
                     /locus_tag="Caur_0166"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163678"
     misc_feature    206369..206785
                     /locus_tag="Caur_0166"
                     /note="LeuA allosteric (dimerisation) domain; Region:
                     LeuA_dimer; smart00917"
                     /db_xref="CDD:214910"
     gene            207061..207915
                     /locus_tag="Caur_0167"
                     /db_xref="GeneID:5824741"
     CDS             207061..207915
                     /locus_tag="Caur_0167"
                     /EC_number="4.2.1.51"
                     /note="PFAM: prephenate dehydratase; amino acid-binding
                     ACT domain protein;
                     KEGG: rrs:RoseRS_1964 prephenate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="YP_001633810.1"
                     /db_xref="GI:163845766"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="GeneID:5824741"
                     /translation="MQTIAYLGPPGTFSEEAALAYAAGREARLLPLASIPAVVTAIET
                     EAATVGVLPIENLLEGSVSYTLDLLIHETNLQIAGEIVVPIRQYLLARPGLQLSDIKV
                     LYAHPQSLAQCRRFVERCLPGVATVASLSNSAAPAEAMADERPAAAIGTLRAAELVGA
                     TILAREIADSPHNVTRFIVLAREDAPPTGDDKTSFCFGFTREDRPGSLVSALQELAVE
                     NINMTKLESRPTRAILGQYIFLVDINGHRREPHVARALERIRLHTGMLKIFGSYPRWR
                     GANGNHAS"
     misc_feature    207061..207879
                     /locus_tag="Caur_0167"
                     /note="Prephenate dehydratase [Amino acid transport and
                     metabolism]; Region: PheA; COG0077"
                     /db_xref="CDD:223155"
     misc_feature    207070..207615
                     /locus_tag="Caur_0167"
                     /note="Prephenate dehydratase; Region: PDT; pfam00800"
                     /db_xref="CDD:250142"
     misc_feature    207634..207879
                     /locus_tag="Caur_0167"
                     /note="C-terminal ACT domain of the bifunctional
                     chorismate mutase-prephenate dehydratase (CM-PDT) enzyme
                     and the prephenate dehydratase (PDT) enzyme; Region:
                     ACT_CM-PDT; cd04905"
                     /db_xref="CDD:153177"
     misc_feature    order(207676..207687,207736..207747)
                     /locus_tag="Caur_0167"
                     /note="putative L-Phe binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153177"
     gene            207940..209364
                     /locus_tag="Caur_0168"
                     /db_xref="GeneID:5824742"
     CDS             207940..209364
                     /locus_tag="Caur_0168"
                     /EC_number="4.2.1.33"
                     /note="dehydratase component, catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate"
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase large subunit"
                     /protein_id="YP_001633811.1"
                     /db_xref="GI:163845767"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="GeneID:5824742"
                     /translation="MNKPRTLFEKVWEAHLVRPETAETPAVLYIDLHLIHEVTSPQAF
                     TELRQRGLRVRRPDKTLATMDHSTPTTPRNHLGIIPVVDPMAISQLEQLRKNCAEFGI
                     PLFELGDENQGIVHVIGPEQGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVGHVL
                     ATQCLLQRKPKTCAVRIDGRLGPGVTAKDIILALIAKYGVGGGTGYVFEYMGEAIRAL
                     SMEERMTICNMSIEGGARAGMVAPDDTTFEYIAGRPFAPKGADFEAAVARWRTLPSDE
                     GATFDHELTLSASELKPMITYGTNPGMGIPIDAPVPRPEDMPDARSRAALDKALAYMG
                     LEPGKPLLGHPVDVVFIGSCTNSRLSDLRQAAQFFRGRKVAPGVRVMVVPGSQQVKRA
                     AEAEGLDRIFKEAGAEWREAGCSACLGMNDDKVPPGKYAVSTSNRNFEGRQGPGARTM
                     LASPLTAAAAAITGVVTDPRTLLN"
     misc_feature    208033..209337
                     /locus_tag="Caur_0168"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    order(208045..208047,208054..208056,208342..208347,
                     209191..209193,209248..209250,209263..209265)
                     /locus_tag="Caur_0168"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    order(208348..208350,208999..209001,209179..209181,
                     209188..209193,209245..209247)
                     /locus_tag="Caur_0168"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            209376..209981
                     /gene="leuD"
                     /locus_tag="Caur_0169"
                     /db_xref="GeneID:5824743"
     CDS             209376..209981
                     /gene="leuD"
                     /locus_tag="Caur_0169"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis; forms a heterodimer of LeuC/D"
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase small subunit"
                     /protein_id="YP_001633812.1"
                     /db_xref="GI:163845768"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="GeneID:5824743"
                     /translation="MEPVSTITGKAVVLPVENIDTDQIIPARFLKVTDRSGLAAGLFE
                     AWRYQADGTPNPDFPLNRPEAAGATILISGRNFGCGSSREHAPWALQDYGFKAVLAPS
                     FADIFRSNSLKIGLLPVTIDQAVYDELVARYAADPQMHLTIDLATQTVTLPDGRQVHF
                     PIDAFSKYCLLHGVDQLGFLLQQEEAIIAYEASHPQPVTTR"
     misc_feature    209415..209810
                     /gene="leuD"
                     /locus_tag="Caur_0169"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    209616..209624
                     /gene="leuD"
                     /locus_tag="Caur_0169"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            complement(211032..212369)
                     /locus_tag="Caur_0170"
                     /db_xref="GeneID:5824744"
     CDS             complement(211032..212369)
                     /locus_tag="Caur_0170"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; pyridine nucleotide-disulphide
                     oxidoreductase dimerisation region; FAD dependent
                     oxidoreductase;
                     KEGG: nfa:nfa9670 putative dihydrolipoamide dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_001633813.1"
                     /db_xref="GI:163845769"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5824744"
                     /translation="MKQIVVIGGGAAGVEAAVAAAQGNTKVTLVSEGPIGGRTGWDSL
                     LPSKVWLHAAEVAGIATAAAGEGVAVNGVQVDPTAVLQRIKHVATRWSDHEQQRLQAA
                     GVTVMQGVAAFSSPHELTIQTQAGQQTITADVIIIATGSVPRFPPTMKPDGQRIIAPR
                     FASHLHTLPDDIIVIGGGPTGSEFASLFSRLGVKVTWLVGSPGVLPMFATNARSTLAA
                     AMQAHGVEIHQVDVERAERTEEGVSVLAADGTTYTAAMAFLAIGRTPDLSRLNLSAAG
                     LTVEANGQLTVDNYGRTPVNHIFAVGDAAGGPMLANRALAQAWIAGRTAADLPAPGYC
                     PHTIVHAVYTVPEVAQVGLVMDTELSRIRAEYGSSLKSYLGAETSGWIELTFDPITRQ
                     VRGGVAVGDHAADLLAPVALAIQTGATLADLAAVFAAYPTLSETVFAAARAAG"
     sig_peptide     complement(212310..212369)
                     /locus_tag="Caur_0170"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.979) with cleavage site probability 0.506 at
                     residue 20"
     misc_feature    complement(211038..212294)
                     /locus_tag="Caur_0170"
                     /note="dihydrolipoamide dehydrogenase; Region:
                     lipoamide_DH; TIGR01350"
                     /db_xref="CDD:233368"
     misc_feature    complement(211623..211856)
                     /locus_tag="Caur_0170"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(211059..211349)
                     /locus_tag="Caur_0170"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            complement(212868..215813)
                     /locus_tag="Caur_0171"
                     /db_xref="GeneID:5824745"
     CDS             complement(212868..215813)
                     /locus_tag="Caur_0171"
                     /note="PFAM: glycosyl transferase family 51;
                     penicillin-binding protein transpeptidase;
                     KEGG: rca:Rcas_0508 peptidoglycan glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001633814.1"
                     /db_xref="GI:163845770"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="GeneID:5824745"
                     /translation="MIRSRRLHANGRNGRRHVPPHLLRGLRGRSTPRSAVSRWLVNAL
                     LAGLGLVAVVIVAIAGFAYNAYAQVAESLKPRLALLDNRELFENSRIFDRNGELLYEF
                     FDTGKRTKVTIDEISPLLIQATIAIEDKTFYTNPGIDLAGIVRTLIDSLRAGEETGGA
                     STITQQVIKNSVLTPEERLPERRYERKLKEIILAQELDRIYTKDQILELYLNENFYGN
                     LAYGIQAASEVYFGVSAADLDLNQASLLAGLPQLPSVYNPINYLERDEQGGYLPPVFV
                     GDGWLDPDARLPAGTPLPRIRQAAVLRRMVEDGYITEAQARQALATPLRFAPQEAPLN
                     APHFVFYVRDLLLQRYGAQIVYGGGLRITTTLDLQLQRMAQRTAFERIAELESRNIHN
                     AAVVIMQPNTGQILAMVGSIDYNAVKPTTTPGESGNVLDGQVNVATRERQPGSALKPF
                     TYLAAMEQGMTPETVLWDVPTRFPTGTGDWYAPQNYNGQWNGPVRIRTALANSLNMPA
                     VRALKFAGIDYTIRLLERVGIRTGLKRGAGFYGLSLTLGGGEVSPLELTTAYNTLASG
                     GRYFAPVAILEITDSQGRVLERFTQTPGEEVVDPALVAIISDMLSDDRARQAIWGLNS
                     PLRLSLPAAVKTGTTNDWRDAWAVGYTPFVTVGVWTGNNNNEPTARVESLTGGGIIWR
                     NVMENIFRLIAEDERYRDLFAAPFPNGEIQTEFVLPEEVVPRPICELPGPFGGYREEL
                     FTLDMIKRLEEAAQPTPEATTGDAIPNEGFCSAYTKVRVVRIPTPEEWTTSGELRPNP
                     PPPPPTDPKAPPLPQDLSALTDGAYCRPAPDAAYPPELVRDIYLWKLPPPDPDEEVEY
                     KWRGGDATVPLKYEELPECTPAMFEPPIPVPPVEGAILMPDLRRLGENQAKEVLALLG
                     IDPGRIYVDYQGPDRAGEDYYRYGPYVVLSSLPAAGEWILPDTTIVLGIRAPDPNPEP
                     PASDSTEGN"
     sig_peptide     complement(215619..215813)
                     /locus_tag="Caur_0171"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.649) with cleavage site probability 0.363 at
                     residue 65"
     misc_feature    complement(215013..215531)
                     /locus_tag="Caur_0171"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     misc_feature    complement(213756..215495)
                     /locus_tag="Caur_0171"
                     /note="penicillin-binding protein, 1A family; Region:
                     PBP_1a_fam; TIGR02074"
                     /db_xref="CDD:233710"
     misc_feature    complement(213756..214637)
                     /locus_tag="Caur_0171"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl17760"
                     /db_xref="CDD:266819"
     misc_feature    complement(212931..213137)
                     /locus_tag="Caur_0171"
                     /note="PASTA domain; Region: PASTA; pfam03793"
                     /db_xref="CDD:252166"
     gene            215985..217481
                     /locus_tag="Caur_0172"
                     /db_xref="GeneID:5824746"
     CDS             215985..217481
                     /locus_tag="Caur_0172"
                     /note="KEGG: rrs:RoseRS_0867 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633815.1"
                     /db_xref="GI:163845771"
                     /db_xref="GeneID:5824746"
                     /translation="MHQPSLIGPAILIVLLITLPLASIGDLILDQIGWQPLWLIGASI
                     IAGMEAFALRMRMLAGLHEAEGGTLRYLAAEIFALVVLARLVATLGFGGEGIRAMMSW
                     ITDPLAFFDVPFLICLLALTTVVMLSRSGIAAIAAITPNPPQKMPLYTLDVLFYNSDA
                     KIRRWNAVKAIISGVSWGGLLIIWLQSWRPGNADAFSGWIALYLIGGLSLIELARRRA
                     SLADWQSDGAEVAVDVQRSWHLLSVMLIGLMIVLTLVFPFPREMSMPEEWRRAIYSLV
                     GLVIFIGLIASLLFVGLISLIMLLPMLLYLLLNWLLTTNSTSAAMPIPQPPLIPPATA
                     SEPMVWPGLIFWFCVAVLTVLAFWRIARRQTWLKAAWVNAVTWLTAWWHHLRHRRIGG
                     WPHWWHSQEEPPPPPHSRCSRSGPVDTVIACYHAALRHATARGYPRRPPQTPAEYAER
                     ISGELPAGAAELQALTEAYQRVVYAGKPFDRSERRQFSALLRRFRRKV"
     sig_peptide     215985..216053
                     /locus_tag="Caur_0172"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.646) with cleavage site probability 0.429 at
                     residue 23"
     misc_feature    217248..217466
                     /locus_tag="Caur_0172"
                     /note="Domain of unknown function (DUF4129); Region:
                     DUF4129; pfam13559"
                     /db_xref="CDD:257876"
     gene            complement(218482..219540)
                     /locus_tag="Caur_0173"
                     /db_xref="GeneID:5824747"
     CDS             complement(218482..219540)
                     /locus_tag="Caur_0173"
                     /note="PFAM: MaoC domain protein dehydratase;
                     KEGG: rca:Rcas_0913 MaoC domain protein dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="YP_001633816.1"
                     /db_xref="GI:163845772"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="GeneID:5824747"
                     /translation="MSAKTNPGNFFEDFRLGQTIVHATPRTITEGDVALYTSLYGSRF
                     ALTSSTPFAQSLGLERAPIDSLLVFHIVFGKTVPDISLNAIANLGYAGGRFGAVVYPG
                     DTLSTTSKVIGLRQNKDGKTGVVYVHSVGVNQWDEVVLEYIRWVMVRKRDPNAPAPET
                     VVPDLPDSVPVTDLTVPYTVSAANYNLAHAGSNYLWDDYEVGEKIDHVDGVTIEEAEH
                     MQATRLYQNTARVHFNLHVEREGRFGRRIVYGGHIISLARSLSFNGLANALSIAAINS
                     GRHTNPSFAGDTIYAWSEILAKMAIPGRTDIGALRVRTVATKDRPCHDFPYRDAEGNY
                     DPAVVLDFDYTVLMPRRG"
     misc_feature    complement(219085..219519)
                     /locus_tag="Caur_0173"
                     /note="FkbR2 is a Streptomyces hygroscopicus protein with
                     a hot dog fold that belongs to a conserved family of
                     proteins found in prokaryotes and archaea but not in
                     eukaryotes. FkbR2  has sequence similarity to (R)-specific
                     enoyl-CoA hydratase, the peroxisomal...; Region: FkbR2;
                     cd03451"
                     /db_xref="CDD:239535"
     misc_feature    complement(order(219343..219348,219355..219357,
                     219400..219402,219409..219411,219415..219417,
                     219430..219432))
                     /locus_tag="Caur_0173"
                     /note="putative active site [active]"
                     /db_xref="CDD:239535"
     misc_feature    complement(order(219346..219348,219400..219402,
                     219409..219411,219415..219417))
                     /locus_tag="Caur_0173"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:239535"
     misc_feature    complement(218485..218961)
                     /locus_tag="Caur_0173"
                     /note="FkbR2 is a Streptomyces hygroscopicus protein with
                     a hot dog fold that belongs to a conserved family of
                     proteins found in prokaryotes and archaea but not in
                     eukaryotes. FkbR2  has sequence similarity to (R)-specific
                     enoyl-CoA hydratase, the peroxisomal...; Region: FkbR2;
                     cd03451"
                     /db_xref="CDD:239535"
     misc_feature    complement(order(218788..218793,218800..218802,
                     218845..218847,218854..218856,218860..218862,
                     218875..218877))
                     /locus_tag="Caur_0173"
                     /note="putative active site [active]"
                     /db_xref="CDD:239535"
     misc_feature    complement(order(218791..218793,218845..218847,
                     218854..218856,218860..218862))
                     /locus_tag="Caur_0173"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:239535"
     gene            complement(219562..220608)
                     /locus_tag="Caur_0174"
                     /db_xref="GeneID:5824877"
     CDS             complement(219562..220608)
                     /locus_tag="Caur_0174"
                     /note="PFAM: HpcH/HpaI aldolase;
                     KEGG: rrs:RoseRS_4173 HpcH/HpaI aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="HpcH/HpaI aldolase"
                     /protein_id="YP_001633817.1"
                     /db_xref="GI:163845773"
                     /db_xref="InterPro:IPR005000"
                     /db_xref="GeneID:5824877"
                     /translation="MRKLAHNFYKPLAIGAPEPIRELPVRPERVVHFFPPHVEKIRAR
                     IPEVAKQVDVLCGNLEDAIPMDAKEAARNGFIEVVKATDFGDTALWVRVNALNSPWVL
                     DDIAEIVAAVGNKLDVIMIPKVEGPWDIHFVDQYLALLEARHQIKKPILIHALLETAQ
                     GMVNLEEIAGASPRMHGFSLGPADLAASRGMKTTRVGGGHPFYGVLADPQEGQAERPF
                     YQQDLWHYTIARMVDVAVAHGLRAFYGPFGDIKDEAACEAQFRNAFLLGCTGAWSLAP
                     NQIPIAKRVFSPDVNEVLFAKRILEAMPDGSGVAMIDGKMQDDATWKQAKVIVDLARM
                     IAKKDPDLAQAYGL"
     misc_feature    complement(219589..220518)
                     /locus_tag="Caur_0174"
                     /note="Citrate lyase beta subunit [Carbohydrate transport
                     and metabolism]; Region: CitE; COG2301"
                     /db_xref="CDD:225184"
     gene            complement(220660..221889)
                     /locus_tag="Caur_0175"
                     /db_xref="GeneID:5824878"
     CDS             complement(220660..221889)
                     /locus_tag="Caur_0175"
                     /note="PFAM: L-carnitine dehydratase/bile acid-inducible
                     protein F;
                     KEGG: rrs:RoseRS_4174 acyl-CoA transferase/carnitine
                     dehydratase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_001633818.1"
                     /db_xref="GI:163845774"
                     /db_xref="InterPro:IPR003673"
                     /db_xref="GeneID:5824878"
                     /translation="MKGILHGLRVVEGSAFVAAPLGGMTLAQLGADVIRFDPIGGGLD
                     YKRWPVTLDGKHSLFWAGLNKGKRSIAIDIRHPRGQELLTQLICAPGEHAGLFITNFP
                     ARGWLSYDELKRHRADLIMVNLVGRRDGGSEVDYTVNPQLGLPFMTGPVTTPDVVNHV
                     LPAWDIVTGQMIALGLLAAERHRRLTGEGQLVKIALKDVGLAMIGHLGMIAEVMINDT
                     DRPRQGNYLYGAFGRDFETLDGKRVMVVGLTDLQWKALGKATGLTDAFNALGARLGLN
                     MDEEGDRFRARHEIAALLEPWFHARTLAEVRRIFEQHRVTWAPYRTVREAIAQDPDCS
                     TDNPMFAMVEQPGIGSYLMPGSPLDFTAVPRLPVQPAPRLGEHTDEILLEVLGLSEAE
                     VGRLHDEGIVAGPDRAA"
     misc_feature    complement(220675..221883)
                     /locus_tag="Caur_0175"
                     /note="mesaconyl-CoA isomerase; Region: mesacon_CoA_iso;
                     TIGR04253"
                     /db_xref="CDD:211976"
     gene            complement(222002..222409)
                     /locus_tag="Caur_0176"
                     /db_xref="GeneID:5824879"
     CDS             complement(222002..222409)
                     /locus_tag="Caur_0176"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633819.1"
                     /db_xref="GI:163845775"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="GeneID:5824879"
                     /translation="MVACIGKSDGTAAHPYLAWHGMGSTAINHLPFGWGRAARLTGDR
                     RHQALFAGPARNPAQITDLRSQRVTQVLAMGARAWHRCTAMRSTRPRLMVACIGKSDG
                     TAAHPYVARNRMGSTAIHHLPFGWCRAARYWRS"
     gene            complement(222384..223025)
                     /locus_tag="Caur_0177"
                     /db_xref="GeneID:5824880"
     CDS             complement(222384..223025)
                     /locus_tag="Caur_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633820.1"
                     /db_xref="GI:163845776"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="GeneID:5824880"
                     /translation="MGARAWHRCTAMRSTRPRLMVACIGKSNGTAAHPYLAWHGMGST
                     AINHLPFGWGRAARLTGDRRHQALFAGPARNPAQITDLRSQRVTQVLAGGARAWHRCT
                     AMRSTRPRPMVACIGKSDGTAAHPYVARNRMGSTARLVQGNGTTWGRAARLTGDRRHQ
                     AVFAGPAQNPAQISDLRSQRVTQVLVVGARAWHRCMAMRSIRPRLIGGLHRQE"
     gene            complement(223035..224252)
                     /locus_tag="Caur_0178"
                     /db_xref="GeneID:5824881"
     CDS             complement(223035..224252)
                     /locus_tag="Caur_0178"
                     /note="PFAM: L-carnitine dehydratase/bile acid-inducible
                     protein F;
                     KEGG: rca:Rcas_0910 L-carnitine dehydratase/bile
                     acid-inducible protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_001633821.1"
                     /db_xref="GI:163845777"
                     /db_xref="InterPro:IPR003673"
                     /db_xref="GeneID:5824881"
                     /translation="MDGTTTTLPLAGIRVIDAATVIAAPFCATLLGEFGADVLKVEHP
                     IGGDALRRFGTPTARGDTLTWLSESRNKRSVTLNLQHPEGARVFKELIAHSDVLCENF
                     RPGTLEKWGLGWDVLSKINPRLIMLRVTGYGQTGPYRDRPGFARIAHAVGGIAYLAGM
                     PKGTPVTPGSTTLADYMTGLYGCIGVLLALRHREQTGRGQYIDAALYESVFRCSDELV
                     PAYGMYRKVRERHGSHYNEFACPHGHFQTKDGKWVAISCATDKLFARLANAMGRPELA
                     SSSVYGDQKVRLAHASDVNEIVRDWCSSLTRAEVLERCYATATPAAPLNDIADFFGDR
                     HVHARRNLVAIDAEDLGETLIMPNVVPKLSETPGSIRSLGPKLGEHTEEVLKEILGMC
                     DEQINDLRSKRVI"
     misc_feature    complement(223038..224243)
                     /locus_tag="Caur_0178"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(224515..225882)
                     /locus_tag="Caur_0179"
                     /db_xref="GeneID:5824882"
     CDS             complement(224515..225882)
                     /locus_tag="Caur_0179"
                     /note="PFAM: L-carnitine dehydratase/bile acid-inducible
                     protein F;
                     KEGG: rca:Rcas_0909 L-carnitine dehydratase/bile
                     acid-inducible protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_001633822.1"
                     /db_xref="GI:163845778"
                     /db_xref="InterPro:IPR003673"
                     /db_xref="GeneID:5824882"
                     /translation="MAKASRLTRSTGQPTEVSEGQVTGTSEMPPTGEEPSGHAESKPP
                     ASDPMSTPGTGQEQLPLSGIRVIDVGNFLAGPYAASILGEFGAEVLKIEHPLGGDPMR
                     RFGTATARHDATLAWLSEARNRKSVTIDLRQQEGVALFLKLVAKSDILIENFRPGTME
                     EWGLSWPVLQATNPGLIMLRVSGYGQTGPYRRRSGFAHIAHAFSGLSYLAGFPGETPV
                     LPGTAPLGDYIASLFGAIGILIALRHKEQTGRGQLIDVGIYEAVFRILDEIAPAYGLF
                     GKIREREGAGSFIAVPHGHFRSKDGKWVAIACTTDKMFERLAEAMERPELASPELYGD
                     QRKRLAARDIVNQITIEWVGSLTRDEVMRRCLEKEVPVGPLNSIADMFNDEHFLARGN
                     FACIEAEGIGEVVVPNVIPRLSETPGRVTNLGPPLGNATYEVLRELLDISAEEIKRLR
                     SRKII"
     misc_feature    complement(<225739..225858)
                     /locus_tag="Caur_0179"
                     /note="Domain of unknown function (DUF4620); Region:
                     DUF4620; pfam15399"
                     /db_xref="CDD:259531"
     misc_feature    complement(224518..225717)
                     /locus_tag="Caur_0179"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            226187..227029
                     /locus_tag="Caur_0180"
                     /db_xref="GeneID:5824883"
     CDS             226187..227029
                     /locus_tag="Caur_0180"
                     /note="KEGG: rrs:RoseRS_4177 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633823.1"
                     /db_xref="GI:163845779"
                     /db_xref="GeneID:5824883"
                     /translation="MSSADWMAWIGRTEQVEDDICLAQAIAAAATLEPPSGAPTADSP
                     LPPLWHWFYFLPRAPQSQLSSDGHPQRGGFIPPIPYPRRMFAGARIRFHHPLRIGQPA
                     RREGVIRNITQKSGRSGPLAFVTVGYQIYQHEMLCIEEEQDIVYREPGAPVPAPTPVE
                     LPPVHDAITRTVVPDPRLLFRFSALTFNAHRIHYDRPYAQHEEGYPGLVVHGPLVAVL
                     LMELARHHTSRPIVGFSFRSQAPLFDLAPFRLLARPNGDRIDLEAQGPDGATALSATV
                     ELGG"
     misc_feature    226187..227017
                     /locus_tag="Caur_0180"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3777"
                     /db_xref="CDD:226300"
     misc_feature    226679..227020
                     /locus_tag="Caur_0180"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    order(226817..226822,226898..226909)
                     /locus_tag="Caur_0180"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(226835..226837,226844..226849,226856..226858,
                     226874..226882)
                     /locus_tag="Caur_0180"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            228787..230322
                     /locus_tag="Caur_0181"
                     /db_xref="GeneID:5824884"
     CDS             228787..230322
                     /locus_tag="Caur_0181"
                     /note="PFAM: protein of unknown function DUF224
                     cysteine-rich region domain protein;
                     KEGG: rrs:RoseRS_4179 protein of unknown function DUF224,
                     cysteine-rich region domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633824.1"
                     /db_xref="GI:163845780"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR004017"
                     /db_xref="GeneID:5824884"
                     /translation="MEPEMQAFVDSLRHNLTAEDVVNLEACMDCKMCGEACAWYLVTG
                     DEKLHPTYKTGLIRQIYHRYMTVEGRIGGALGLVPTPTVADLREHMQYFWACTACGRC
                     TLACPSGISIRRIVRLARAAYADSGLSLANPTIRSIIENTDRHRHSFGLTMPQVIGRV
                     GLFLRSEDLEVPVDVPGADMLFVCPAAGNTKIPDYGIKLIKILNAAGVSYTISPYVID
                     TGTEIDHIAVHHNLSKQMLEDWEQEADRLGVKNILLVECGCDTRTLYAEASETLGRPF
                     RYPIVSVDALMLDLIKQGRLPVEKTHLKVTLHDPCYATRLSGLGDLFRELLNLVTDNF
                     IEMTPNREHNYCCNGGAGGMRLPENTATRRKISVLKANQIRATNATYVTSPCVVCTLS
                     LEDTCQTYGLAPQGERMALVLFEVVYAAMEQALAKRGELDRMRIPAELQNRDHEFFVA
                     HSIEGRLSMLMQLPEFPALLDWLEQDDIVRRFSKDHPHVYDLLRAWREVVTAPKQRSI
                     TAD"
     misc_feature    228853..229116
                     /locus_tag="Caur_0181"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    228856..230043
                     /locus_tag="Caur_0181"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    229699..229968
                     /locus_tag="Caur_0181"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            230354..231175
                     /locus_tag="Caur_0182"
                     /db_xref="GeneID:5824885"
     CDS             230354..231175
                     /locus_tag="Caur_0182"
                     /note="KEGG: rrs:RoseRS_4180 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633825.1"
                     /db_xref="GI:163845781"
                     /db_xref="GeneID:5824885"
                     /translation="MLITLLNIVAPIAMTIFVVGVGLRLGRFVMALLTKRRFRGISPT
                     FESPPPRLGFWQSLAAVLFGPYQHFYRRANPVWGRGYLAYHVAIITEVIGYSISALIV
                     FGNILLGRPIPDVALHLEHSFNYTPANLLAIIFGNGEELQSRFLFGDFAPYFVGITWV
                     AVIFAVIGNLHLMTVLLRRWSGAVVSDIDPPAHRIRTPGRRPFDRVLIRTIIFCIIWT
                     ELLARLQLVPGIVYVHSLLGLALFTLLPFTYLFHMVYNFLAVFYATRRRMARTIA"
     gene            complement(231269..232126)
                     /locus_tag="Caur_0183"
                     /db_xref="GeneID:5824886"
     CDS             complement(231269..232126)
                     /locus_tag="Caur_0183"
                     /note="TIGRFAM: formate dehydrogenase family accessory
                     protein FdhD;
                     PFAM: formate dehydrogenase subunit FdhD;
                     KEGG: rca:Rcas_4385 formate dehydrogenase family accessory
                     protein FdhD"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase family accessory protein
                     FdhD"
                     /protein_id="YP_001633826.1"
                     /db_xref="GI:163845782"
                     /db_xref="InterPro:IPR003786"
                     /db_xref="GeneID:5824886"
                     /translation="MITRASTRRRTILKVRDGRWQQTKDTVVVEEPLEIRLATAGNPQ
                     STALATVMRTPGADVELAAGFLFGEGIVRDRYDIVTIRYCVDADLDEEARFNTLIVTL
                     RPELDLNLDHIRRLFFVSSSCGVCGKISLEALRLRGCTPLIDDPTLQVRCSVLAGIDQ
                     RVQQAQELFSRTGGLHAAALISLDGQIHALHEDIGRHNAVDKLIGDHLLGGRLELLRQ
                     SVLLVSGRASFEIMQKALMAQIPIVAAVGAPSTLAVTLAQHFNMTLIGFLRGSSFNIY
                     AGAGRVEEG"
     misc_feature    complement(231284..232123)
                     /locus_tag="Caur_0183"
                     /note="FdhD/NarQ family; Region: FdhD-NarQ; cl00659"
                     /db_xref="CDD:260556"
     gene            complement(232142..234382)
                     /locus_tag="Caur_0184"
                     /db_xref="GeneID:5824887"
     CDS             complement(232142..234382)
                     /locus_tag="Caur_0184"
                     /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
                     subunit;
                     PFAM: molybdopterin oxidoreductase; molydopterin
                     dinucleotide-binding region;
                     KEGG: rrs:RoseRS_4018 oxidoreductase alpha (molybdopterin)
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase alpha (molybdopterin) subunit"
                     /protein_id="YP_001633827.1"
                     /db_xref="GI:163845783"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR010046"
                     /db_xref="GeneID:5824887"
                     /translation="MKRRGWNPATWVSLVPNGLGHVKPNHYWEIVRTIWENRDNLGKA
                     WRILHEGVCDGCALGTAGLRDFTMKGVHLCTVRLNLLRLNTMPPLDIHRLHDVADLQR
                     LNGRELRALGRLPYPMLRRRGEAGFRRISWDDALNEIAARLRNTDPHRMAFYLTSRGI
                     TNETYYVAQKVARFLGTNNVDNAARLCHAPSTTAMKQALGVAASTCSYRDWIGTDLLI
                     FIGSDAPNNQPVTTKYLYYAKQHGTRILVINPYREPGLERYWVPSVFESALFGTRLAD
                     RFFQIHTGGDIAFLNGTLKHLIERNWLDWDFISAHTRDFERVQVALAQQSWDDLERAS
                     GATRGEMLAFAEALAQAKSAVFVWSMGITQHEYGVENVKAILNLALARGFIGREYCGV
                     MPIRGHSGVQGGGEMGCTATTFPGGKPITPDTAHWLGEQWGFAVPAWKGLSCGDMLDV
                     AYNGELDVFYAVGGNFLDTMPDPAYIRTALARPALRVHQDIVLTTQMLVEPADTVILL
                     PAATRYEQRDGGTETSTEREIIFSPYIAPPPAEARSEWEILLSVAERTKPEQAHLIHF
                     ADGQQIRNEIARIVPEYNGIQHLHQTGDHIQWGGRILCRDGRFGTPDGKAVFTPLKPP
                     VTTLPPAMFVLKTRRGKQFNSLIHDERDPLNGALRDDVLINPVDAATLGVREGDWVIL
                     RSAVGEMRARIKFAPLKSGNIQVHWPEGNVLIDAHQRDPGAGVPSYKALVSIHPITEA
                     VLQEQR"
     misc_feature    complement(232187..234361)
                     /locus_tag="Caur_0184"
                     /note="oxidoreductase alpha (molybdopterin) subunit;
                     Region: Fdhalpha-like; TIGR01701"
                     /db_xref="CDD:233538"
     misc_feature    complement(232529..234232)
                     /locus_tag="Caur_0184"
                     /note="The MopB_ydeP CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative molybdopterin
                     cofactor binding site. These members belong to the
                     molybdopterin_binding (MopB) superfamily of proteins;
                     Region: MopB_ydeP; cd02767"
                     /db_xref="CDD:239168"
     misc_feature    complement(order(232835..232837,232850..232855,
                     232901..232903,232910..232918,232988..232996,
                     233189..233194,233297..233308,233525..233527,
                     233633..233641,233702..233707,233714..233716,
                     233720..233725,233819..233827,233831..233833,
                     234098..234100))
                     /locus_tag="Caur_0184"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239168"
     misc_feature    complement(232187..232489)
                     /locus_tag="Caur_0184"
                     /note="The MopB_CT_ydeP CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative molybdopterin
                     cofactor binding site. This CD is of the conserved
                     molybdopterin_binding C-terminal (MopB_CT) region...;
                     Region: MopB_CT_ydeP; cd02787"
                     /db_xref="CDD:239188"
     misc_feature    complement(order(232196..232201,232250..232252,
                     232262..232264,232448..232459,232463..232477))
                     /locus_tag="Caur_0184"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239188"
     gene            234848..235422
                     /locus_tag="Caur_0185"
                     /pseudo
                     /db_xref="GeneID:5824888"
     gene            complement(235459..235869)
                     /locus_tag="Caur_0186"
                     /db_xref="GeneID:5824889"
     CDS             complement(235459..235869)
                     /locus_tag="Caur_0186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633828.1"
                     /db_xref="GI:163845784"
                     /db_xref="GeneID:5824889"
                     /translation="MRVVIREVLNVGGFFAGETVTLAVQPWPDHGPEQTITIDDAAFV
                     NITARHLLAPGMVLDLLFAGDRVEQATLLGAADHAGLRTALRPQPISPTPVPRVLSFH
                     CPHCNLWVPASGDPSGCGICGTPAPTLSLAVQST"
     gene            complement(235921..237333)
                     /locus_tag="Caur_0187"
                     /db_xref="GeneID:5824890"
     CDS             complement(235921..237333)
                     /locus_tag="Caur_0187"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: rrs:RoseRS_0683 glycosyl transferase, group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_001633829.1"
                     /db_xref="GI:163845785"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:5824890"
                     /translation="MLRIAYCSPVNPAPSGISDYSEELLPYLAQYAALTLFVEDGLRP
                     TNPHLAKHFPIKPIRQLERMARRGQFDAIIYHMGNSPAHAGIWRMAQRVPGVIVLHDF
                     VLHHFMLWYAANVQRDVQRYVAMMRARYGADGDHMAQLMIRSRFSEAAFAFPCNEDVL
                     AAAKAVIGHSHYLLRRVTATRPDLLCGYVPMGVPLPPLIDRIAARQRLGLPLDQPLLA
                     SFGHINAWKRIEPTLRAVAGLRREGIDVHCLLVGSVSPNYDLKGVIQRLGLQEAVTVT
                     GYVARAQFEDYVAATDVCLNLRYPTAGETSASLLRLLGAGKPTLVSAVDAFCELPPDV
                     AAQVDVDESETDLIIAYCRRLLTDPALAAALGARARAYVATEHTLAGAAQAMIEFLAK
                     VYGWAPPQRIRPDPLWDPTPVVEAETTPSPPSPQPAAPASLLLQTAAQAMAEIGLTED
                     DTGALQSVATKIAELQGKHP"
     misc_feature    complement(236146..237327)
                     /locus_tag="Caur_0187"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(236164..237327)
                     /locus_tag="Caur_0187"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(237333..237857)
                     /locus_tag="Caur_0188"
                     /db_xref="GeneID:5824929"
     CDS             complement(237333..237857)
                     /locus_tag="Caur_0188"
                     /note="PFAM: ThiJ/PfpI domain protein;
                     KEGG: rrs:RoseRS_2580 ThiJ/PfpI domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiJ/PfpI domain-containing protein"
                     /protein_id="YP_001633830.1"
                     /db_xref="GI:163845786"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="GeneID:5824929"
                     /translation="MRLAGKQIAILLAEGVEDLEFYVPLMRLQEEGAEVLAAGLDLRP
                     VRGKNGLEITPTTTIAELRADDLFGLVLPGGWAPDKLRRYQVVTDLVRAMDAAGKVIG
                     IICHGGSIAISAGIVRGRPATGSTGIKDDLINAGALWVDEAAFRDGHLVWGRVVADIP
                     VFCRELVAALVERA"
     misc_feature    complement(237351..237839)
                     /locus_tag="Caur_0188"
                     /note="A type 1 glutamine amidotransferase (GATase1)-like
                     domain found in PfpI from Pyrococcus furiosus; Region:
                     GATase1_PfpI_like; cd03134"
                     /db_xref="CDD:153228"
     misc_feature    complement(237348..237836)
                     /locus_tag="Caur_0188"
                     /note="intracellular protease, PfpI family; Region: PfpI;
                     TIGR01382"
                     /db_xref="CDD:233389"
     misc_feature    complement(237540..237545)
                     /locus_tag="Caur_0188"
                     /note="proposed catalytic triad [active]"
                     /db_xref="CDD:153228"
     misc_feature    complement(237543..237545)
                     /locus_tag="Caur_0188"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153228"
     gene            complement(237972..238892)
                     /locus_tag="Caur_0189"
                     /db_xref="GeneID:5824930"
     CDS             complement(237972..238892)
                     /locus_tag="Caur_0189"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein;
                     KEGG: dar:Daro_3508 PAS:GGDEF"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_001633831.1"
                     /db_xref="GI:163845787"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="GeneID:5824930"
                     /translation="MASAVSFLPIITTDNALITQLSARLGSGWQIVPASTVTPGQPNL
                     IDLREQIPEGLAAYAEQVPLVGVVVDTAGAAHVLQIGVHEVLTVAELQPLCLTRAITS
                     ATIRWQIDQTRRQHLAEARAQVQALTVRLQNEQIRDPLTGLYTRRYLNETLDRELRRA
                     DREQIVLSVALIDIDQLEQVNWQFGRALGDAVLQHLAGLIGRQVRGGDIFCRYGSDEL
                     LLVLPRVMPETAFQRAEQWRLSVAESIIRPGTLDLQVTISIGLASFPRDARNAVELMS
                     RVGEALYAAKAAGGNCVRQWPGADRLLSQA"
     misc_feature    complement(238011..238484)
                     /locus_tag="Caur_0189"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(238245..238247,238374..238376))
                     /locus_tag="Caur_0189"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(238242..238253,238257..238259,
                     238323..238325,238335..238337,238347..238352,
                     238359..238361))
                     /locus_tag="Caur_0189"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(238185..238187,238269..238271))
                     /locus_tag="Caur_0189"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(239302..240213)
                     /locus_tag="Caur_0190"
                     /db_xref="GeneID:5824931"
     CDS             complement(239302..240213)
                     /locus_tag="Caur_0190"
                     /note="KEGG: rrs:RoseRS_1536 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633832.1"
                     /db_xref="GI:163845788"
                     /db_xref="GeneID:5824931"
                     /translation="MDRLKRFRVAFVIGIIVLLVGGAVVLFGQPGAMMSEQTSFVAMP
                     TPAPMLSGAPVPAQRDTASFAGGVSSGESAIGSEVAVQRLIIKNASIALEVADVLAAE
                     QALRQKAEALGGFVASVETYGSGEDLRATIVLRVPVEHFEAVLRDAEGLASNVLRRSV
                     SGSDVTEEYVDLEARLRNLEATNARLLDLLSRAQNVNDALMVNQALTEIQEQIERIKG
                     RMQYLEQSAAMSTITVELLPVPPPTPIIEEDAWQPLEVARIALRNLIQLGQTLANAVI
                     VFLVWTPVWLPLVLIAVWARRRLSQRT"
     sig_peptide     complement(240127..240213)
                     /locus_tag="Caur_0190"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.979) with cleavage site probability 0.929 at
                     residue 29"
     misc_feature    complement(239323..240081)
                     /locus_tag="Caur_0190"
                     /note="Domain of unknown function (DUF4349); Region:
                     DUF4349; pfam14257"
                     /db_xref="CDD:258443"
     gene            complement(240860..241345)
                     /locus_tag="Caur_0191"
                     /db_xref="GeneID:5824932"
     CDS             complement(240860..241345)
                     /locus_tag="Caur_0191"
                     /note="KEGG: cya:CYA_0515 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633833.1"
                     /db_xref="GI:163845789"
                     /db_xref="GeneID:5824932"
                     /translation="MTTPCECSPTESATCGLNTPRRQTVSCPVCGASGKRVGLQTVKA
                     LVSISLRQVQGSSFWFCRSQHCPVVYFAADNGQTLTVDQIRERVYQKEPERPDVLVCY
                     CFQYRVGDIQQASPEARAAVIADIKAGIAADQCACDVRNPQGSCCLGNVQQVAKQVKL
                     T"
     gene            241621..243909
                     /locus_tag="Caur_0192"
                     /db_xref="GeneID:5824933"
     CDS             241621..243909
                     /locus_tag="Caur_0192"
                     /EC_number="2.7.13.3"
                     /note="KEGG: gme:Gmet_2788 histidine kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; PAS fold-4 domain protein; PAS
                     fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS sensor protein"
                     /protein_id="YP_001633834.1"
                     /db_xref="GI:163845790"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5824933"
                     /translation="MAALPFVMIYLIPAIIATGLAIVMWQRRYYRGGRPFTLLLAAIA
                     WWNLCHALSIADTTFEGTLFWSLLQNVGIVLIGPCWLLIALAYSGEWWRVDRRIRRGI
                     FIPELIALIFALTNNLHYLWWSTVVADTSRPFLWLSVTRGPAFWFHSIYAYVCLAIGI
                     IILFRASAHAPPVHRYHSRLMLAAALIPAVGNIAFLSGLKVPWNDDPTPILLLISAAL
                     AMYTTMRYQLYDLAPLAEQEVIAGLPDGLIVLDSRGLVAEINQHAPRLLGIQQGRWIG
                     RSLTSLIVNSPFERDLQRLLNTPVTGPSRPVICENGTQAIEVRLRPLQSAAGITTGSL
                     LLIRDVSERMRAEQERARHIAALRLINSIARSANTAQETSTLLKTIAHIIVQEGHWER
                     VSIGLIDNAQNIHVTIDYTTAGYGRLHDQVISGVAASALIERIQHGRPELINLSELTV
                     TDPLAETMQQEGLQSLLLAPLRHDQHAAGILGLASSETKSMTPTLTELVIAIGELITD
                     ALIRIRLYEEVQRADRLKTGFLATVSHELRTPLTTIIGYTDMLRRGVLGELSPEVQET
                     LHYMRQASLNLMRLISDILEFSRMEAGQLIIDIEPVPVSVIVQNVVGQMQPQIREHQL
                     HLMVNIPPDLPMIQANAGRLEQVLINLLSNAIKFNRPQGLIEIKAETRGEWVRISVRD
                     TGIGIAPADQERIFEEFERVKQKNGHSVSGVGLGLAICRRLIQHMGGKIGVKSTPGEG
                     STFFCDLPVVPVSRTVGAEADV"
     misc_feature    241624..>242370
                     /locus_tag="Caur_0192"
                     /note="4-amino-4-deoxy-L-arabinose transferase and related
                     glycosyltransferases of PMT family [Cell envelope
                     biogenesis, outer membrane]; Region: ArnT; COG1807"
                     /db_xref="CDD:224720"
     misc_feature    242347..242649
                     /locus_tag="Caur_0192"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    242347..242640
                     /locus_tag="Caur_0192"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(242395..242397,242407..242409,242425..242427,
                     242464..242475,242551..242553)
                     /locus_tag="Caur_0192"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(242455..242457,242467..242469,242491..242493,
                     242500..242505,242572..242574,242578..242580)
                     /locus_tag="Caur_0192"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    242689..243186
                     /locus_tag="Caur_0192"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    242920..243882
                     /locus_tag="Caur_0192"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    243187..243387
                     /locus_tag="Caur_0192"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(243205..243207,243217..243219,243229..243231,
                     243238..243240,243250..243252,243259..243261,
                     243316..243318,243328..243330,243337..243339,
                     243349..243351,243358..243360,243370..243372)
                     /locus_tag="Caur_0192"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    243223..243225
                     /locus_tag="Caur_0192"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    243550..243849
                     /locus_tag="Caur_0192"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(243568..243570,243580..243582,243589..243591,
                     243658..243660,243664..243666,243670..243672,
                     243676..243681,243760..243771,243817..243819,
                     243823..243825,243838..243843,243847..243849)
                     /locus_tag="Caur_0192"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    243580..243582
                     /locus_tag="Caur_0192"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(243670..243672,243676..243678,243760..243762,
                     243766..243768)
                     /locus_tag="Caur_0192"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(243930..244271)
                     /locus_tag="Caur_R0002"
                     /db_xref="GeneID:5824934"
     ncRNA           complement(243930..244271)
                     /locus_tag="Caur_R0002"
                     /ncRNA_class="RNase_P_RNA"
                     /product="RNA component of RNaseP"
                     /note="Bacterial RNase P class A as predicted by Rfam
                     (RF00010), score 52.89"
                     /db_xref="GeneID:5824934"
     gene            complement(244924..246468)
                     /locus_tag="Caur_0193"
                     /db_xref="GeneID:5824935"
     CDS             complement(244924..246468)
                     /locus_tag="Caur_0193"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-diphosphate and nicotinate from nicotinate
                     D-ribonucleotide and diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="YP_001633835.1"
                     /db_xref="GI:163845791"
                     /db_xref="InterPro:IPR006405"
                     /db_xref="InterPro:IPR015977"
                     /db_xref="GeneID:5824935"
                     /translation="MNNVQQRTATGILFTDQYQLTMAQLYFRMGIHERMAQFDHFFRQ
                     PPNYGLHAAGYCIAAGLEWLLDWMETACFGPAELEVLRNQRNRVGNPIFAEDFLTYLS
                     RHGHFGGMTLWAVPEGRVVHAQAPMTIVRGPLLMAQILETALLNHLNYQTLVATKASR
                     IREASGASTVLEFGLRRGQGMGANAGTRAALIGGADFTSNVGLAHTVGQTAKGTHAHA
                     MVQAFLALGMSELDAFRAYAEVYPDDCLLLVDTIDTLNSGLPNAIRVFEELRAKGHKP
                     VGVRLDSGDLAYLAIQTALMLDRSGFPDTVIVLSNDLDELVIWQIQSQIVQEAPRYNA
                     DANAIIRRLVYGVGTRLVTSHGEGALGGVYKLVALHDGREWQPAIKIAESAAKLTNPG
                     LKRVWRLYDSRGKATADLIALEDEDPTQEELIRLRHPSDHARQRVVVRAELTGIEPLL
                     EPAMLAGRRLIEPQPIEQMRARRYADVERLDLGVRRIMNPHIYHVSLSQRLWDMKQEL
                     LNRFQM"
     misc_feature    complement(244966..246432)
                     /locus_tag="Caur_0193"
                     /note="nicotinate phosphoribosyltransferase; Validated;
                     Region: PRK09243"
                     /db_xref="CDD:236426"
     misc_feature    complement(245368..246432)
                     /locus_tag="Caur_0193"
                     /note="Nicotinate phosphoribosyltransferase (NAPRTase),
                     subgroup A. Nicotinate phosphoribosyltransferase catalyses
                     the formation of NAMN and PPi from 5-phosphoribosy
                     -1-pyrophosphate (PRPP) and nicotinic acid, this is the
                     first, and also rate limiting, reaction...; Region:
                     NAPRTase_A; cd01570"
                     /db_xref="CDD:238804"
     misc_feature    complement(order(245413..245415,245422..245427,
                     245431..245433,245536..245541,245623..245625,
                     245872..245877,245938..245946))
                     /locus_tag="Caur_0193"
                     /note="active site"
                     /db_xref="CDD:238804"
     gene            complement(247214..248317)
                     /locus_tag="Caur_0194"
                     /db_xref="GeneID:5824936"
     CDS             complement(247214..248317)
                     /locus_tag="Caur_0194"
                     /note="PFAM: ABC-3 protein;
                     KEGG: rca:Rcas_1721 transcriptional regulator, MarR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-3 protein"
                     /protein_id="YP_001633836.1"
                     /db_xref="GI:163845792"
                     /db_xref="InterPro:IPR001626"
                     /db_xref="GeneID:5824936"
                     /translation="MSPQLEVQLIAVIIAAACTLPGVFLVLRRMAMLSDAISHTVLLG
                     IVLAYLISGNLSSPLLFAGAVAMGVLTVWLVELMSGSRLMHEDAAIGLVFPALFSLAV
                     LLISRFAGNVHLDTDSVLLGELAFAPFDRIELFGLSLPRALVVGSGTLMLNLILLVLF
                     YKELKLATFDPALATTLGFAPALIHYGLMTSVSLTAVTAFDAVGSILVIALMVAPPAT
                     AYLLTDRLPRMILLSVAIGIASALSGYWLARWFDVSIAGTMATMTGIAFLLAFLFAPR
                     RGIVAQRRQQQINRERFALQMLTLHLLNHEGTRDANVECHPRHLIEELHWPAAFAGAI
                     VRQAEQHGLVQRRGDMLVLTEQGRLFAAEASVR"
     misc_feature    complement(247502..248293)
                     /locus_tag="Caur_0194"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(247640..247642,247661..247663,
                     247787..247795,247799..247816,247820..247825,
                     247829..247837,247841..247846,248234..248242,
                     248252..248254))
                     /locus_tag="Caur_0194"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(247502..247504,247511..247516,
                     247523..247525,247532..247537,247544..247546,
                     247694..247696,247955..247957,247964..247969,
                     248000..248002,248006..248011,248018..248020,
                     248027..248032,248039..248044,248051..248056,
                     248060..248062,248216..248218,248231..248233,
                     248237..248239))
                     /locus_tag="Caur_0194"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(247553..247555,247571..247573,
                     247706..247708,247718..247720,247928..247930,
                     248000..248002))
                     /locus_tag="Caur_0194"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(248330..249205)
                     /locus_tag="Caur_0195"
                     /db_xref="GeneID:5824937"
     CDS             complement(248330..249205)
                     /locus_tag="Caur_0195"
                     /note="PFAM: transport system permease protein; ABC-3
                     protein;
                     KEGG: rca:Rcas_1722 ABC-3 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-3 protein"
                     /protein_id="YP_001633837.1"
                     /db_xref="GI:163845793"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="InterPro:IPR001626"
                     /db_xref="GeneID:5824937"
                     /translation="MELFTDYTFRNVTLGAMLIGAISGFLGSFAVLRRQALLGDAMSH
                     AALPGIALAFLITGQRDPFSLLIGAAVAALVAALWLLAVVRTTRIKDDAALALTLAVF
                     FGFGLVLLSYLQRQPHAAQAGLKSFLFGQAAALIERDLWAMLAIGLPALALVLIFWPQ
                     VKLISFDPDFARSLGVPVRRFEVLLTGIIVVAIVIGLQTVGVVLMSAMLIAPAVAARQ
                     WTNRLEYMVVLAAGFGALASLIGAWISTLGEGLATGPLIVLVMSLFTMISLLLAPERG
                     LIWRHIRRQRVIAFD"
     misc_feature    complement(248399..249166)
                     /locus_tag="Caur_0195"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(248537..248539,248558..248560,
                     248684..248692,248696..248713,248717..248722,
                     248726..248734,248738..248743,249107..249115,
                     249125..249127))
                     /locus_tag="Caur_0195"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(248399..248401,248408..248413,
                     248420..248422,248429..248434,248441..248443,
                     248591..248593,248819..248821,248828..248833,
                     248873..248875,248879..248884,248891..248893,
                     248900..248905,248912..248917,248924..248929,
                     248933..248935,249089..249091,249104..249106,
                     249110..249112))
                     /locus_tag="Caur_0195"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(248450..248452,248468..248470,
                     248603..248605,248615..248617,248789..248791,
                     248873..248875))
                     /locus_tag="Caur_0195"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(249226..250002)
                     /locus_tag="Caur_0196"
                     /db_xref="GeneID:5824938"
     CDS             complement(249226..250002)
                     /locus_tag="Caur_0196"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: rrs:RoseRS_3069 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001633838.1"
                     /db_xref="GI:163845794"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5824938"
                     /translation="MEVAVDIKDLTVAYGDKPVLWDVDLQVPRGVLMAIVGPNGAGKT
                     TLLKAMLGLVRPAAGSVRVFGRPYHQQRHLIAYVPQRSSVDWDFPTTVLDVVLMGRYG
                     HLGWFRRPGRAERDAALAALAQVQMADFAHRQIGQLSGGQQQRVFLARALAQAAEIYV
                     MDEPFQGVDAVTERAIINVLRDLRAAGKTVVVVHHDLQTVTEYFDHVALINVRRIAAG
                     PVAEVFTEANLRATYGGRLALLHTPTDTAPAARPTPAPGD"
     misc_feature    complement(249283..250002)
                     /locus_tag="Caur_0196"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    complement(249349..249984)
                     /locus_tag="Caur_0196"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            complement(250016..250933)
                     /locus_tag="Caur_0197"
                     /db_xref="GeneID:5824939"
     CDS             complement(250016..250933)
                     /locus_tag="Caur_0197"
                     /note="PFAM: periplasmic solute binding protein;
                     KEGG: rrs:RoseRS_3070 periplasmic solute binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic solute binding protein"
                     /protein_id="YP_001633839.1"
                     /db_xref="GI:163845795"
                     /db_xref="InterPro:IPR006127"
                     /db_xref="InterPro:IPR006128"
                     /db_xref="InterPro:IPR006129"
                     /db_xref="GeneID:5824939"
                     /translation="MILRCSLITILLLILTGCTAPVTDGRLRVVATTGPIGDAVQAIA
                     GDRVTLHTLLGPGIDPHTYIATESDLFALQEARLILYNGLHLEANLERVFQAIKRSGT
                     IPVVAVAEAVPVEMRLRWEDDEKAYDPHVWHDPQRWRYAVIAIRDALIDLDPDGREVY
                     QQRSEQYLNDLQALDADLRALAEQVPPERRILVTAHDAFNYFGQAYGFRVEAVQGIST
                     ASEASAATIRDLTTLVVTERIPAIFVETSVSPRTIEAVQSAARAAGHEVRVGGELYSD
                     SLGDANGPAGTYFGMMRHNMQTIVAALMP"
     sig_peptide     complement(250862..250933)
                     /locus_tag="Caur_0197"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.874) with cleavage site probability 0.436 at
                     residue 24"
     misc_feature    complement(250025..250879)
                     /locus_tag="Caur_0197"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    complement(250025..250858)
                     /locus_tag="Caur_0197"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    complement(order(250493..250495,250649..250651,
                     250658..250663))
                     /locus_tag="Caur_0197"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            complement(251566..252552)
                     /locus_tag="Caur_0198"
                     /db_xref="GeneID:5824940"
     CDS             complement(251566..252552)
                     /locus_tag="Caur_0198"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: bce:BC2064 ribosomal-protein-alanine
                     acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_001633840.1"
                     /db_xref="GI:163845796"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:5824940"
                     /translation="MHSHGQGWTVGHVGANSRCGVTHTLSPNLTLQYDRCLAGDTAAE
                     RIINNHMTLDIAIIPAADWPALVELFARCNRADNIELPVYLDGDWTPTMAAARIGETL
                     VGGVVMYGYFAIEAVIAVDPAWRRRGFGRQLIEQIERWAYARGGNWIALADEAGSCVA
                     PFVAALDLHRLNVEVELQLDPAQLPPLPEAPDDWQVRLAEKDDVATLTSIIVSAFGDP
                     VEQVSAFVSDRITHPRHRFVIAEMAGHPVAALRLLRAEQTIIITTFGVCRDLQGRGYG
                     KLLLLTTLHRLQAAGYQDIRIEVEEQNTAAYHLYRSSGFVPRRRLGQYGRPR"
     misc_feature    complement(252100..252276)
                     /locus_tag="Caur_0198"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(252160..252165,252193..252201))
                     /locus_tag="Caur_0198"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    complement(251605..251823)
                     /locus_tag="Caur_0198"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     misc_feature    complement(251581..>251772)
                     /locus_tag="Caur_0198"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     gene            complement(252795..253025)
                     /locus_tag="Caur_0199"
                     /db_xref="GeneID:5824941"
     CDS             complement(252795..253025)
                     /locus_tag="Caur_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633841.1"
                     /db_xref="GI:163845797"
                     /db_xref="GeneID:5824941"
                     /translation="MRNGTFEQLTVEEVLQTFGPEARAFLRENRIDRSNLRFADACAA
                     ASVTPDEFFAQLDAGMRRRAARAARHSVAEYA"
     gene            complement(254264..255088)
                     /locus_tag="Caur_0200"
                     /db_xref="GeneID:5824973"
     CDS             complement(254264..255088)
                     /locus_tag="Caur_0200"
                     /note="KEGG: rca:Rcas_4132 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633842.1"
                     /db_xref="GI:163845798"
                     /db_xref="GeneID:5824973"
                     /translation="MIGRNRVQVVTEAITLQYANGKSMARPIGGKRFTPYIGFHIEVG
                     RDDELDARLGIAGIPQIEIKHQRQGGAEIVRHWALGETILFYPVTSGPVAQTVAGSLG
                     RNAAATAAAGIGLRWGINDRSRMAVRGYLDLLVRVEMARLVQLSVRSRMSDVLLNVLL
                     DHGRVCEAADHLIDRSSHPDLVTFHELALPLGPGEEEEWGKGETTTVVPFKSLHPAQI
                     DRDYIQRIWRPESVHQAALRDWAGIQAWASEYALQNDERVTGERNDVVETSHEIGR"
     gene            complement(255295..259257)
                     /locus_tag="Caur_0201"
                     /db_xref="GeneID:5824974"
     CDS             complement(255295..259257)
                     /locus_tag="Caur_0201"
                     /note="TIGRFAM: autotransporter-associated beta strand
                     repeat protein;
                     PFAM: Ig domain protein group 1 domain protein; Ig family
                     protein;
                     KEGG: spu:761405 hypothetical protein LOC761405"
                     /codon_start=1
                     /transl_table=11
                     /product="beta strand repeat-containing protein"
                     /protein_id="YP_001633843.1"
                     /db_xref="GI:163845799"
                     /db_xref="InterPro:IPR003344"
                     /db_xref="InterPro:IPR008009"
                     /db_xref="InterPro:IPR013425"
                     /db_xref="GeneID:5824974"
                     /translation="MQFWRGAMNRPIPRALLSTLAVILLLIWSLVFSPVFAATSTWIG
                     GNGSWSDPTKWSGGVPSSRHDVAVFPYTPFPLAIDLDGTFEIGEVRFDSPMPYLLMTN
                     SNGSLYFPPAGAGAIRVLSGNHVIYVPIELQKIISFDIAADSSLLIFSPNNLLRGSGG
                     ITKTGEGELYLLAANEHRGRTTINGGAIVIAHNQAFGTSKLELLSGRLINAGSDRIIT
                     NEISQLNNNFTLDSGDYRLSFSTPWSLPGNREITVEGDVIFAKITDPAASRNLRKNGA
                     GDLTINLTASGSNIGSFVRNQGSGRLNLYGSGTVGAIVYNPTSGGGEIGVGDQRDLNT
                     GAVIRGRGTLSIAGNGDGVRLHSPNISLHFEIGPGGDKLVLINTSNNSTRNASIELVG
                     TGNPAGATLSLALVPGYTPVAGDIWTILEHASAGSGGILGTFQGLPNGAVIDVDGYPF
                     QIVYTSKTVSLVALPPLVVEQRGGNNQSAVVDTDFAQPLEVWVGDENGNPLSGVYVSF
                     TAPASGASAVFPAGNGAVSDANGLVQVPVRANNVAGTYTVTASVANASTDFTLTNIAA
                     APSPTPSPSATASATPEPTASVTPEPTASVTPEPTASATPEPTASVTPEPTASATPEP
                     TASVTPEPTASATPEPTASVTPEPTASTTPSPSATASVTPSPSATASVTPSPSATASA
                     TPEPTASTTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASATPEPTASTTPSP
                     SATASVTPSPSATASTTPSPSATASVTPSPSATASMTPSPSATASATPEPTASTTPSP
                     SATASVTPSPSATASTTPSPSATASTTPSPSATASATPSPSATASVTPEPTASTTPSP
                     SATASATPEPTASVTPSPSATASVTPSPSATASVTPSPSATASTTPSPSVTASTTPSP
                     SATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASATP
                     EPTASVTPSPSATASTTPSPSATASVTPSPSATASVTPSPSATASTTPEPTASTTPSP
                     SATASTTPSPSATASTTPSPSATASTTPEPTASVTPSPSATASVTPSPSATASTTPEP
                     TASTTPSPSATASATPEPTASTSPVSTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVP
                     TVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTV
                     TTSPVPTETPSPVPTPGEAPHLELSLPPSIAVGSLVQTQLNASGGSGSYVYQSTGQLP
                     SGLVLLADGRLEGQVTQVGTYTFTIIVTDSNGQTASYTYEIVVEPMRIFVPVIMRAAP
                     "
     sig_peptide     complement(259144..259257)
                     /locus_tag="Caur_0201"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 38"
     misc_feature    complement(258688..258780)
                     /locus_tag="Caur_0201"
                     /note="autotransporter-associated beta strand repeat;
                     Region: autotrns_rpt; TIGR02601"
                     /db_xref="CDD:213728"
     misc_feature    complement(257578..257835)
                     /locus_tag="Caur_0201"
                     /note="Bacterial Ig-like domain (group 1); Region: Big_1;
                     cl17740"
                     /db_xref="CDD:266802"
     misc_feature    complement(257119..257556)
                     /locus_tag="Caur_0201"
                     /note="Cornifin (SPRR) family; Region: Cornifin;
                     pfam02389"
                     /db_xref="CDD:145501"
     misc_feature    complement(<257086..>257514)
                     /locus_tag="Caur_0201"
                     /note="envelope glycoprotein I; Provisional; Region:
                     PHA03292"
                     /db_xref="CDD:177577"
     misc_feature    complement(<256804..>257208)
                     /locus_tag="Caur_0201"
                     /note="envelope glycoprotein I; Provisional; Region:
                     PHA03292"
                     /db_xref="CDD:177577"
     misc_feature    complement(<256252..>256641)
                     /locus_tag="Caur_0201"
                     /note="RAM signalling pathway protein; Region: SOG2;
                     pfam10428"
                     /db_xref="CDD:255982"
     misc_feature    complement(<255994..>256410)
                     /locus_tag="Caur_0201"
                     /note="envelope glycoprotein I; Provisional; Region:
                     PHA03292"
                     /db_xref="CDD:177577"
     gene            259575..260486
                     /locus_tag="Caur_0202"
                     /db_xref="GeneID:5824975"
     CDS             259575..260486
                     /locus_tag="Caur_0202"
                     /note="TIGRFAM: RarD protein, DMT superfamily transporter;
                     PFAM: protein of unknown function DUF6 transmembrane;
                     KEGG: mms:mma_3532 transporter of the DMT superfamily,
                     chloramphenicol-sensitivity protein (RarD family)"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter DMT superfamily protein"
                     /protein_id="YP_001633844.1"
                     /db_xref="GI:163845800"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004626"
                     /db_xref="GeneID:5824975"
                     /translation="MTNKTTLQGISAAIAAYALWGLLPVYWKALNGASATEILAHRMI
                     WSLLFLLGVLAIRRQWEWITVIRQQRRLRLTYLASAILLAANWGIYVWAVQINRVVEA
                     SLGYFINPLVSIALGVLVLRERLRPAQWLAIGIAAAGVAWLTYSAGALPWIALALALS
                     FGLYGLLRKQTPLGSFEALTVETLWMFPPALLWLSWLAGANGGIHHDTGLWMLLISTG
                     VVTAAPLLFFGAATRRIPLTTIGILQYLAPTLQLVLGVLVYGEPFSTAQLIGFGAIWT
                     ALAIYTLDSFIAVRHYRAKLSQEAIQR"
     misc_feature    259581..260429
                     /locus_tag="Caur_0202"
                     /note="Predicted permeases [General function prediction
                     only]; Region: RarD; COG2962"
                     /db_xref="CDD:225510"
     gene            complement(260447..261064)
                     /locus_tag="Caur_0203"
                     /db_xref="GeneID:5824976"
     CDS             complement(260447..261064)
                     /locus_tag="Caur_0203"
                     /note="PFAM: protein of unknown function DUF121;
                     KEGG: rxy:Rxyl_0959 protein of unknown function DUF121"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633845.1"
                     /db_xref="GI:163845801"
                     /db_xref="InterPro:IPR002835"
                     /db_xref="GeneID:5824976"
                     /translation="MIGIVIPIKRLHLAKSRLIDLLDPADRQQLVVTMVRHVITTARQ
                     AVSYLSIPARIWLVSPEPTLATDSEGIEWLPDNQEELNAALTEARQRIQAAGVQIMMV
                     LAGDLPFVTVRDLILLSEALTDNDVVVAPDQHGQGTNALGLHLPSQLPFGFGPDSAGY
                     HLRTAARLGLRASLISTPTLAFDLDDGERLQQYYRCIASCDNFAR"
     misc_feature    complement(260459..261058)
                     /locus_tag="Caur_0203"
                     /note="2-phospho-L-lactate guanylyltransferase; Region:
                     F420_cofC; TIGR03552"
                     /db_xref="CDD:234254"
     gene            complement(261061..262017)
                     /locus_tag="Caur_0204"
                     /db_xref="GeneID:5824977"
     CDS             complement(261061..262017)
                     /locus_tag="Caur_0204"
                     /note="catalyzes the formation of the L-lactyl
                     phosphodiester of
                     7,8-didemethyl-8-hydroxy-5-deazariboflavin (F420-0) and
                     GMP from actyl (2) diphospho-(5')guanosine (LPPG) to
                     7,8-didemethyl-8-hydroxy-5-deazariboflavin (FO)"
                     /codon_start=1
                     /transl_table=11
                     /product="LPPG:FO 2-phospho-L-lactate transferase"
                     /protein_id="YP_001633846.1"
                     /db_xref="GI:163845802"
                     /db_xref="InterPro:IPR002882"
                     /db_xref="InterPro:IPR010115"
                     /db_xref="GeneID:5824977"
                     /translation="MIVVLSGGVGAARFIEGLAAVVAPERIAAVVNTGDDMVLHGLYI
                     SPDLDIVTCTLADVIDRNQGWGIAGDTDACMQWLARLGAPTWFKLGDRDLALHIYRTA
                     RLQAGATLSQVADEIRQALGVAVSIIPMSDDPAPTHVLTDQGELHFEEYFVRERCQPV
                     VHGVRLHAAGPVRPAPALLPLLMSAEVIIIAPSNPVVSVGPILAIPEVRTTLTTTNTP
                     VVAVSPIVGGAAIKGPAVPLMKAVGLTPTALGVAETYADLIDGIVIDTIDAELAPAIQ
                     SRGIATLVTDTIMRGMPEKMALARATLELASLIAPSTARSLV"
     misc_feature    complement(261106..262014)
                     /locus_tag="Caur_0204"
                     /note="LPPG:FO 2-phospho-L-lactate transferase; important
                     in F420 biosynthesis; Region: CofD_like; cd07186"
                     /db_xref="CDD:132872"
     misc_feature    complement(order(261319..261324,261424..261426,
                     261436..261441,261991..261999))
                     /locus_tag="Caur_0204"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:132872"
     misc_feature    complement(order(261655..261660,261703..261705,
                     261712..261714,261721..261726,261733..261738,
                     261742..261747,261784..261789,261796..261801,
                     261892..261900))
                     /locus_tag="Caur_0204"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132872"
     misc_feature    complement(order(261559..261561,261739..261741,
                     261754..261759,261823..261825,261880..261882))
                     /locus_tag="Caur_0204"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132872"
     gene            complement(262084..262935)
                     /locus_tag="Caur_0205"
                     /db_xref="GeneID:5824978"
     CDS             complement(262084..262935)
                     /locus_tag="Caur_0205"
                     /note="PFAM: Thioredoxin domain;
                     KEGG: rrs:RoseRS_1818 thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin domain-containing protein"
                     /protein_id="YP_001633847.1"
                     /db_xref="GI:163845803"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="GeneID:5824978"
                     /translation="MITGVSNKANPATAQAVVIDVTEATFEREVLQRSQQTPVVIDFW
                     APWCGPCRVLGPTLERLAREAGGTWVLAKINVDENPRLAQMFRVQGIPAVKAVYQGKI
                     VDEFTGALPESQVRTWLKRIVPDRNADLLAMAQALEATNPVEAIARYRLILGQDPNNE
                     AALFHLGRLLALRGDPEGITTLKQVPAGGPFGGRAIAGLAIADLVNAPAEPADGSEGL
                     YRQAAIAVRSGDYATAIEHLLTLVARDRAFRDDGARKALLALFALLGDDHPLVGPARR
                     RLANLLF"
     misc_feature    complement(262087..262905)
                     /locus_tag="Caur_0205"
                     /note="Thioredoxin domain-containing protein
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG3118"
                     /db_xref="CDD:225660"
     misc_feature    complement(262579..262854)
                     /locus_tag="Caur_0205"
                     /note="ybbN protein family; ybbN is a hypothetical protein
                     containing a redox-inactive TRX-like domain. Its gene has
                     been sequenced from several gammaproteobacteria and
                     actinobacteria; Region: ybbN; cd02956"
                     /db_xref="CDD:239254"
     misc_feature    complement(262405..>262557)
                     /locus_tag="Caur_0205"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(262417..262422,262429..262434,
                     262441..262446,262519..262524,262531..262536,
                     262540..262542))
                     /locus_tag="Caur_0205"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(262087..262353)
                     /locus_tag="Caur_0205"
                     /note="Tetratricopeptide repeat; Region: TPR_20;
                     pfam14561"
                     /db_xref="CDD:258699"
     gene            complement(263035..263784)
                     /locus_tag="Caur_0206"
                     /db_xref="GeneID:5824979"
     CDS             complement(263035..263784)
                     /locus_tag="Caur_0206"
                     /note="KEGG: rrs:RoseRS_4071 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633848.1"
                     /db_xref="GI:163845804"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="GeneID:5824979"
                     /translation="MMTSTTSPRVHRLLRGWWIAKHLFALIIFVTLITLGFWQLDRLA
                     QRRAANAARLAALSQPAIPLTPATDPATVIGRRVVVSGTFRNEESVVLRGRRSDSGVD
                     GVHLLTPLQIAGSDQAVLVDRGWIPSAQGAATAYAVTRPVTIEGIARAPQVRPDSPLA
                     GRDLPLPGETRINAWLRVDVPAIQQQVGAPLLPLFIEQLPDGSSALPRPPDPYRLDEG
                     PHLSYALQWFTFAGIVGVGYIFLLRQELQRR"
     misc_feature    complement(263074..263691)
                     /locus_tag="Caur_0206"
                     /note="SURF1 superfamily. Surf1/Shy1 has been implicated
                     in the posttranslational steps of the biogenesis of the
                     mitochondrially-encoded Cox1 subunit of cytochrome c
                     oxidase (complex IV). Cytochrome c oxidase (complex IV),
                     the terminal electron-transferring...; Region: SURF1;
                     cd06662"
                     /db_xref="CDD:119401"
     gene            264040..264711
                     /locus_tag="Caur_0207"
                     /db_xref="GeneID:5824980"
     CDS             264040..264711
                     /locus_tag="Caur_0207"
                     /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
                     6-phosphogluconate dehydrogenase NAD-binding;
                     KEGG: cyb:CYB_1337 K+ transporter, trk family"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA domain-containing protein"
                     /protein_id="YP_001633849.1"
                     /db_xref="GI:163845805"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="GeneID:5824980"
                     /translation="MARKPSRLEFAVIGLGRFGRSVALNLIERGHTVLGIDRDPNIVQ
                     QLADRMTQVVALDSSNEDALRAVDIMSFDTVVVAIGSQFEANLMTTVALKSLGVKRVV
                     CKALNERQQYILTRVGADMVVLPEHEAGARLAWQLSEPHVLEHLNLGSGFSVAEVRVP
                     APLVGQTLMQSGLRRRYGINVLAVKHNGKMIVTPPPDYVFSRDDRILIIGADSSISTF
                     CDLSS"
     misc_feature    264067..264693
                     /locus_tag="Caur_0207"
                     /note="K+ transport systems, NAD-binding component
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG0569"
                     /db_xref="CDD:223643"
     misc_feature    264067..264414
                     /locus_tag="Caur_0207"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    264499..264693
                     /locus_tag="Caur_0207"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            264708..266084
                     /locus_tag="Caur_0208"
                     /db_xref="GeneID:5824981"
     CDS             264708..266084
                     /locus_tag="Caur_0208"
                     /EC_number="3.6.3.14"
                     /note="PFAM: cation transporter;
                     KEGG: rrs:RoseRS_2088 H(+)-transporting two-sector ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="H(+)-transporting two-sector ATPase"
                     /protein_id="YP_001633850.1"
                     /db_xref="GI:163845806"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="GeneID:5824981"
                     /translation="MTALVTGRNLARLRRKPIPPPLRLVGGLALLIVIGTLLLLLPIS
                     STRPLTFMEALFTAASALSVTGLSVITPVQDLSLVGQILLMLLIQIGGVGFMVVAVII
                     FRLLGRRISFTDRIALSDSLGLLSPAAIVTLTRRVLITVVTIEAIGAMLLYIHWRTDP
                     RLSEGQAFFYALFHAVSAFCNAGFDLFTGTPGFENGIPRDSITLFIMGMLILTGGLGI
                     PVIADLISYANERKLSLHTRITLLVVSFLVGIGTFGLWLSEGFDADGTLHGQPLDRQL
                     IVTTFQSISARTAGFSGMDSFESLTPASQLLLIALMFIGCAPASMGGGITTGTFAVLS
                     ISLWSYARGLPTAQFAGRSLATGMVRRAAAVLTISLFVVLLASWLIVATHDATLDQVV
                     FEVVSAFATCGLTLGFTSELNTFGQLIIIAVMFWGRLGALTIITAIARQSATPQQITY
                     PEEQILIG"
     misc_feature    264789..>265049
                     /locus_tag="Caur_0208"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     misc_feature    264819..265991
                     /locus_tag="Caur_0208"
                     /note="potassium uptake protein, TrkH family; Region:
                     2a38; TIGR00933"
                     /db_xref="CDD:233196"
     misc_feature    265068..266027
                     /locus_tag="Caur_0208"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     gene            266088..267269
                     /locus_tag="Caur_0209"
                     /db_xref="GeneID:5824982"
     CDS             266088..267269
                     /locus_tag="Caur_0209"
                     /EC_number="1.3.99.22"
                     /note="KEGG: rrs:RoseRS_3875 putative oxygen-independent
                     coproporphyrinogen III oxidase;
                     TIGRFAM: oxygen-independent coproporphyrinogen III
                     oxidase;
                     PFAM: Radical SAM domain protein; HemN domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="YP_001633851.1"
                     /db_xref="GI:163845807"
                     /db_xref="InterPro:IPR004559"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /db_xref="GeneID:5824982"
                     /translation="MRHLYLHIPFCHRRCSYCDFNTYANMEHRIEAYVDALCQELAML
                     RDQLPPLPASPEAAALRPSIFFGGGTPSMLSPAQIERILQAAAEIVPLTGAEISLEAN
                     PGTVLGRDYLRDLRSLGINRLSMGVQSLHDPTLRMLGRIHTAAEAYASFNDARAVGFE
                     SINLDFIFGLPGQDIEQWRATLTEIIRWEVDHIALYSLILEENTPLYAQVTAGRLQIP
                     DDDLTGAMYELAMEMLGAAGYRHYEISNWVRPSVSDRPDAPPALACQHNLAYWLNSDY
                     LAAGAGAHGHVFPQRYANLRPIDSYITAVQSGRRPIAETTLLTSADLAAETMFMGLRL
                     DIGVGFAHFAARVGQSLLDYYGPTLEQLSQQGLIECSAQRVYLTPRGRMLGNQVFAHF
                     V"
     misc_feature    266088..267263
                     /locus_tag="Caur_0209"
                     /note="Coproporphyrinogen III oxidase and related Fe-S
                     oxidoreductases [Coenzyme metabolism]; Region: HemN;
                     COG0635"
                     /db_xref="CDD:223708"
     misc_feature    266118..266708
                     /locus_tag="Caur_0209"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(266118..266120,266124..266126,266130..266132,
                     266136..266144,266286..266288,266292..266297,
                     266385..266393,266463..266465,266586..266588,
                     266676..266681)
                     /locus_tag="Caur_0209"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    267039..267236
                     /locus_tag="Caur_0209"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            267365..268417
                     /locus_tag="Caur_0210"
                     /db_xref="GeneID:5824983"
     CDS             267365..268417
                     /locus_tag="Caur_0210"
                     /note="TIGRFAM: TIM-barrel protein, nifR3 family;
                     PFAM: dihydrouridine synthase DuS; dihydroorotate
                     dehydrogenase;
                     KEGG: rrs:RoseRS_0864 putative TIM-barrel protein, nifR3
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="NifR3 family TIM-barrel protein"
                     /protein_id="YP_001633852.1"
                     /db_xref="GI:163845808"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR004652"
                     /db_xref="GeneID:5824983"
                     /translation="MNNNITLEEIARLPTSYQVAHIRIEPNIILAPMAGVTDSIFRRM
                     ILRLGGCGLVSTEMTNAASVSPKALRRHRLLDYLPEERPLTMQISGNDPDLVANAARV
                     VEQLGADIIDINCGCPSPKVTGGGHGSALLRDLPKMERLLRAVREAVQIPVTLKFRAG
                     WDEQSLNFIEAGKRAEAAGVSALALHPRTREQGYKGQADWSRVAALKQAVSIPVIGSG
                     DVTSAHDALIRLRDSGADGVMIGRGAMANPWIFRQIADLRRGVTPYVPTPADKRNLLI
                     EYMTICAEELPERLALNKIKQLIGQFHVGLPGSNHLRVAVHTSTSLAEARDAIERFFA
                     PFLESDRVVQEMVAAD"
     misc_feature    267443..268363
                     /locus_tag="Caur_0210"
                     /note="putative TIM-barrel protein, nifR3 family; Region:
                     nifR3_yhdG; TIGR00737"
                     /db_xref="CDD:129820"
     misc_feature    267443..268138
                     /locus_tag="Caur_0210"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    order(267455..267463,267536..267538,267623..267625,
                     267704..267706,267830..267832,267920..267922,
                     268013..268015,268019..268021,268085..268090)
                     /locus_tag="Caur_0210"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(267623..267625,267713..267718,267830..267832,
                     267836..267838,267917..267922,267926..267931,
                     268016..268021,268088..268090)
                     /locus_tag="Caur_0210"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(267713..267715,267836..267838,267920..267922,
                     267926..267928)
                     /locus_tag="Caur_0210"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(267716..267718,267830..267832,267917..267919,
                     267929..267931,268016..268021)
                     /locus_tag="Caur_0210"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            269002..271686
                     /locus_tag="Caur_0211"
                     /db_xref="GeneID:5824984"
     CDS             269002..271686
                     /locus_tag="Caur_0211"
                     /note="TIGRFAM: polymorphic outer membrane protein;
                     PFAM: Polymorphic membrane protein Chlamydia;
                     KEGG: rca:Rcas_2873 polymorphic outer membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polymorphic outer membrane protein"
                     /protein_id="YP_001633853.1"
                     /db_xref="GI:163845809"
                     /db_xref="InterPro:IPR003368"
                     /db_xref="GeneID:5824984"
                     /translation="MKRFLIRFWVFLLIVTLLRVDQPMHVVQAAGFVVNSLADDTVDN
                     DLCTLREAILTSNNIPPNDDCGPGSADDDVITFSVSGTIVLNTPMVNITSGQGALTID
                     GGRNIVISGNNLAIFTVAVGADLTLSNLTVTDGNATLGGAINNLGGTVNIINSTFSNN
                     DASNLGGAIYNTGGIVTITSSTFTNNSSATLGGVIYNTGGTVTITNSTFSNNNAALLG
                     GTIYNVSGTINLYNTIVANSGSSGDCVNLGTIGAAYNNLIEDSTNACGLINGVNGNII
                     GSDPDLGPLTGAPAYFPLNTGSPAIDNGSNAYCAATDQRGVLRPQDGDGNSSVVCDIG
                     AYEVDIATRTVVNITRAGADPTNAATATFTVTFSEPVTGLDSADFSLTTTGSISGASV
                     GSVSGSGASYTVTVTTGSGDGTLRLDIPTAATITDLAGNTVGGLPFTGGESYTIDKTT
                     PTVVNITRAGADPTNATTATFTVTFSEPVTGLDSADFSLTTTGSISGASVGSVSGSGA
                     SYTVTVATGSGDGSLRLDLNPSGTGITDSAGNAISGGFTGGESYTIDKTTPTVVNITR
                     AGADPTNATTATFTVTFSEPVTGLDSADFSLTTTGSISGASVGSVSGSGASYTVTVTT
                     GSGDGSLRLDLNPSGTGITDSAGNAISGGFTGGESYTIDKTTPTVVSITRAEADPTNA
                     ATATFTVTFSEPVTGLDSTDFSLTTTGSISGASVSSVSGSGAAYTVTVTTGSGDGSLR
                     LDIPTAATITDLAGNAVGGLPFTGGESYTVDRSLLTVTINQAPAQTDPAISSPIRFIV
                     IFNKPINPTTFTASDITLGGSAPGTLTVTITEIAPNNGTTFEVVVSGMSGNGTVIASI
                     PVNVVQDLAGNGNTASTSTDNEVTYQPEIRIYLPVIMR"
     misc_feature    269095..269172
                     /locus_tag="Caur_0211"
                     /note="CSLREA domain; Region: CSLREA_Nterm; TIGR04214"
                     /db_xref="CDD:211937"
     misc_feature    269944..270870
                     /locus_tag="Caur_0211"
                     /note="Putative flagellar system-associated repeat;
                     Region: SWM_repeat; pfam13753"
                     /db_xref="CDD:258044"
     misc_feature    270604..271584
                     /locus_tag="Caur_0211"
                     /note="Putative flagellar system-associated repeat;
                     Region: SWM_repeat; pfam13753"
                     /db_xref="CDD:258044"
     gene            271968..272450
                     /locus_tag="Caur_0212"
                     /db_xref="GeneID:5824985"
     CDS             271968..272450
                     /locus_tag="Caur_0212"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633854.1"
                     /db_xref="GI:163845810"
                     /db_xref="GeneID:5824985"
                     /translation="MHDGYLFTLGICGSAEEDDPGPVMLNSLLAALPPVKRAAFLGTI
                     PSDQPDQLIAEIITDMRDAELIVIVTPATTPQLPNRLNNLLRAAYAAGVGGRFATLIA
                     VGPYAAAVLPALQAAAATCGLRIASTCAANTDDEPPLADVQAAYATARAALAPHALPH
                     "
     gene            272460..273275
                     /locus_tag="Caur_0213"
                     /db_xref="GeneID:5824986"
     CDS             272460..273275
                     /locus_tag="Caur_0213"
                     /note="PFAM: phospholipid/glycerol acyltransferase;
                     KEGG: rrs:RoseRS_2705 phospholipid/glycerol
                     acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_001633855.1"
                     /db_xref="GI:163845811"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="GeneID:5824986"
                     /translation="MQAMTTPRIPANKIWIADEAIYYLLARPALKRSFDHVWFAQYGP
                     RPDPRHGPYIFYLNHSAWWDGYMMMLIHRAIMHRAFDSYVMMEERQLRAYRFFTWCGA
                     FSIERRDPDDAQRSQLYAANLLRERRDRALYIFPQGRIEANDYRPLTVYPGIARIAAL
                     VGDVTLCPIALRYEFLGQQWPHAFVQIGPAHPPASRDDIEAIRRDVAMRLTDAVDRLR
                     TDVIEQRLGRFQPLLSGRWGIDRTWDAVRGWFRRRGGDDGPAAVAANRLRARS"
     misc_feature    272547..273104
                     /locus_tag="Caur_0213"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cd06551"
                     /db_xref="CDD:153244"
     misc_feature    order(272634..272636,272643..272645,272649..272651,
                     272715..272726,272871..272879)
                     /locus_tag="Caur_0213"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153244"
     gene            complement(273196..274053)
                     /locus_tag="Caur_0214"
                     /db_xref="GeneID:5824795"
     CDS             complement(273196..274053)
                     /locus_tag="Caur_0214"
                     /note="PFAM: protein of unknown function DUF422;
                     KEGG: rrs:RoseRS_2706 protein of unknown function DUF422"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633856.1"
                     /db_xref="GI:163845812"
                     /db_xref="InterPro:IPR007354"
                     /db_xref="GeneID:5824795"
                     /translation="MFSDQSILQNLRRAVVTLFAVYLFIYPFAIVLVALDKVPVWGTW
                     MGGALLILQGTLMGFWLTVRYRWWGAIAAGLILVVSWAVEHVGATTGFPFGSYSYTDV
                     LQPQIFGVVPLAIPFAWLLIVVAAVGVAERIGHRDGKPVNDHQLNPTRVLTAASFALL
                     LDVTIEPFAVYINRYWVWSSAEGGVYYGIPASNFIAWWVTSLILSWVLLHQRRSAARR
                     GHTPQPFMIWLPPVLYLTNLTMFVVVNLARGQVLPALIGGLIMIVLAGDWLLPRLARR
                     LRRVAETNP"
     misc_feature    complement(273274..273939)
                     /locus_tag="Caur_0214"
                     /note="Protein of unknown function (DUF422); Region:
                     DUF422; cl00991"
                     /db_xref="CDD:242236"
     gene            275167..275586
                     /locus_tag="Caur_0215"
                     /db_xref="GeneID:5824796"
     CDS             275167..275586
                     /locus_tag="Caur_0215"
                     /note="PFAM: response regulator receiver;
                     KEGG: rca:Rcas_1967 response regulator receiver protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="YP_001633857.1"
                     /db_xref="GI:163845813"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:5824796"
                     /translation="MVNTNGHPVRILLVEDDNNIGRIIELAMRSINTPYEFESVLSAE
                     EALERWEAQPFDLLISDYNLRGMNGVRLVKTLRERGYYPATLMVTAYDSAEVREAVKE
                     AAIDSYMTKPFFIDELIENIKQLLPGSKQMRERIING"
     misc_feature    275200..275544
                     /locus_tag="Caur_0215"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(275209..275214,275347..275349,275371..275373,
                     275431..275433,275488..275490,275497..275502)
                     /locus_tag="Caur_0215"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    275347..275349
                     /locus_tag="Caur_0215"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(275356..275361,275365..275373)
                     /locus_tag="Caur_0215"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    275497..275505
                     /locus_tag="Caur_0215"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(275669..276721)
                     /locus_tag="Caur_0216"
                     /db_xref="GeneID:5824797"
     CDS             complement(275669..276721)
                     /locus_tag="Caur_0216"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633858.1"
                     /db_xref="GI:163845814"
                     /db_xref="GeneID:5824797"
                     /translation="MSAWATIADLTEDRVIYRDLQPCDASLPGLPALRTLLGLPANAT
                     PRKRDTAYARVILALARAAQALRNGPPLTHVVVIGDTENDRLLTLHLQALAEVAAYGF
                     IGVDRPVAPATLDWEGVVATATRWALVHEWAATLTARGVPWAQTAVLIDIDKTLLGPR
                     GRSDGAIDDARAEAALIVATDLLGDRFDRTVFRQYYTTLCRREWHAITLDNQDYTVAM
                     ALFATVDVFDLPAIEVQLAAGLSPTLLELLIAAQQVPVELQALRRQLIEQIEAGNPTP
                     FTQFRRAELVTTAARMADGRLTLSNELFTLGRRLQAQGALLMAASDKPAESALPSPEQ
                     QTAGLLPLHRTPALLD"
     gene            complement(276718..277767)
                     /locus_tag="Caur_0217"
                     /db_xref="GeneID:5824798"
     CDS             complement(276718..277767)
                     /locus_tag="Caur_0217"
                     /EC_number="1.2.1.11"
                     /note="KEGG: mka:MK1389 aspartate-semialdehyde
                     dehydrogenase;
                     TIGRFAM: aspartate-semialdehyde dehydrogenase;
                     PFAM: Semialdehyde dehydrogenase NAD - binding;
                     Semialdehyde dehydrogenase dimerisation region"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="YP_001633859.1"
                     /db_xref="GI:163845815"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR005676"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="GeneID:5824798"
                     /translation="MATIPVAVLGATGAVGQRFIQLLEGHPLFQVVALTGSERSAGKK
                     YHEVCRWVLDTPMPAAVANLTVLDADADLPAQLVFSALPSTVAGPIEQRLAAAGHIVC
                     SNASNHRMEPDVPLIIPEVNPDHLALIPVQRRRRGWSGAIVTNPNCTSTPATMVLRPL
                     LDTFGVRRMLLVSMQALSGAGYPGVPSYDVVDNVIPYIGGEEPKLEIEPQKMLGRLEG
                     ETIVPAGFTTSAHCNRVPVLEGHLVCLSIELERKADPAEIATVLSNFRALPQELRLPT
                     APEQPIIVRHEPDRPQPRRDRDAGRGMATVVGRIRPCSLFDIKLIALSHNTIRGAAGA
                     SILNAELMHAQGWLA"
     misc_feature    complement(276724..277767)
                     /locus_tag="Caur_0217"
                     /note="aspartate-semialdehyde dehydrogenase; Reviewed;
                     Region: PRK08664"
                     /db_xref="CDD:236329"
     misc_feature    complement(277381..277752)
                     /locus_tag="Caur_0217"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    complement(276781..277299)
                     /locus_tag="Caur_0217"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            278042..278425
                     /locus_tag="Caur_0218"
                     /db_xref="GeneID:5824799"
     CDS             278042..278425
                     /locus_tag="Caur_0218"
                     /note="KEGG: rrs:RoseRS_1087 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633860.1"
                     /db_xref="GI:163845816"
                     /db_xref="GeneID:5824799"
                     /translation="MIDPLVQRLLEQVLDTPTKLHMLLMFHEHPRCELTAAAIAERLF
                     RDIWSVEQALEDLTAAGFLSVAQVTGGQPVYRYTPPPEWHEAIRRLVRSYNDPIERDM
                     IQRTIRDLSVYASFRRSELERFEFV"
     misc_feature    <278171..>278326
                     /locus_tag="Caur_0218"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     gene            complement(278675..279451)
                     /locus_tag="Caur_0219"
                     /db_xref="GeneID:5824800"
     CDS             complement(278675..279451)
                     /locus_tag="Caur_0219"
                     /note="PFAM: Rare lipoprotein A;
                     KEGG: rca:Rcas_2307 rare lipoprotein A"
                     /codon_start=1
                     /transl_table=11
                     /product="rare lipoprotein A"
                     /protein_id="YP_001633861.1"
                     /db_xref="GI:163845817"
                     /db_xref="InterPro:IPR005132"
                     /db_xref="GeneID:5824800"
                     /translation="MQWSAGRLQIALVICLTGFFWLIANPVFTQPPYRVHLPLVVRPA
                     QNPLLSGEATFYLEADGSGSCLFDPIPGDKMVAAISYLNYGNADYCGAYVEVFGPQGS
                     VVVRIVDMCPDNPGCGQNHLDLSPEAFDRIAPRAWGRVPITWRVISPPLSGPVQFHLK
                     DGSNPWWLAFQVRHHRNPIARMEYRTPQGQWVQLNRTTYNYFIRQCQCANGELGPFTL
                     RITDIYGNVLTETVQFTTLSRSSNSPGELVSGTGQFPYGP"
     sig_peptide     complement(279362..279451)
                     /locus_tag="Caur_0219"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.910) with cleavage site probability 0.910 at
                     residue 30"
     misc_feature    complement(278687..279310)
                     /locus_tag="Caur_0219"
                     /note="Endoglucanase C-terminal domain/subunit and related
                     proteins [Carbohydrate transport and metabolism]; Region:
                     COG4305"
                     /db_xref="CDD:226755"
     misc_feature    complement(279020..279226)
                     /locus_tag="Caur_0219"
                     /note="Rare lipoprotein A (RlpA)-like double-psi
                     beta-barrel; Region: DPBB_1; pfam03330"
                     /db_xref="CDD:251879"
     gene            complement(279577..281388)
                     /locus_tag="Caur_0220"
                     /db_xref="GeneID:5824801"
     CDS             complement(279577..281388)
                     /locus_tag="Caur_0220"
                     /note="TIGRFAM: oligoendopeptidase F;
                     PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
                     Oligopeptidase F;
                     KEGG: dge:Dgeo_1084 oligoendopeptidase F"
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="YP_001633862.1"
                     /db_xref="GI:163845818"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR004438"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="InterPro:IPR013647"
                     /db_xref="GeneID:5824801"
                     /translation="MQTVKERSAIPDQYKWDPYSIFPSQEAWEAAITETDAMIASAAQ
                     FRGRLQEGPQVIGEFLALSEDILRNVGQITVFATMFYTVDTNDREASAMRDRAIGLQA
                     RASAALAFGEPELLAIGGDQLLAWAERDEHLNTYYHYFERLIARAAHIRSAEVEELLG
                     QVRDPFAAASAVHGVLANAELRFPPAYDSNGEAHEITQGTINALITHPDRTLRKNAWE
                     GYADAHIAVENTMAQCLAAGVKQNVFIARARRYASALEAALKPNFIPLEVFHNLIATF
                     ERHLPIWHRYWRVRRAALGVDELHVYDTKAPLATPLVVPYEQAVDWICEGMAPLGQEY
                     VQIMRRGLREQRWVDVYPNRGKRAGAFSTGAPGTHPFIMMSYNDDIFGLSTLAHELGH
                     SMHSYYTRRTQPVIYTNYGLFLAEVASNFNQALVRDYLFKTLTDRNAQIAIIEEAMSN
                     FHRYFFIMPTLARFELAIHQRAERGQPLTATIFNDLMADLFAEGYGTEVVVDRARVGN
                     TWAQFSTHLYANFYVYQYATGIAGAHALAAPIIAGEAGAAERYINEFLKAGGSRFPLD
                     ILRRAGVDLASPEPVERTFAVMASYVDRLEQLVASAD"
     misc_feature    complement(279595..281370)
                     /locus_tag="Caur_0220"
                     /note="oligoendopeptidase F; Region: pepF; TIGR00181"
                     /db_xref="CDD:232861"
     misc_feature    complement(279604..281217)
                     /locus_tag="Caur_0220"
                     /note="Peptidase family M3B Oligopeptidase F (PepF);
                     Region: M3B_PepF_3; cd09608"
                     /db_xref="CDD:189015"
     misc_feature    complement(order(279811..279813,279823..279825,
                     279841..279843,280141..280143,280213..280215,
                     280222..280227))
                     /locus_tag="Caur_0220"
                     /note="active site"
                     /db_xref="CDD:189015"
     misc_feature    complement(order(280141..280143,280213..280215,
                     280225..280227))
                     /locus_tag="Caur_0220"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189015"
     gene            281835..282563
                     /locus_tag="Caur_0221"
                     /db_xref="GeneID:5824802"
     CDS             281835..282563
                     /locus_tag="Caur_0221"
                     /note="PFAM: Ion transport protein; Ion transport 2 domain
                     protein;
                     KEGG: vco:VC0395_1082 putative potassium channel protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ion transport 2 domain-containing protein"
                     /protein_id="YP_001633863.1"
                     /db_xref="GI:163845819"
                     /db_xref="InterPro:IPR003091"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="GeneID:5824802"
                     /translation="MSSEQRATLLHRFERISELPMLLLSFGFLIIFLLVESNVFEATI
                     TLVLDGLLWLIWGIFLAELVAKLYLAPDRLHYLRSHWFEVIIIVLPFLRPLRLLWLPI
                     VLARLWKQSQRALRRKMPAFIGVSSLVMVLITATLMFIAERGSGGPITSFADAIWWAL
                     ATITTVGYGDTYPVTALGRGIATFLMIAGIALFGLLTANVAAFFVEEDTVDRSQADLA
                     MINERLARIEQLLAEIVQREARER"
     misc_feature    282216..282437
                     /locus_tag="Caur_0221"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            complement(282569..282644)
                     /locus_tag="Caur_R0003"
                     /note="tRNA-Arg4"
                     /db_xref="GeneID:5824803"
     tRNA            complement(282569..282644)
                     /locus_tag="Caur_R0003"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:5824803"
     gene            complement(282707..283801)
                     /locus_tag="Caur_0222"
                     /db_xref="GeneID:5824804"
     CDS             complement(282707..283801)
                     /locus_tag="Caur_0222"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: rba:RB5051 conserved hypothetical protein-putative
                     thioredoxin reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_001633864.1"
                     /db_xref="GI:163845820"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:5824804"
                     /translation="MHYEELPLTAEHDVAIVGAGPIGLEVAVCLKQAGVDYIQFDAHQ
                     IGYTMTWWPRNTSFFSTTERLAIAGVPIQNNHQQRITGEEYLAYLRSVVELFDLHIQS
                     YEPVSDLIPDHEGFTLITRPHSGERRYRARRVVLAIGDMHYPHRLNIPGEDLPHVSHY
                     FRDPHDYFRRRLLIVGGKNSAVEAALRCWRAGAQVTLAYRRSQLDAQRVKHWLLPDFL
                     AQVEAGTIRFLARTTPVAIDSGGVVLAHTDEDGQPTTDHFYHPTDFVLLATGFRGDQR
                     LLEQAGVVLQGPNRVPLYNPATMETNVPGLYLAGTVAAGIQQRYTLFIENSHEHAGKI
                     TQALTGRWPSRLGDVATRNYQLSFEQIAAN"
     misc_feature    complement(282779..283765)
                     /locus_tag="Caur_0222"
                     /note="putative bacillithiol system oxidoreductase, YpdA
                     family; Region: Bthiol_YpdA; TIGR04018"
                     /db_xref="CDD:188533"
     misc_feature    complement(283199..283759)
                     /locus_tag="Caur_0222"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox_3; pfam13738"
                     /db_xref="CDD:258033"
     misc_feature    complement(283049..283291)
                     /locus_tag="Caur_0222"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            284138..284686
                     /locus_tag="Caur_0223"
                     /db_xref="GeneID:5824805"
     CDS             284138..284686
                     /locus_tag="Caur_0223"
                     /note="KEGG: rrs:RoseRS_2756 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633865.1"
                     /db_xref="GI:163845821"
                     /db_xref="GeneID:5824805"
                     /translation="MMLTTADIPQADVLWDVARVAEAIARGRMTAEEIGAYLGAKGQR
                     QGLYYMQAARIIGLIEISEQTETAQLTKFGLAFTRYNRADQRSALRRQLLRYEPTRSV
                     IAALRNAPEGLSRNDVARILQQLAPLAESTAQRRASTVTAWLTEIGLADWRDDRLYYC
                     GPSLPLPLPATPHNSASFAPGV"
     gene            complement(286667..287926)
                     /locus_tag="Caur_0224"
                     /db_xref="GeneID:5824806"
     CDS             complement(286667..287926)
                     /locus_tag="Caur_0224"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: rrs:RoseRS_2506 major facilitator superfamily MFS_1"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_001633866.1"
                     /db_xref="GI:163845822"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:5824806"
                     /translation="MTSSSEAVLARYARRNFWLNVLDGSAFTFGISLVSRFTVLPLIV
                     ERLTDARWVQGLIPAIFFAGWLLPGLFTAPLVAAQPRRKPWVLIATIGERLPFLALGI
                     ILLTMPDLPASVLLVIVLSLYAIFATSAGLTSIAWQDLIARIIPAQRWGVFFGLQAGL
                     GGLFGIGGGALAAAILAQQPFPQSAGILALICFAAMVVSYVFLALTVEPAQAPIPTRP
                     FHVFLRGLGPLLRRDVAFRRYLFCRAAIAFGLTGHSFLTAAALERFHVPAADIGLFTG
                     VMMAAQAVGNIGLGALADRWGHKQVLVLSAGMGMAALVLALLAPVSTWFFIIFALVGA
                     AQAGYQLSGFTLVFAFSPPAERTTYIGVANLALAPVAAAGPVLVGVLATFTGYGMIFV
                     LLAIVGLIGMAMLHWQVAAPVRAEQVA"
     misc_feature    complement(286802..287770)
                     /locus_tag="Caur_0224"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(<286712..287209)
                     /locus_tag="Caur_0224"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(286814..286816,286832..286837,
                     286844..286849,286883..286885,286892..286897,
                     286904..286909,286916..286921,287057..287062,
                     287066..287071,287081..287083,287090..287095,
                     287102..287104,287153..287158,287162..287170,
                     287177..287179))
                     /locus_tag="Caur_0224"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            288301..289482
                     /locus_tag="Caur_0225"
                     /db_xref="GeneID:5824807"
     CDS             288301..289482
                     /locus_tag="Caur_0225"
                     /note="PFAM: beta-lactamase domain protein;
                     SMART: Rhodanese domain protein;
                     KEGG: rca:Rcas_1187 beta-lactamase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_001633867.1"
                     /db_xref="GI:163845823"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:5824807"
                     /translation="MTFTPEQSTVTEISPRDLYARLLSAQPLFILDVRNEEEFKRMPV
                     EGHATLRTLNLPYFDFIEDEEAALARLPKDVEEFIVICAKGGASQYVAEVLNNHGYRA
                     VSLSEGMIGWGNYYDVRDVVKADWGRIVQIARPARGDLSFAVISDGQAALVDPLRHIQ
                     VYRELIENAGARLTAILDTHVHADHISGGPALSKETGAPYYIHPYDAIHPIDMLPAVI
                     AYEPLRDGQTFQIGQVRITTIWYPGHTLGQVNFLAETPDGGRYLFTGDGIFLRSFGRP
                     DLGGKGEAWTPILYRSMFEWLPRHLTDDTVILPAHFSTLDEDAGNGIFAAPFAQVRAQ
                     NDSLQPRSLEEFTSYVLSHLPVFPPEYVEIKRVNIGLVEACEGKASELELGKNICALA
                     G"
     misc_feature    288337..288642
                     /locus_tag="Caur_0225"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily. This CD includes predicted proteins with
                     rhodanese-like domains found N-terminal of the
                     metallo-beta-lactamase domain; Region: RHOD_Lact_B;
                     cd01523"
                     /db_xref="CDD:238781"
     misc_feature    288544..288546
                     /locus_tag="Caur_0225"
                     /note="active site residue [active]"
                     /db_xref="CDD:238781"
     misc_feature    288721..289233
                     /locus_tag="Caur_0225"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            289565..289813
                     /locus_tag="Caur_0226"
                     /db_xref="GeneID:5824808"
     CDS             289565..289813
                     /locus_tag="Caur_0226"
                     /note="PFAM: SirA family protein;
                     KEGG: rrs:RoseRS_0815 SirA family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SirA family protein"
                     /protein_id="YP_001633868.1"
                     /db_xref="GI:163845824"
                     /db_xref="InterPro:IPR001455"
                     /db_xref="GeneID:5824808"
                     /translation="MPHFDQTLDVKGAKCPMPLVKSRKAITELPVGQVLQVISTDRGS
                     VADFQGWAKTAKNVELIAQETVQENGQELYVHYLRRTA"
     misc_feature    289583..289804
                     /locus_tag="Caur_0226"
                     /note="SirA, YedF, and YeeD. Two-layered alpha/beta
                     sandwich domain.  SirA (also known as UvrY,  and YhhP)
                     belongs to a family of bacterial two-component response
                     regulators that controls secondary metabolism and
                     virulence. The other member of this...; Region:
                     SirA_YedF_YeeD; cd00291"
                     /db_xref="CDD:238180"
     misc_feature    order(289586..289591,289598..289600,289607..289618,
                     289622..289624)
                     /locus_tag="Caur_0226"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:238180"
     gene            289865..290440
                     /locus_tag="Caur_0227"
                     /db_xref="GeneID:5827898"
     CDS             289865..290440
                     /locus_tag="Caur_0227"
                     /note="KEGG: rca:Rcas_1185 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633869.1"
                     /db_xref="GI:163845825"
                     /db_xref="GeneID:5827898"
                     /translation="MTTPMTETVDTQALLSRIAELEQRVAALEQSPAQSIEDRLAMVV
                     FSGDLDKAIAAFIIATGAASMGLEVSMFFTFWGISAVKKQKVFSGKNLLEQGFTAMLP
                     GKLGELGLSQMNFFGAGAQIIRNLMKQHDVASPEELFAMARELGVRMVVCDMSRELLG
                     IKDEELVDGLETGGVATFLGDAARAKVTLFI"
     misc_feature    289973..290434
                     /locus_tag="Caur_0227"
                     /note="DsrE/DsrF/DrsH-like family; Region: DrsE_2;
                     cl17453"
                     /db_xref="CDD:266694"
     gene            290538..290900
                     /locus_tag="Caur_0228"
                     /db_xref="GeneID:5827899"
     CDS             290538..290900
                     /locus_tag="Caur_0228"
                     /note="PFAM: Rhodanese domain protein;
                     KEGG: rrs:RoseRS_2962 rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_001633870.1"
                     /db_xref="GI:163845826"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:5827899"
                     /translation="MFRQLFRRDVVQNHIATMTVQELKTQLDARAPMVLIDVRQPEEF
                     AYDGHVSGARLLPLPVLASRLNELPKDQPIVCICRSGNRSQVACEMLQRHGFTNVTNV
                     VGGMVAWQRAGYPVSRQH"
     misc_feature    290601..290867
                     /locus_tag="Caur_0228"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    290769..290771
                     /locus_tag="Caur_0228"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            290928..291437
                     /locus_tag="Caur_0229"
                     /db_xref="GeneID:5827900"
     CDS             290928..291437
                     /locus_tag="Caur_0229"
                     /note="PFAM: protein of unknown function DUF442;
                     KEGG: rrs:RoseRS_0813 protein of unknown function DUF442"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633871.1"
                     /db_xref="GI:163845827"
                     /db_xref="InterPro:IPR005939"
                     /db_xref="GeneID:5827900"
                     /translation="MDTTMQHQAICNTLQHQTEVAPLRSYVVTENVLLAAQPQPEDWQ
                     RFVEAGYQTVLNIRSDPERAAQQAANARAAGLRYIHAPWPAYELEPEHLAEFARIVED
                     PATGKLVFHCRSATRVGLIWMLYRMVHQGWSREQAEAELRAAGYDDDAIETFDFCAGD
                     FFERVGSQA"
     misc_feature    291009..291368
                     /locus_tag="Caur_0229"
                     /note="Putative phosphatase (DUF442); Region: DUF442;
                     cl17385"
                     /db_xref="CDD:247939"
     gene            291449..293215
                     /locus_tag="Caur_0230"
                     /db_xref="GeneID:5827901"
     CDS             291449..293215
                     /locus_tag="Caur_0230"
                     /note="TIGRFAM: sulfate transporter;
                     PFAM: Sulfate transporter/antisigma-factor antagonist
                     STAS; Xanthine/uracil/vitamin C permease; sulphate
                     transporter;
                     KEGG: rrs:RoseRS_0812 sulfate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="YP_001633872.1"
                     /db_xref="GI:163845828"
                     /db_xref="InterPro:IPR001902"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="GeneID:5827901"
                     /translation="MTPVSAHRPDVQAALLAMIYRYLPFLNWLRHYRREHLPSDVVAG
                     IVTAIMLIPQSMAYAQLAGLPPQIGLYASVAPLIVYALLGTSGQLSVGPVAITSLLVF
                     SGVSSLAEPGSARYIQLVLLLAFMVGAIKLTFGVLRLGAILNFISHPVLTAFTSASAL
                     IIAVGQLKYILGYRIGGEHIHETIGQAIAGLSQTNLVTLTIGLVSIGLLVFFRQGLRP
                     LLRRTGLPPLAITLIVSGAPLLTVILGILVAQTLFLDQTAGIAVVGAIPAGLSPISVP
                     AFSMADAQALLPTALTIVLVSVVESIAVAKALASKRRQAIDPDQELVALGAANITASF
                     FSGYPVTGGFARSVVNAQAGAITGLASLITALGIAVILLFFTPVFYYLPQAVLAATVI
                     VAVIGLVDLREPRRIWRTNRGDAFTWLITFLAVLTLGIETGIFVGVASALILYLWRTS
                     RPHIAIVGRLGDSEVYRNVERYQVKTWPHVVAVRVDESLYFANTRYLESALLQIVAER
                     PSVKHLVLIGSAINFIDSSALHTLEHLIDELRDAGVEFHLADIKGPVMDRLKQSELID
                     KIGHDHIHLTTHTAMLALGCQD"
     misc_feature    291515..291763
                     /locus_tag="Caur_0230"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    291518..293188
                     /locus_tag="Caur_0230"
                     /note="high affinity sulphate transporter 1; Region: sulP;
                     TIGR00815"
                     /db_xref="CDD:162054"
     misc_feature    291848..292699
                     /locus_tag="Caur_0230"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     pfam00916"
                     /db_xref="CDD:250221"
     misc_feature    292859..293179
                     /locus_tag="Caur_0230"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain of SulP-like sulfate transporters, plays
                     a role in the function and regulation of the transport
                     activity, proposed general NTP binding function; Region:
                     STAS_SulP_like_sulfate_transporter; cd07042"
                     /db_xref="CDD:132913"
     gene            293305..293715
                     /locus_tag="Caur_0231"
                     /db_xref="GeneID:5827902"
     CDS             293305..293715
                     /locus_tag="Caur_0231"
                     /note="PFAM: Rhodanese domain protein;
                     KEGG: rrs:RoseRS_2962 rhodanese domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_001633873.1"
                     /db_xref="GI:163845829"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:5827902"
                     /translation="MKYRFLLLLMIGLALLTACGTTTASTSTTSTPANITVARLKSML
                     DQNETFFLLDVRTPAEFVQDGRIAQATLIPLQELEQRLSELPTDKTIVCICRSGNRSS
                     VACNLLKERGYQAINVTGGMNEWKAAGYPTVFGQ"
     sig_peptide     293305..293379
                     /locus_tag="Caur_0231"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.835 at
                     residue 25"
     misc_feature    293422..293682
                     /locus_tag="Caur_0231"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    293587..293589
                     /locus_tag="Caur_0231"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(294090..294485)
                     /locus_tag="Caur_0232"
                     /db_xref="GeneID:5827903"
     CDS             complement(294090..294485)
                     /locus_tag="Caur_0232"
                     /note="PFAM: protein of unknown function DUF35;
                     KEGG: rca:Rcas_0984 protein of unknown function DUF35"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633874.1"
                     /db_xref="GI:163845830"
                     /db_xref="InterPro:IPR002878"
                     /db_xref="GeneID:5827903"
                     /translation="MKIARHWRDRVPRYRLEGQRHRYTGEIRFPPHPPALDEDPNDWE
                     PYQLSGRGEIYSFSVLRQAPEGFASFGVYPVALVRLEEGPLVTAQLTDCDEADLAIGM
                     PVEMVTRRLMDSGEDGVLVYGYKFRPRLV"
     misc_feature    complement(<294387..294464)
                     /locus_tag="Caur_0232"
                     /note="Rubredoxin-like zinc ribbon domain (DUF35_N);
                     Region: DUF35_N; pfam12172"
                     /db_xref="CDD:256889"
     misc_feature    complement(294102..294449)
                     /locus_tag="Caur_0232"
                     /note="Predicted nucleic-acid-binding protein containing a
                     Zn-ribbon [General function prediction only]; Region:
                     COG1545"
                     /db_xref="CDD:224462"
     misc_feature    complement(294159..294353)
                     /locus_tag="Caur_0232"
                     /note="DUF35 OB-fold domain; Region: DUF35; pfam01796"
                     /db_xref="CDD:250873"
     gene            complement(294482..295108)
                     /locus_tag="Caur_0233"
                     /db_xref="GeneID:5827904"
     CDS             complement(294482..295108)
                     /locus_tag="Caur_0233"
                     /note="KEGG: rrs:RoseRS_2432 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633875.1"
                     /db_xref="GI:163845831"
                     /db_xref="GeneID:5827904"
                     /translation="MIQEMVNGSIAVLTRPSVQSFEQHERDNLVWALIYAVIASVING
                     ILAAITAPLRVGELRAQLETQGVPPDAIEAAIAQQGNPIIAIFAGIFGTIIGSLIIWG
                     FIYLLGRAFGGTGSFGELAWGLSLFSSPLAVAQSIVSVIPLVGDILLLGLSIYGVYLT
                     YLAIQSGMNLPSQKALYIAIILLVITLLFLCVTVGLAAIVGLIGGLAP"
     misc_feature    complement(294533..295075)
                     /locus_tag="Caur_0233"
                     /note="Yip1 domain; Region: Yip1; cl17815"
                     /db_xref="CDD:266857"
     gene            complement(295186..296352)
                     /locus_tag="Caur_0234"
                     /db_xref="GeneID:5827905"
     CDS             complement(295186..296352)
                     /locus_tag="Caur_0234"
                     /note="KEGG: rca:Rcas_0983 acetyl-CoA
                     acetyltransferase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase-like protein"
                     /protein_id="YP_001633876.1"
                     /db_xref="GI:163845832"
                     /db_xref="GeneID:5827905"
                     /translation="MTNVYIAGIGATAVGEHYRRGLADLVSEAARAALASAPEIAPHQ
                     IGALYVGSAFSEELYGQSQAGAYLASILGLSPSIPAYRVEAAGASGALALYQAVQAVQ
                     NGVAVALVIGVDKVTDHLEDEIEAAQAMAADSTEEALHGVTLTAQWAMLMRRYMHEYG
                     YTADAFAPFPINAHANGVHNPLALYRFAIDANKYRKAAQIASPLNMLDCSTLADGAAA
                     LIVVGEQIARELDRPRIRIAGSAVATDHPALHRRRNPLDLSAARASAHIALGRAHLGV
                     GDVQVWELTDPHGIAATLALEAIGCYEPGTAPRYAAEGAITPTGKTPIATFGGYKARG
                     DVGGASGVYQVIELTRQLSGQAGPTQVSNARIGLSQSLGGIGATAVSHVLIRES"
     misc_feature    complement(295192..296352)
                     /locus_tag="Caur_0234"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06064"
                     /db_xref="CDD:235688"
     misc_feature    complement(295204..296334)
                     /locus_tag="Caur_0234"
                     /note="Thiolase domain associated with sterol carrier
                     protein (SCP)-x isoform and related proteins; SCP-2  has
                     multiple roles in intracellular lipid circulation and
                     metabolism. The N-terminal presequence in the SCP-x
                     isoform represents a peroxisomal...; Region:
                     SCP-x_thiolase; cd00829"
                     /db_xref="CDD:238425"
     misc_feature    complement(order(295348..295350,295498..295500,
                     296092..296094))
                     /locus_tag="Caur_0234"
                     /note="active site"
                     /db_xref="CDD:238425"
     gene            complement(296371..297420)
                     /locus_tag="Caur_0235"
                     /db_xref="GeneID:5827906"
     CDS             complement(296371..297420)
                     /locus_tag="Caur_0235"
                     /note="TIGRFAM: hydroxymethylglutaryl-CoA synthase;
                     PFAM: Hydroxymethylglutaryl-coenzyme A synthase domain;
                     3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
                     protein;
                     KEGG: rca:Rcas_0982 putative hydroxymethylglutaryl-CoA
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633877.1"
                     /db_xref="GI:163845833"
                     /db_xref="InterPro:IPR004656"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013747"
                     /db_xref="GeneID:5827906"
                     /translation="MMKPQHPVGIVGYGAYIPRYRIAAREIARVWTDGQSGTPIEAKS
                     VPGPDEDTITMSIEAARNALARAAIPATALGAVWIGSESHPYSVKPSGTVVADALGAG
                     PWVSAADWEFACKAGSEALTAAMALVGSGMQRYALAVGADTAQGRPGDALEYTASAGA
                     AALIVGPASEALATIDATLSYVTDTPDFYRRADRPYPVHGNRFTGEPAYFHQIQSAAT
                     ELLRHLNRTAADFTYAVFHQPNAKFPQAVAKRLGFTDKQIAPGLLSPQIGNTYSGAAL
                     LGLCAILDVAQPGETIFMTTYGSGAGSDAYALTVTEAVLERRERAPLVAAYLQRAVMI
                     DYAIYAKWRGKLVMG"
     misc_feature    complement(296374..297405)
                     /locus_tag="Caur_0235"
                     /note="hypothetical protein; Provisional; Region:
                     PRK04262"
                     /db_xref="CDD:235266"
     misc_feature    complement(296497..297402)
                     /locus_tag="Caur_0235"
                     /note="'initiating' condensing enzymes are a subclass of
                     decarboxylating condensing enzymes, including
                     beta-ketoacyl [ACP] synthase, type III and polyketide
                     synthases, type III, which include chalcone synthase and
                     related enzymes. They are...; Region: init_cond_enzymes;
                     cd00827"
                     /db_xref="CDD:238423"
     misc_feature    complement(order(296521..296523,296872..296883,
                     296983..296985,297040..297045,297052..297057,
                     297064..297066,297091..297105,297109..297111,
                     297133..297135,297142..297144,297169..297171,
                     297175..297177))
                     /locus_tag="Caur_0235"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238423"
     misc_feature    complement(order(296614..296616,296710..296712,
                     297079..297081))
                     /locus_tag="Caur_0235"
                     /note="active site"
                     /db_xref="CDD:238423"
     gene            complement(297617..298936)
                     /locus_tag="Caur_0236"
                     /db_xref="GeneID:5827907"
     CDS             complement(297617..298936)
                     /locus_tag="Caur_0236"
                     /EC_number="1.1.1.88"
                     /note="TIGRFAM: hydroxymethylglutaryl-CoA reductase,
                     degradative;
                     KEGG: rca:Rcas_0981 hydroxymethylglutaryl-CoA reductase,
                     degradative"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA reductase"
                     /protein_id="YP_001633878.1"
                     /db_xref="GI:163845834"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004553"
                     /db_xref="GeneID:5827907"
                     /translation="MGTKSSRLQGFYQLNPFERLQMVKSFDGLVDEDLRALHGGHGGA
                     LTIERADKMIENVIGTYNLPLGIATNFRINGRDYLIPMVVEEPSIVAGASYAARMVRD
                     GGGFETSSTEPLMIGQVQLVNVRDPDQARQTILSRKEEILALANAQSRSLVSLGGGAR
                     DVEVRFFPTSPMGPMLVVHLIIDCRDAMGANAVNTMAEAVAPLLAEMTGGKVYLRILS
                     NLTDRRLARARCVVPAASLARDGLSGEEVVEGILWAYAFAAVDPYRAATHNKGIMNGI
                     DPVLVATGNDWRAVEAGAHAYASRNGHYTSLSHWERDAQGDLVGTLEMPLAVGIVGGA
                     TKVHPTAQAALKLLGVRSAAELAEVCVAAGLANNLAAMRALACEGIQQGHMSLHARQI
                     AMAAGASGTLVDEVARRMVAERNIKLARAEEIIAELEGRTIGNPTHN"
     misc_feature    complement(297653..298909)
                     /locus_tag="Caur_0236"
                     /note="Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA)
                     reductase (HMGR); Region: HMG-CoA_reductase_classII;
                     cd00644"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(297680..297682,297752..297757,
                     297764..297769,297773..297778,297782..297784,
                     297794..297805,297812..297814,297914..297919,
                     297923..297925,297935..297937,298025..298027,
                     298031..298033,298040..298042,298052..298054,
                     298061..298066,298070..298081,298091..298096,
                     298106..298108,298115..298120,298127..298129,
                     298136..298141,298145..298150,298154..298159,
                     298166..298171,298175..298183,298190..298192,
                     298280..298300,298400..298402,298406..298408,
                     298436..298438,298577..298579,298583..298585,
                     298589..298591,298664..298690,298736..298780,
                     298784..298789,298796..298798,298826..298828,
                     298877..298882,298889..298891,298904..298906))
                     /locus_tag="Caur_0236"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(297785..297787,297938..297946,
                     298070..298072,298079..298081,298127..298129,
                     298136..298138,298280..298282,298286..298288,
                     298355..298357,298361..298384,298472..298474,
                     298481..298483,298679..298681))
                     /locus_tag="Caur_0236"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(297785..297787,298079..298081,
                     298127..298129,298679..298681))
                     /locus_tag="Caur_0236"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:153082"
     misc_feature    complement(order(297797..297799,297812..297814,
                     297824..297826,298115..298117,298124..298129,
                     298133..298138,298145..298147,298679..298681))
                     /locus_tag="Caur_0236"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:153082"
     misc_feature    complement(297749..297796)
                     /locus_tag="Caur_0236"
                     /note="flexible flap; other site"
                     /db_xref="CDD:153082"
     gene            299078..299800
                     /locus_tag="Caur_0237"
                     /db_xref="GeneID:5827908"
     CDS             299078..299800
                     /locus_tag="Caur_0237"
                     /note="KEGG: rrs:RoseRS_0432 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633879.1"
                     /db_xref="GI:163845835"
                     /db_xref="GeneID:5827908"
                     /translation="MLTYGTIEYVIYKRLFAFIISLFYLSACATTPLPPLLSDLLTRS
                     PSGTQEMIAFLYYDEQGARLVSSLSVSADRPLPLDPPERQVWIGGLDPPADIPLTNEA
                     GVQYGLVIAQGNWQSAGNYGPGGQWPYTLVTPSFQSITPDRVELAQLFNDNRYEGRLV
                     QMRAALLLADGTSLLVDSIGAGGIPAAGARQVKLLHGESDQAALSQLQARGNVRYGYV
                     DVIGVWRQGRLEPLLIRPLPSE"
     gene            complement(299778..301706)
                     /locus_tag="Caur_0238"
                     /db_xref="GeneID:5827909"
     CDS             complement(299778..301706)
                     /locus_tag="Caur_0238"
                     /note="KEGG: sfu:Sfum_1007 PAS/PAC sensor hybrid histidine
                     kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: response regulator receiver; ATP-binding region
                     ATPase domain protein; histidine kinase A domain protein;
                     PAS fold-3 domain protein; PAS fold domain protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS sensor protein"
                     /protein_id="YP_001633880.1"
                     /db_xref="GI:163845836"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5827909"
                     /translation="MPDDTILLLLANAANRELLRDWLGHHYQTIIADSEADLQRSFQL
                     CIVDGPALATFEAAIQARRAAAYPIFLPFLLVTTRGDVKYHTHHLWQTVDELVISPIQ
                     KVELQARIEILLRARRLALEVSRLQQAMLSSTQTWLQLAVQSAQIGLWEWDLQTNRVF
                     FSPEWKAQIGYAADELVDSLTVWEELIHPDDRERCLNLLYRYLHRPWPDFALEFRLRH
                     KNGSYRWIRSQAALIYDQHGRPTHMLGAHFDLTERKQMEEEQQQLAEQLFQSQKLEAI
                     GALTSGIAHDLNNLLVPIIGFAEMGMLEVTPDNPLYSDFDQIRAAGIRATALTRRILT
                     FSRQQRMEMKPIHISRVISDFVAILRRIIGERIDIQLQLASDLPPVQADVSQIEQILL
                     NLVINARDAIEGNGTITITTAFVSPEDTDFPWPADVPPGDYIALQISDTGCGIDSAIR
                     SRIFEPFFTTKPSGKGTGLGLATVAAIVKQHHGYIDVQSLPGQGATFTVYLPALKDGA
                     AVSEDVAFSKDQLFGHETVLVVEDEPAVLHLIASALRLHGYQVIEATDAQYGLGLAAS
                     HQGTIDLLITDVMLPTLNGDELYRQLRGLYPQARVLYISAYVDSEHVGPDVTPILAKP
                     FTLQRLLQQVRAILTAAV"
     misc_feature    complement(300957..301265)
                     /locus_tag="Caur_0238"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(300966..301235)
                     /locus_tag="Caur_0238"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    complement(order(301044..301046,301059..301061,
                     301140..301151,301194..301196,301212..301214,
                     301224..301226))
                     /locus_tag="Caur_0238"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(301017..301019,301023..301025,
                     301110..301115,301122..301124,301146..301148,
                     301158..301160))
                     /locus_tag="Caur_0238"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(300696..300890)
                     /locus_tag="Caur_0238"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(300711..300713,300723..300725,
                     300732..300734,300744..300746,300753..300755,
                     300765..300767,300816..300818,300825..300827,
                     300837..300839,300846..300848,300858..300860,
                     300870..300872))
                     /locus_tag="Caur_0238"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(300852..300854)
                     /locus_tag="Caur_0238"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(300204..300548)
                     /locus_tag="Caur_0238"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(300216..300218,300222..300227,
                     300240..300242,300246..300248,300294..300305,
                     300372..300377,300381..300383,300387..300389,
                     300393..300395,300507..300509,300516..300518,
                     300528..300530))
                     /locus_tag="Caur_0238"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(300516..300518)
                     /locus_tag="Caur_0238"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(300297..300299,300303..300305,
                     300375..300377,300381..300383))
                     /locus_tag="Caur_0238"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(299793..300125)
                     /locus_tag="Caur_0238"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(299835..299840,299847..299849,
                     299892..299894,299952..299954,299976..299978,
                     300111..300116))
                     /locus_tag="Caur_0238"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(299976..299978)
                     /locus_tag="Caur_0238"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(299952..299960,299964..299969))
                     /locus_tag="Caur_0238"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(299832..299840)
                     /locus_tag="Caur_0238"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(301866..303314)
                     /locus_tag="Caur_0239"
                     /db_xref="GeneID:5827910"
     CDS             complement(301866..303314)
                     /locus_tag="Caur_0239"
                     /EC_number="2.7.11.1"
                     /note="KEGG: rca:Rcas_0671 putative circadian clock
                     protein, KaiC;
                     PFAM: Circadian clock protein KaiC central region; KaiA
                     binding;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="non-specific serine/threonine protein kinase"
                     /protein_id="YP_001633881.1"
                     /db_xref="GI:163845837"
                     /db_xref="InterPro:IPR001553"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004504"
                     /db_xref="InterPro:IPR010624"
                     /db_xref="InterPro:IPR014774"
                     /db_xref="InterPro:IPR015140"
                     /db_xref="GeneID:5827910"
                     /translation="MEQAATQRLATGIPGLDEICGGGLVPRYAYLVRGGPGTGKTTLG
                     LHFLAAGAANGETTLFISLEETESKIRWNAAQTGINLNQVHILDLSPSSDFFANTQIY
                     DIFSPAEVEREPITRQIVETVQRLQPTRVFLDSITQFRYLTPDTFQFRKQVISFLRFL
                     AEQRTTVVFSAENSAAFPDDDLQYIADGIISLELTNTGRYLTVSKMRGSSFVSGRHAM
                     RLTTQGLQVFPRIIPTPLVAGHAFTLIPSGVPELDELLNGGVERGTITLITGPSGVGK
                     TTLGFQFMKEAASRGERSMVFSFEEEIEIMQQRCEAVNIPVRAMQKQQLLRIEKIEPL
                     QYNPAEFAQHVRYFIEQEQIKVVMIDSVTGYRLCMHGEDLISQLHALSKYLQSRGVTV
                     FLIMDTTDIVGDFKVTEIGASYLGDNIIFLRFLEIEGELRKAIGVLKKRLGDFEKTLR
                     EFAISRYGIKVGKPLTNLRGILSGMPTWVDKA"
     misc_feature    complement(301884..303311)
                     /locus_tag="Caur_0239"
                     /note="circadian clock protein KaiC; Reviewed; Region:
                     PRK09302"
                     /db_xref="CDD:236461"
     misc_feature    complement(302628..303284)
                     /locus_tag="Caur_0239"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(303192..303200,303210..303215))
                     /locus_tag="Caur_0239"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(302910..302915,303126..303131,
                     303135..303137,303192..303200,303210..303212))
                     /locus_tag="Caur_0239"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(302913..302927)
                     /locus_tag="Caur_0239"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(<302478..>302579)
                     /locus_tag="Caur_0239"
                     /note="Circularly permuted YlqF-related GTPases; Region:
                     YlqF_related_GTPase; cl17249"
                     /db_xref="CDD:247803"
     misc_feature    complement(301986..302522)
                     /locus_tag="Caur_0239"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(302484..302507)
                     /locus_tag="Caur_0239"
                     /note="G1 box; other site"
                     /db_xref="CDD:206746"
     misc_feature    complement(order(302484..302492,302502..302507))
                     /locus_tag="Caur_0239"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(302232..302237,302418..302423,
                     302427..302429,302484..302492,302502..302504))
                     /locus_tag="Caur_0239"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(302481..302501)
                     /locus_tag="Caur_0239"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206746"
     misc_feature    complement(302235..302249)
                     /locus_tag="Caur_0239"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            303685..304764
                     /locus_tag="Caur_0240"
                     /db_xref="GeneID:5827911"
     CDS             303685..304764
                     /locus_tag="Caur_0240"
                     /note="PFAM: creatinase; peptidase M24;
                     KEGG: sth:STH1865 Xaa-Pro dipeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="YP_001633882.1"
                     /db_xref="GI:163845838"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="GeneID:5827911"
                     /translation="MTNRLQQLRATLAARELPAMLLTAPTSRRYISGFTGSAGALLIS
                     AEAAFLLTDGRYLIRAAAEAPHFTLREVRPPARPMTALIADLASELGIKRLGFEAAVM
                     TVAEHRQYTAALGNAIELVPTENIVEELRMVKDEEEIALLRRAAAITDAALAAVLPAL
                     TPTMTEREAAWRLEVALHDLGAEGPSFPIIVAAGRNSARPHHTPGDDVLGEGQPIIID
                     MGARLDGYHADLTRTIVLGQPDDTFRAVYAATLKAQQAAMQALRPGLPWSEADAIARR
                     VIGEAGYAEGIAHSLGHGVGLVIHEAPWLRITAPDAPPSPPLQAGMVTSIEPGIYLPE
                     WGGVRIEDLVLITTNGYEVLSQAPK"
     misc_feature    303685..304761
                     /locus_tag="Caur_0240"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    303694..304083
                     /locus_tag="Caur_0240"
                     /note="Creatinase/Prolidase N-terminal domain; Region:
                     Creatinase_N; pfam01321"
                     /db_xref="CDD:250531"
     misc_feature    304099..304737
                     /locus_tag="Caur_0240"
                     /note="Similar to Prolidase and Aminopeptidase P. The
                     members of this subfamily presumably catalyse hydrolysis
                     of Xaa-Pro dipeptides and/or release of any N-terminal
                     amino acid, including proline, that is linked with
                     proline; Region: APP-like; cd01092"
                     /db_xref="CDD:238525"
     misc_feature    order(304285..304287,304336..304338,304369..304371,
                     304561..304563,304663..304665,304705..304707)
                     /locus_tag="Caur_0240"
                     /note="active site"
                     /db_xref="CDD:238525"
     gene            305149..307278
                     /locus_tag="Caur_0241"
                     /db_xref="GeneID:5827870"
     CDS             305149..307278
                     /locus_tag="Caur_0241"
                     /EC_number="6.5.1.2"
                     /note="KEGG: rca:Rcas_0877 DNA ligase, NAD-dependent;
                     TIGRFAM: DNA ligase, NAD-dependent;
                     PFAM: helix-hairpin-helix motif; BRCT domain protein;
                     zinc-finger NAD-dependent DNA ligase C4-type;
                     NAD-dependent DNA ligase OB-fold; NAD-dependent DNA ligase
                     adenylation;
                     SMART: Helix-hairpin-helix DNA-binding class 1;
                     NAD-dependent DNA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="YP_001633883.1"
                     /db_xref="GI:163845839"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR001679"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR004149"
                     /db_xref="InterPro:IPR004150"
                     /db_xref="InterPro:IPR013839"
                     /db_xref="InterPro:IPR013840"
                     /db_xref="GeneID:5827870"
                     /translation="MSHTTVADRINELRSLIRRYDYHYYVLDDPIVSDAEYDALMTEL
                     RALEAAHPELITPDSPTQRVSGTPASQFAKVQHPQPMLSLGNAFTKADLLAWRDRVLR
                     LLGPDAIVAYVVEPKIDGLAVALTYRDGRLVQGATRGDGEVGEDVTANLRTIGSIPLT
                     LQATSTPQDDDLPTTLPTTIEVRGEVYMRTADFETLNDRLAAAGEKIFANPRNAAAGS
                     LRQKDPTITAARPLRFFAYGVGVVEGISLSSQWQTLRYLRALGFPVNQDVRRFTDFAE
                     VLAYCEAWMAKRDDLPYEADGVVIKIDDFAQQRELGVVGRDPRWAIAFKFPAREAITR
                     LLDITVNVGRTGVVTPNAELEPVQIGGVTVRNASLHNADYIAQRDIRIGDYVIVKRAG
                     DVIPYVVGPVIARRDGSERPWQFPTHCPACGSPLEREEGEAAWRCNNFSICPAQLVRR
                     VEHFVSRSALDIVGMGERQAELFVQRGLIRDVADIFFLKADQLAELEGFGPKRIANLL
                     AAIDAARQRPLDRLLVGLGIRYVGTVAAQTLVAALGSLDAIMAARQEELEQIPGIGPV
                     VAASIVDFFSRPANRALIEKLRAAGVQMGGVSGPTRQSDTLAGKTFVLTGTLPSLSRE
                     QASALIVAHGGKVTDSVSKKTSYVVAGANAGSKLAKALQLGIPVIDEAGLLALIGTTA
                     EPPPSPPPPPPETNTDGNQLLLPLDGE"
     misc_feature    305158..307185
                     /locus_tag="Caur_0241"
                     /note="NAD-dependent DNA ligase LigA; Validated; Region:
                     ligA; PRK07956"
                     /db_xref="CDD:236137"
     misc_feature    305170..306132
                     /locus_tag="Caur_0241"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cd00114"
                     /db_xref="CDD:238062"
     misc_feature    order(305398..305400,305491..305493,305497..305499,
                     305560..305562,305701..305703,305857..305859,
                     306043..306045,306049..306051)
                     /locus_tag="Caur_0241"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(305497..305499,305503..305508)
                     /locus_tag="Caur_0241"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    305497..305499
                     /locus_tag="Caur_0241"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    306139..306384
                     /locus_tag="Caur_0241"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     misc_feature    306400..306483
                     /locus_tag="Caur_0241"
                     /note="NAD-dependent DNA ligase C4 zinc finger domain;
                     Region: DNA_ligase_ZBD; pfam03119"
                     /db_xref="CDD:251739"
     misc_feature    306505..306681
                     /locus_tag="Caur_0241"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     misc_feature    306709..306900
                     /locus_tag="Caur_0241"
                     /note="Helix-hairpin-helix motif; Region: HHH_2;
                     pfam12826"
                     /db_xref="CDD:257328"
     misc_feature    306973..307182
                     /locus_tag="Caur_0241"
                     /note="Breast Cancer Suppressor Protein (BRCA1),
                     carboxy-terminal domain. The BRCT domain is found within
                     many DNA damage repair and cell cycle checkpoint proteins.
                     The unique diversity of this domain superfamily allows
                     BRCT modules to interact forming homo...; Region: BRCT;
                     cd00027"
                     /db_xref="CDD:237994"
     misc_feature    order(307018..307020,307030..307032,307039..307041,
                     307048..307050,307054..307056)
                     /locus_tag="Caur_0241"
                     /note="Dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237994"
     misc_feature    order(307165..307167,307177..307179)
                     /locus_tag="Caur_0241"
                     /note="BRCT sequence motif; other site"
                     /db_xref="CDD:237994"
     gene            complement(308385..309560)
                     /locus_tag="Caur_0242"
                     /db_xref="GeneID:5827871"
     CDS             complement(308385..309560)
                     /locus_tag="Caur_0242"
                     /note="KEGG: rca:Rcas_2266 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633884.1"
                     /db_xref="GI:163845840"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:5827871"
                     /translation="MAGNQNDLRRFGTALLLGVAAGFAARYYLETRARNSTRPASGLI
                     DWEQARQAALRLSQWEQAPVDNRAFRREQYARMVALSEPLIADYLGVRLPEPVSRIFV
                     FDRREWLEANIVSFSQLFRPIEEMYEKNGGGRGALGVLMNDVSSKLLGVQIGGLLGYL
                     AQRVLGQYDLSLLSAEATGGSLYFVEPNIARVQQQLGLSDEDFRLWITLHEMTHAFEF
                     EAYPWVRTYFRELLEQNFALVSGQMLSSGNSLVDMLMRLLQGIGSGQHWIETVLTPEQ
                     RAVFDRIQALMSLIEGYGNHVMNAVGRRLLPSFNQIEQQIAQRQRQRTMLDQMVFRLT
                     GLDLKLAQYQQGEAFVNAVVAARGIQFASRVWERPENLPSMDEIRNPGQWIVRMDRQ"
     misc_feature    complement(308394..309431)
                     /locus_tag="Caur_0242"
                     /note="uncharacterized protein, coenzyme F420 biosynthesis
                     associated; Region: DUF2342_F420; TIGR03883"
                     /db_xref="CDD:234380"
     gene            complement(309663..311531)
                     /locus_tag="Caur_0243"
                     /db_xref="GeneID:5827872"
     CDS             complement(309663..311531)
                     /locus_tag="Caur_0243"
                     /EC_number="2.7.7.4"
                     /note="KEGG: mta:Moth_2503 selenocysteine-specific
                     translation elongation factor;
                     TIGRFAM: selenocysteine-specific translation elongation
                     factor; small GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor Tu domain 2 protein; Elongation factor SelB winged
                     helix 2; Elongation factor SelB winged helix 3"
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine-specific translation elongation
                     factor"
                     /protein_id="YP_001633885.1"
                     /db_xref="GI:163845841"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004535"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR015190"
                     /db_xref="InterPro:IPR015191"
                     /db_xref="GeneID:5827872"
                     /translation="MQEFLAMFVIGTAGHVDHGKSTLVKALTGIDPDRLREEQQREMT
                     IDLGFAWLTLPGGREVSLIDVPGHERFIKNMLAGVGGIDAVLLVIAADEAVMPQTREH
                     LAIIDLLAIRHGIVVLSKVDLVDADWLELVREEVREALAGSTLASAPIVPVSARTGAG
                     LAELLLTLDRLLDTLPARDQVRGVPRLAIDRSFTITGFGTVVTGTLRDGVLSVGQEVE
                     LLPPGLRARIRGLQSHQRPIDQGKPGMRVAVNLAGVHHRDIRRGHVLTLPGALTPTTL
                     LDARVRVVSDVAPIAHNAALDLFIGSSEAPCRLTLLDTDELSAGTEGWVQIRLTVPVV
                     AAVGDRFILRTPSPSRTVAGGVVIDPHPPRHRRFRSEVIAALTLRSQGSPAERLRQTL
                     ADGRPRLRTESLAAAGITDTEAEAVLVALVTEGHLVVLGDDVLISSAGWASLRATLRD
                     LLASYHQRFPLRRGMSREEVRQRLQLTPRLWQSVLATTMAEGWLSADETTVRLTNFTP
                     QPTADQQRALNRYISALAHMPPAPPPAELDSELLAWACDNGLLVKIASDLYLLPATCT
                     AMTMWVRTTVETQGGVTVAAFRDHFGVSRRYAVAFLEYLDEQRITRRVGDTRILVR"
     misc_feature    complement(310119..311507)
                     /locus_tag="Caur_0243"
                     /note="Selenocysteine-specific translation elongation
                     factor [Translation, ribosomal structure and biogenesis];
                     Region: SelB; COG3276"
                     /db_xref="CDD:225815"
     misc_feature    complement(311043..311507)
                     /locus_tag="Caur_0243"
                     /note="SelB, the dedicated elongation factor for delivery
                     of selenocysteinyl-tRNA to the ribosome; Region: SelB;
                     cd04171"
                     /db_xref="CDD:206734"
     misc_feature    complement(311481..311504)
                     /locus_tag="Caur_0243"
                     /note="G1 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(order(311127..311129,311139..311141,
                     311253..311258,311325..311330,311385..311390,
                     311457..311462,311469..311471,311478..311483,
                     311493..311495,311499..311501))
                     /locus_tag="Caur_0243"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(order(311064..311072,311166..311168,
                     311172..311177,311478..311495))
                     /locus_tag="Caur_0243"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206734"
     misc_feature    complement(311388..311435)
                     /locus_tag="Caur_0243"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(311400..311402)
                     /locus_tag="Caur_0243"
                     /note="G2 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(311331..311342)
                     /locus_tag="Caur_0243"
                     /note="G3 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(311280..311336)
                     /locus_tag="Caur_0243"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(311166..311177)
                     /locus_tag="Caur_0243"
                     /note="G4 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(311064..311072)
                     /locus_tag="Caur_0243"
                     /note="G5 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    complement(310734..310979)
                     /locus_tag="Caur_0243"
                     /note="selB_II: this subfamily represents the domain of
                     elongation factor SelB, homologous to domain II of EF-Tu.
                     SelB may function by replacing EF-Tu. In prokaryotes, the
                     incorporation of selenocysteine as the 21st amino acid,
                     encoded by TGA, requires several...; Region: selB_II;
                     cd03696"
                     /db_xref="CDD:239667"
     misc_feature    complement(310461..310748)
                     /locus_tag="Caur_0243"
                     /note="This family represents the domain of elongation
                     factor SelB, homologous to domain III of EF-Tu. SelB may
                     function by replacing EF-Tu. In prokaryotes, the
                     incorporation of selenocysteine as the 21st amino acid,
                     encoded by TGA, requires several elements:...; Region:
                     selB_III; cd04094"
                     /db_xref="CDD:239761"
     misc_feature    complement(310023..310190)
                     /locus_tag="Caur_0243"
                     /note="Elongation factor SelB, winged helix; Region:
                     SelB-wing_2; pfam09106"
                     /db_xref="CDD:255185"
     misc_feature    complement(309672..309818)
                     /locus_tag="Caur_0243"
                     /note="Elongation factor SelB, winged helix; Region:
                     SelB-wing_3; pfam09107"
                     /db_xref="CDD:255186"
     gene            311572..312168
                     /locus_tag="Caur_0244"
                     /db_xref="GeneID:5827873"
     CDS             311572..312168
                     /locus_tag="Caur_0244"
                     /EC_number="3.2.2.21"
                     /note="PFAM: HhH-GPD family protein;
                     KEGG: sus:Acid_6307 DNA-3-methyladenine glycosylase II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase II"
                     /protein_id="YP_001633886.1"
                     /db_xref="GI:163845842"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="GeneID:5827873"
                     /translation="MEHALQHLRNVDPTLGHWIEQIGPYTLQRQPHGFATLAYAIISQ
                     QLSLVAARTIRDRLNERLGSLAPETIIAADETVLRAAGLSAQKSSYLRDLAERVMSGQ
                     LDLNLLPTLDDETAITHLMTVKGIGRWTAEIYLMFALERLDVLPAADLGLRDAVRLIY
                     DQPRLPKPQELRTFGERWRPYRSIACWYLWQARRIMIS"
     misc_feature    <311572..312153
                     /locus_tag="Caur_0244"
                     /note="3-methyladenine DNA glycosylase/8-oxoguanine DNA
                     glycosylase [DNA replication, recombination, and repair];
                     Region: AlkA; COG0122"
                     /db_xref="CDD:223200"
     misc_feature    311671..312144
                     /locus_tag="Caur_0244"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    order(311704..311712,311719..311721,311830..311832)
                     /locus_tag="Caur_0244"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    311938..311961
                     /locus_tag="Caur_0244"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(311968..311970,312127..312129,312139..312141)
                     /locus_tag="Caur_0244"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    312016..312018
                     /locus_tag="Caur_0244"
                     /note="active site"
                     /db_xref="CDD:238013"
     gene            312240..312992
                     /locus_tag="Caur_0245"
                     /db_xref="GeneID:5827874"
     CDS             312240..312992
                     /locus_tag="Caur_0245"
                     /EC_number="2.7.7.56"
                     /note="KEGG: rrs:RoseRS_2001 ribonuclease PH;
                     TIGRFAM: ribonuclease PH;
                     PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
                     domain 2"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="YP_001633887.1"
                     /db_xref="GI:163845843"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR002381"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="GeneID:5827874"
                     /translation="MMRIDGRSPDQLRPISIEIGAAPYAEGSALIAYGKTRVLCTATV
                     EDGVPAWMRGQQSGWVTAEYAMLPRATLQRTRRERNGPSGRTQEIQRLIGRSLRAAID
                     LNALGERTITIDCDVLQADGGTRTAAISGGYVALALAVDYLVRSGVLETRPTLTPVAA
                     VSVGMLQGVLLLDLCYEEDSQADLDCNVVMNSAGGYIEVQATAERSAVTRDQLNALLD
                     LAGRGIQQILDAQAAALATALPNNAMSQVQSP"
     misc_feature    312243..312920
                     /locus_tag="Caur_0245"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    312270..312920
                     /locus_tag="Caur_0245"
                     /note="Ribonuclease PH; Region: RNase_PH_bact; cd11362"
                     /db_xref="CDD:206767"
     misc_feature    order(312300..312314,312342..312344,312348..312350,
                     312354..312356,312360..312362,312366..312368,
                     312426..312428,312432..312434,312438..312455,
                     312459..312461,312468..312473,312489..312494,
                     312498..312503,312510..312512,312522..312524,
                     312531..312533,312573..312575,312579..312581,
                     312585..312587,312591..312599,312822..312836,
                     312840..312842,312846..312863,312867..312869,
                     312876..312881,312888..312893,312900..312902)
                     /locus_tag="Caur_0245"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(312435..312437,312492..312494,312597..312614,
                     312774..312776,312792..312794)
                     /locus_tag="Caur_0245"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            313069..314322
                     /locus_tag="Caur_0246"
                     /db_xref="GeneID:5827875"
     CDS             313069..314322
                     /locus_tag="Caur_0246"
                     /note="PFAM: TPR repeat-containing protein;
                     Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
                     protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: rrs:RoseRS_1999 tetratricopeptide TPR_2 repeat
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633888.1"
                     /db_xref="GI:163845844"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:5827875"
                     /translation="MTDETRRVAGRRHLRYGLAFERTQHPEAAVDQFRRAIAADPTLR
                     DAHNALAFHYQQQGLLAKAADAFAAVASLADDYFAHFNLGFVLIELERYDEAEREFRR
                     CLELDPGDVAAQLELAYIYAARGDYETALNFLTIPRQHYYDDWGVFHLLGRCLFHMQR
                     FDEARQAWQQSLALAPTPETQLELLSCLQSIERRREFHATISHKDELYIHEGVICLGS
                     AMDDGFTIRPLSNYRFSELDVARTIQRFLALARSSEWRFGGVTTPELMSKPLALTLAQ
                     LLNLPLLSLHHLPQLSEPILIVMAVGHSADLLTIARERLPVPGPGFCLAVNWTRQSKL
                     LPEIIGVIVEGQCTVPWEEELQSLDTAGQTDHIKHIAGRLIQMVQTLPGEDNLPRQIR
                     YYTRHHRRLAINALLHTSPPDHPAE"
     misc_feature    313105..313392
                     /locus_tag="Caur_0246"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    313108..313392
                     /locus_tag="Caur_0246"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(313108..313113,313120..313125,313210..313215,
                     313219..313224,313231..313236,313309..313314,
                     313321..313326,313333..313338)
                     /locus_tag="Caur_0246"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(313117..313119,313153..313155,313165..313167,
                     313174..313176,313219..313221,313255..313257,
                     313267..313269,313276..313278,313318..313320,
                     313354..313356,313366..313368,313375..313377)
                     /locus_tag="Caur_0246"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    313303..313599
                     /locus_tag="Caur_0246"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(313303..313305,313309..313314,313321..313326,
                     313411..313416,313420..313425,313432..313437,
                     313513..313518,313525..313530,313537..313542)
                     /locus_tag="Caur_0246"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(313318..313320,313354..313356,313366..313368,
                     313375..313377,313420..313422,313456..313458,
                     313522..313524,313558..313560,313570..313572,
                     313579..313581)
                     /locus_tag="Caur_0246"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    313333..313569
                     /locus_tag="Caur_0246"
                     /note="Anaphase-promoting complex, cyclosome, subunit 3;
                     Region: Apc3; pfam12895"
                     /db_xref="CDD:257383"
     gene            314703..315731
                     /locus_tag="Caur_0247"
                     /db_xref="GeneID:5827876"
     CDS             314703..315731
                     /locus_tag="Caur_0247"
                     /note="KEGG: rca:Rcas_2319 UV damage repair
                     endonuclease-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UV damage repair endonuclease-like protein"
                     /protein_id="YP_001633889.1"
                     /db_xref="GI:163845845"
                     /db_xref="GeneID:5827876"
                     /translation="MKAIDHPIPGTSHDLAPLYQRASRQSKHAAIRSSGQQYDTTHPG
                     IRLGFAVRTVSQPGLISGSPPHLSILLTHLGDALRYLERTNIRFYRFALPRHFNLSDL
                     AECQTQLALLNQHISTRNLRLGVHLDPHLSLSHSDEQVADATIRTIEATCQLLAALDH
                     AQTINHTLVIHPGAADPAAQQRFIQRWVKLSIQARRRTTIEHTGAGFSLGQLLVLAAR
                     TGIPIVFDYLHYRLHNPERLSLALALGLTLATWPHQIRPEVHLSSQRSEAHLLPGRNG
                     TTRVIPPRAGQHADFVVAHDAIALLEAGRGLPPFDLMIEAKAGDLALLRLRQELAHYA
                     PEWAARLA"
     misc_feature    314913..315701
                     /locus_tag="Caur_0247"
                     /note="UV-endonuclease UvdE; Region: UvdE; cl10036"
                     /db_xref="CDD:263954"
     gene            316267..317016
                     /locus_tag="Caur_0248"
                     /db_xref="GeneID:5827877"
     CDS             316267..317016
                     /locus_tag="Caur_0248"
                     /EC_number="5.2.1.8"
                     /note="PFAM: peptidyl-prolyl cis-trans isomerase
                     cyclophilin type;
                     KEGG: rrs:RoseRS_2438 peptidylprolyl isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl isomerase"
                     /protein_id="YP_001633890.1"
                     /db_xref="GI:163845846"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="GeneID:5827877"
                     /translation="MSNERPSTTSNPLAGLVAIAILLIVLGFVAGLLISRSGTPIVVP
                     TAAPAPTNPPAPTEPASVPTPITGSMPILPTATTYQYSSPPPMSIDPAKKYTATIYTP
                     RGEIVIELLPDIAPQTVNNFVFLARQNFYNGLTWHRVLPNFMAQGGDPRGDGTGGPGY
                     TIPAEFTDKILFDQPGIVAMARSSDPNSAGSQFFITTAPAPRLNEQYTIFGRVIQGQE
                     IVDGIPLRDPSNPADLATPGEMILGIAINEE"
     sig_peptide     316267..316380
                     /locus_tag="Caur_0248"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.759) with cleavage site probability 0.315 at
                     residue 38"
     misc_feature    316558..316956
                     /locus_tag="Caur_0248"
                     /note="cyclophilin: cyclophilin-type peptidylprolyl cis-
                     trans isomerases. This family contains eukaryotic,
                     bacterial and archeal proteins which exhibit a
                     peptidylprolyl cis- trans isomerases activity (PPIase,
                     Rotamase) and in addition bind the...; Region:
                     cyclophilin; cd00317"
                     /db_xref="CDD:238194"
     misc_feature    order(316678..316680,316684..316686,316693..316698,
                     316702..316704,316807..316812,316840..316842,
                     316846..316848,316870..316875,316885..316887)
                     /locus_tag="Caur_0248"
                     /note="active site"
                     /db_xref="CDD:238194"
     gene            317293..319125
                     /locus_tag="Caur_0249"
                     /db_xref="GeneID:5827878"
     CDS             317293..319125
                     /locus_tag="Caur_0249"
                     /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
                     domain protein;
                     KEGG: rca:Rcas_2308 pyruvate flavodoxin/ferredoxin
                     oxidoreductase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate flavodoxin/ferredoxin oxidoreductase
                     domain-containing protein"
                     /protein_id="YP_001633891.1"
                     /db_xref="GI:163845847"
                     /db_xref="InterPro:IPR002880"
                     /db_xref="GeneID:5827878"
                     /translation="MQSPEPVVNEFAITAATVNGSGSQTANMVLMRAIFKMGIPVSGK
                     NLFPSNIQGEPTWYTLRVSQAGYTARPAETPILVAFNPRTANDDLSQLPPGGICLYPA
                     DGPWQPSRTDIIPFAIPVRQLLDQVGVNQRLRTYAANMTYVGALAALLGIEDAALVAA
                     LKQQFRGRLSAIELNLAVIRAAYAWAAAEPSPAHGRFRIARMQATDGMMLIDGNTAAA
                     IGAITGGVGVVAWYPITPSSSLIESLESYLPRLRPPTDGATCAIVQAEDEIAALGIVI
                     GAGWAGARAMTATSGPGISLMSEFAGLGFFAEIPAVIWDVQRVGPSTGLPTRTAQGDL
                     MAVYYLSHGDTRHVILLPGTMEECFSDAQTAFDLAEQLQTPVFVLSDLDLGMNIWMSK
                     PFTYPEQPLQRGKVLSAEELSRLTNYARFADVDGDGIGYRTLPGNPHPLAATLSRGTG
                     HNERNVYSERPEDWQRNMARLWRKHETARRLVPRPVIDDHPEATIGLIGFGSTAPAIS
                     EARDLLAAAGIPTSSMRVRALPFGPEVTNFIARHQICVVIEQNHDGQLRQLLQLHCPA
                     YASRLGSVAWCDGLPLTAPFVRDQVLHCLESMRETMMIGIGTGN"
     misc_feature    317320..319065
                     /locus_tag="Caur_0249"
                     /note="2-oxoacid:acceptor oxidoreductase, alpha subunit;
                     Region: OAFO_sf; TIGR03710"
                     /db_xref="CDD:234323"
     misc_feature    317350..317832
                     /locus_tag="Caur_0249"
                     /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
                     Region: POR; pfam01558"
                     /db_xref="CDD:250706"
     misc_feature    317929..318435
                     /locus_tag="Caur_0249"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    order(317974..317979,317995..317997,318007..318009,
                     318016..318018,318079..318090,318109..318114,
                     318118..318126,318133..318135,318139..318141,
                     318190..318192,318199..318201,318211..318213,
                     318250..318255,318304..318309)
                     /locus_tag="Caur_0249"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(317974..317979,317986..317991,317995..317997,
                     318013..318018,318079..318090,318109..318114,
                     318118..318126,318133..318135,318139..318141,
                     318190..318192,318199..318201)
                     /locus_tag="Caur_0249"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(317989..317991,318094..318096)
                     /locus_tag="Caur_0249"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(317995..317997,318244..318246)
                     /locus_tag="Caur_0249"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     gene            319155..320180
                     /locus_tag="Caur_0250"
                     /db_xref="GeneID:5827879"
     CDS             319155..320180
                     /locus_tag="Caur_0250"
                     /note="catalyzes the coenzyme A-dependent formation of
                     succinyl-CoA from 2-oxoglutarate and ferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate ferredoxin oxidoreductase subunit
                     beta"
                     /protein_id="YP_001633892.1"
                     /db_xref="GI:163845848"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="GeneID:5827879"
                     /translation="MTQVNAIGLSKADYRGAPSTLCAGCGHDSVASQIIAAAFELSLQ
                     PHTVIRMSGIGCSSKSAAYFLGRSHGFNSLHGRMPSVTTGAHLANHTLRPLAVSGDGD
                     TASIGLGQFIHLLRRNVPIVYIVENNGVYGLTKGQFSATADEGQELKHAGVNHLPPID
                     VCAEAILAGCGFVARSFAGDARQVRELIKAAFNVHGSAVIDVISPCVTFNNHDRSTKS
                     YTYGKTHETPIHDISFIPHYDEVTVDYEPGEVRDVQLHDGPVIRLRKLNRDHDPTDRS
                     AALALLEQARANNEFVTGLIYLNERRPTLAETLGIGSTPIAALPEDRLRPSREAFAAV
                     MAELVDG"
     misc_feature    319161..320159
                     /locus_tag="Caur_0250"
                     /note="2-oxoglutarate ferredoxin oxidoreductase subunit
                     beta; Validated; Region: PRK05778"
                     /db_xref="CDD:235604"
     misc_feature    319215..319781
                     /locus_tag="Caur_0250"
                     /note="Thiamine pyrophosphate (TPP family), 2-oxoglutarate
                     ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding
                     module; OGFOR catalyzes the oxidative decarboxylation of
                     2-oxo-acids, with ferredoxin acting as an electron
                     acceptor. In the TCA cycle, OGFOR...; Region: TPP_OGFOR;
                     cd03375"
                     /db_xref="CDD:239470"
     misc_feature    order(319377..319379,319449..319460,319536..319538,
                     319542..319544)
                     /locus_tag="Caur_0250"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239470"
     misc_feature    <319938..320102
                     /locus_tag="Caur_0250"
                     /note="Pyruvate ferredoxin oxidoreductase beta subunit C
                     terminal; Region: PFO_beta_C; pfam12367"
                     /db_xref="CDD:257011"
     gene            complement(320681..322705)
                     /locus_tag="Caur_0251"
                     /db_xref="GeneID:5827880"
     CDS             complement(320681..322705)
                     /locus_tag="Caur_0251"
                     /note="KEGG: rrs:RoseRS_2439 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633893.1"
                     /db_xref="GI:163845849"
                     /db_xref="GeneID:5827880"
                     /translation="MELVRAILAVEIGSLITRVSLIDEVDGESRLIGQTETLTSRELP
                     YRNVFFAVQEATAQLADLTGRQLLRDGRLLMPRISTGDGIDAVIVVTSALEPLRVVVA
                     AIASDVSARSALHAVRGVPSVVLAVVTLDDVSARSTTGVMQSWLERQLETLLPLLPDV
                     VVLAGGVEGGTVEAMKRLAHLINLKLSFTAAIRQPLPTIIYAGNTSVQPQIQAALGGH
                     NCELITVANVRPALDQEVLTPLRQALLACYARQLTDVPGIDQLSAPDQTTLRTVAESQ
                     YVMTRFLAERQQQAVLYVDVGATTTTLIAAAPDQIAATLHGVCGTAFGVGALLSEVGP
                     AAIARWLPFAIEEQELIERLLNRMLRPQTLPATREDCYLDLALAREALALGVAALRDE
                     QTPLAYERLLAGGGVLTHAPHPGMALLALLDGLQPANELPGLLLPIHLDMLSLLSVCG
                     GIAALSTDAAISIFDHDLLNNTPLATCIVLQGGSRIGEPVADVELITVGGDSERVQVR
                     HGELIRLPLSVGRYAQVKVKPAATVRVGQAAPGEAVESDPAEVHGSLLGLIIDARGRP
                     LTLPADGAERRRLLWSWLRAVGAEHSDSPYPEPVISLPEMPAPVVAAPSTAPKPRRSW
                     FKRAPQPAKTSEATLPTTETVPASPDDDIAQLRQQVSKPARRSWFGRRKP"
     misc_feature    complement(321296..322690)
                     /locus_tag="Caur_0251"
                     /note="MutL protein; Region: MutL; pfam13941"
                     /db_xref="CDD:258199"
     gene            complement(322747..323394)
                     /locus_tag="Caur_0252"
                     /db_xref="GeneID:5827881"
     CDS             complement(322747..323394)
                     /locus_tag="Caur_0252"
                     /note="KEGG: rrs:RoseRS_2440 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633894.1"
                     /db_xref="GI:163845850"
                     /db_xref="GeneID:5827881"
                     /translation="MDIAINLIPILLTLLVFSRVLGDTPAFRLVQYLFVGVALGYAFV
                     VIYHQVLRPAVIDVLAAGDQPVLLTLRLTPFFLAALLLTRISGQQTSSWLANLPLALV
                     FGVGAALVVGGAVVGTILPQVLDATRSDLSSPVAILGSIVLLIGSIATLLSFSLTRSS
                     NPNRQRWIDLVASVGRWILLLAFGFFLAGSIVSYLAALNERLLFIIDWIRAIAGM"
     sig_peptide     complement(323326..323394)
                     /locus_tag="Caur_0252"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.737) with cleavage site probability 0.730 at
                     residue 23"
     gene            complement(323394..327809)
                     /locus_tag="Caur_0253"
                     /db_xref="GeneID:5827882"
     CDS             complement(323394..327809)
                     /locus_tag="Caur_0253"
                     /note="KEGG: rca:Rcas_2219 putative FHA domain containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633895.1"
                     /db_xref="GI:163845851"
                     /db_xref="GeneID:5827882"
                     /translation="MSMEHLPPWLRNVPLPPPPTDAADETPAWLRGIDSFTPPAPTPA
                     TDHPPAWLTEPEPASESAAESASVPDWLAELQAEVADPLADTGSAAEWLGGVEAEPPA
                     ERPSTFGATGWLQGLGGETSTGPVTPSEPPPTTSSRLRMPVGPTDWLRSMGHEDEVEP
                     ASAEQSPEPAPPDPNAGVPDWLRELSEEDVSQALASLPPAETTPPVEAKEASEKTPTD
                     WLDELARLASEDDWARAGAANAETVVATDSPDWLSSAQPPPVDPSAPALPAWLQDVAG
                     DEPPAAPGSVRLDLPSWLLEDESSLSPTSPAIAPDAPTLLADSRAVVPGQEGVDLSAP
                     SRLTPAGSEPEASADIPTWLREAEVPAADEWPAAAASEAPAWLQEEGTPAERAGDIPT
                     WLREAEAPAADEWPAAAASEVPAWLQDEAAPAEREGDIPTWLREAEAPTADEWPAAAS
                     EAPAWLQDEAAPAEREGDIPTWLREAEAPAADEWPAAASEAPAWLQDEAAPAEREGDI
                     PAWLREAEAPAADEWPAAAASEAPAWLQDEAAPAEREGDIPTWLREAEAPAADEWPAA
                     AASEAPAWLQDEAAPAEREGDIPTWLREAEAPAADEWPAAASEAPAWLQEEGTPAERA
                     GDIPTWLREAEAPAADEWPATAASEAPAWLQDEAAPAERAGDIPTWLREAEAPAADEW
                     PAAASEAPAWLQEEAAPATGSDVPAWLREEAAPAEREGDIPTWLREAEAPAADEWPAA
                     ASEAPAWLQEEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLRE
                     EAAPAAGSDVPAWLREEAAPAAGSDVPAWLQEEAAPAAGSDVPAWLREEAAPAAGSDV
                     PAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAP
                     AAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWL
                     REEAAPAAGSDVPAWLREEAAPAAGGDVPAWLREEAAPAAGSDVPVWLQEESAPAAGS
                     DVPDWLQQASTAPVDTPDWLTADVSAEAISWLQSAPAENAPIAEPSLTTSSTSDEFFS
                     GAELPPWLRASTERAVEPAITPLSDWLERLRHREAEEEEEVVAGPDVVVVKPPPPAPA
                     QRTDDQIAAAALLERLLQSPLPAILPVERPVIVRRRLPTLEQWLAVVLLIAVLIGIAI
                     PGLTATFTNRAQPSPVAVALNEQLAGLSSEDVVLVAYEWGAQRVAELRPLEDVLLTRL
                     TADRTKLIIVSTDLQGSLLAFDVIGPLRSAGYNNENGVIFGGRDYVLLGYRPGGELAL
                     RSMAIDLRAELRRDYTGQDATAGLLATRSDGTPRIQSLRDLAMIVVMADQVQDVQAWM
                     EQIHSAAPQVPIAFLLPQEVYPQVLPYTRLPNVYAVAGQRGASDLLAAGKADNLATPE
                     LSYQTWATIAFVGVLLLGAFIVGIGQLRRLARGRG"
     misc_feature    complement(327015..>327452)
                     /locus_tag="Caur_0253"
                     /note="Potato leaf roll virus readthrough protein; Region:
                     PLRV_ORF5; pfam01690"
                     /db_xref="CDD:250799"
     misc_feature    complement(324636..>325910)
                     /locus_tag="Caur_0253"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     gene            complement(327833..328501)
                     /locus_tag="Caur_0254"
                     /db_xref="GeneID:5827883"
     CDS             complement(327833..328501)
                     /locus_tag="Caur_0254"
                     /note="KEGG: rca:Rcas_2220 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633896.1"
                     /db_xref="GI:163845852"
                     /db_xref="GeneID:5827883"
                     /translation="MSSPLRNPRQLITVLIAGVSGLIVLLDFVGAGPAVSTIAVVLVR
                     WAALITAIAVAIGVLSVFFVHLRRARSRSAEAGYSLVLLAGMIVVIVAGIFYPTRTAT
                     GLSLPTTLADPPIRTVFRLIYEPLAASLLALLSFFALSAMLRAMRSGRIEAVFVVAVA
                     LIALIIQLPPLTLVPIIGQTVQWVNDYLVAAGARGLLLGSAIGALVAGVRLLIGFDMP
                     YADR"
     gene            complement(328506..329300)
                     /locus_tag="Caur_0255"
                     /db_xref="GeneID:5824862"
     CDS             complement(328506..329300)
                     /locus_tag="Caur_0255"
                     /note="KEGG: rrs:RoseRS_2443 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633897.1"
                     /db_xref="GI:163845853"
                     /db_xref="GeneID:5824862"
                     /translation="MTLPAIFLIVTLIFVVALVWLHHARALSGRLPERRSLPALDMLR
                     SALARSAETGRPVHLSPGASTIGAGEGQRASTAELLAGLSMIGQAASQAAAGGAAIEV
                     SSADAVAHLALRGVVRQAYQTLGQSQSFDPRQIELWAHADAMAYATAVAAHYRQAQLE
                     ASVLSGAFGQEVLLAAETGAQRAIPQVLGSTHPSALGLMIITTPHVLAGEELYAAEAH
                     LTTAPAPQARLLTHDTLRTIVIWLMLIAFGYGLIRVAFGWPALPGW"
     gene            complement(329432..329617)
                     /locus_tag="Caur_0256"
                     /db_xref="GeneID:5824863"
     CDS             complement(329432..329617)
                     /locus_tag="Caur_0256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633898.1"
                     /db_xref="GI:163845854"
                     /db_xref="GeneID:5824863"
                     /translation="MPVAMLLHIAAPFDVVCSQIVQAFVPLLHGTRWAVIADTLTVPD
                     HWPALRDLVQSRLQRED"
     gene            complement(329634..330122)
                     /locus_tag="Caur_0257"
                     /db_xref="GeneID:5824864"
     CDS             complement(329634..330122)
                     /locus_tag="Caur_0257"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633899.1"
                     /db_xref="GI:163845855"
                     /db_xref="GeneID:5824864"
                     /translation="MIRYEIAATTVTTAPPERVLAVLDDFGNWPRWMPSLERVRIELP
                     PNEHPRQGYRFKLHGLLVHADMEVIDYTPLSRATRFRISFPPFQGVNRCRLIPLGDGR
                     YRIERLDQLELPDLVAHLIDSTQRKRFEKLAMEFLQALRREVEQPPHATAASAATTGR
                     SD"
     misc_feature    complement(329685..330113)
                     /locus_tag="Caur_0257"
                     /note="Ligand-binding SRPBCC domain of Streptococcus
                     mutans Smu.440 and related proteins; Region:
                     SRPBCC_Smu440-like; cd08862"
                     /db_xref="CDD:176871"
     misc_feature    complement(order(329703..329705,329712..329720,
                     329724..329732,329736..329750,329784..329786,
                     329790..329792,329796..329798,329802..329804,
                     329838..329840,329844..329846,329850..329855,
                     329877..329879,329883..329885,329919..329921,
                     329925..329927,329946..329948,329952..329954,
                     329958..329960,329964..329966,330006..330008,
                     330051..330056,330060..330068,330093..330095,
                     330099..330101,330105..330107))
                     /locus_tag="Caur_0257"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176871"
     gene            complement(330163..331233)
                     /locus_tag="Caur_0258"
                     /db_xref="GeneID:5824865"
     CDS             complement(330163..331233)
                     /locus_tag="Caur_0258"
                     /EC_number="2.7.1.11"
                     /note="PFAM: phosphofructokinase;
                     KEGG: gme:Gmet_1640 phosphofructokinase, pyrophosphate
                     dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_001633900.1"
                     /db_xref="GI:163845856"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR012829"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR015913"
                     /db_xref="GeneID:5824865"
                     /translation="MASKKQRIGVLTSGGDAPGLNAVIRAVVKSASGLGWEVIGIHDG
                     FEGLLGTKSYRVLTNADVQGLLPRGGTILRTTNKGHFGPRRSDELSEADPYVRAVKAI
                     EEMGLRALITIGGEGTQRIALELHKLGAPVIGVPKTIDNDLAGTDRTFGFDTALQVAT
                     DAIDRLHTTAASHNRVMVLEVMGRHTGWIALHAGLAGGADVILIPEIPFSIERVAEKV
                     MARDQQGSSFSIIVVAEGARPRGGSEMYIAEGRLGGIGHWVGEQLEKLTAKEVRVVVL
                     GHLQRGGSPSPYDRLLSTRYGAAAVQAAARGIYGEMVALRGQDIVTVPLAEACGHLNR
                     VRPHSDLVLCARSLGIAFGDEL"
     misc_feature    complement(330184..331215)
                     /locus_tag="Caur_0258"
                     /note="6-phosphofructokinase; Provisional; Region:
                     PRK03202"
                     /db_xref="CDD:235111"
     misc_feature    complement(order(330391..330393,330400..330402,
                     330529..330531,330682..330690,330808..330810,
                     330814..330816,330820..330822,330871..330876,
                     330880..330888,330979..330981,331099..331101,
                     331189..331191))
                     /locus_tag="Caur_0258"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(330871..330876,330880..330888,
                     330979..330981,331099..331101,331189..331191))
                     /locus_tag="Caur_0258"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(330283..330285,330328..330330,
                     330349..330351,330361..330366,330556..330558,
                     330640..330642,330646..330651,330733..330735,
                     330742..330744,330754..330756,330790..330792,
                     331033..331035,331042..331044,331057..331059,
                     331147..331149,331159..331161))
                     /locus_tag="Caur_0258"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(330550..330558,330562..330564,
                     330634..330636,330640..330642,330733..330735,
                     331042..331047,331054..331059,331147..331149,
                     331159..331161))
                     /locus_tag="Caur_0258"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(330391..330393,330400..330402,
                     330418..330420,330529..330531,330682..330690,
                     330709..330711,330808..330810,330814..330816,
                     330820..330822))
                     /locus_tag="Caur_0258"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            complement(331528..331713)
                     /gene="rpmB"
                     /locus_tag="Caur_0259"
                     /db_xref="GeneID:5824866"
     CDS             complement(331528..331713)
                     /gene="rpmB"
                     /locus_tag="Caur_0259"
                     /note="required for 70S ribosome assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="YP_001633901.1"
                     /db_xref="GI:163845857"
                     /db_xref="InterPro:IPR001383"
                     /db_xref="GeneID:5824866"
                     /translation="MATCELCGKKPSFGHNVSFSKRRTNRIWRPNIQKTTLTVPGGQS
                     VQVRICTRCMRTLAKTR"
     misc_feature    complement(<331537..331713)
                     /gene="rpmB"
                     /locus_tag="Caur_0259"
                     /note="50S ribosomal protein L28; Reviewed; Region: rpmB;
                     PRK00359"
                     /db_xref="CDD:234736"
     gene            331817..332671
                     /locus_tag="Caur_0260"
                     /db_xref="GeneID:5824867"
     CDS             331817..332671
                     /locus_tag="Caur_0260"
                     /note="PFAM: DegV family protein;
                     KEGG: rca:Rcas_0603 DegV family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DegV family protein"
                     /protein_id="YP_001633902.1"
                     /db_xref="GI:163845858"
                     /db_xref="InterPro:IPR003797"
                     /db_xref="GeneID:5824867"
                     /translation="MATMKVITDGASDIPFEVAHELEIEVVPLLARIDDRLYRIGIDI
                     SEDQVYDQLFSGNQRVEIVKPNATTFEQLYRSLLGRYDYVFSIHLSRHLGEIYSEALA
                     GRSRLPASSTRIEIIDSKLAGMGLGSVAIAAARAIRDGMTPAEVNERIGQTIRHTHTA
                     FFVDTMEYLEQSGLLTFSGSLIGSMQRIKPLMILDEGEIVPYERTRTRAKAIEGLFTF
                     VEDFPHVEDVIIHYATTPEDVEKLLEKLDPIFSRDRVQVSRMGPAIAACLGPGAMAVT
                     AFEGFDEA"
     misc_feature    331829..332647
                     /locus_tag="Caur_0260"
                     /note="EDD domain protein, DegV family; Region: DegV;
                     TIGR00762"
                     /db_xref="CDD:213558"
     gene            332668..335286
                     /locus_tag="Caur_0261"
                     /db_xref="GeneID:5824868"
     CDS             332668..335286
                     /locus_tag="Caur_0261"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="YP_001633903.1"
                     /db_xref="GI:163845859"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004609"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:5824868"
                     /translation="MTEAERQQVIALGRLLAAERRDGCADRVTTDGLVAYLNQWSAAA
                     GSAARLPAVQRALGCLVGYDGMTLVERDQALAEAIEILRSLFRTAPTAPVETTVPPSP
                     AVDPTANAGHVPVTKRNTSARQSRKRAANVDQRPLAELNLDAPLEQIAGIDWRLVGGF
                     RRLGVRTIRDLLYHFPRRYDDVRNRRSISELQVGAEETVIGEVTDVRTIGAGPKLRVR
                     VEVSDETGSIEAIFFNQRWIAQQIRVGQTIALSGKVTTFGGKRQFSSPRWERYTPDPD
                     ALLHTGRLVPIHPLTQGLHENQVRRFIKQVVDTMAPQVEDHLPPVRLQHARLLPLGEA
                     LAQIHFPTDHTSLAAARRRLGFDEFLFIQIGVLQRKRLWQQEMGYAFTIDSQVHAELQ
                     RLLPFQLTTAQQRAIEEIFSDLRRPSPMARLLQGDVGSGKTVVAAAALLQAVANGFQG
                     ALMAPTEILAEQHAKNLKQLLSRVRVPRKTTSATASSAYQQADWRSLLDPEEAAQLAE
                     IISILGMSPEEDMGGHGVRVALLTGSLGTRERRRVLEGIARGEIDLVVGTHALITETV
                     QFAQLGLVVVDEQHRFGVEQRLRLKNKGYNPHMLVMTATPIPRTLTMTIYGDLDVSVL
                     DERPPGRQEIRTKRVGRAERAKVYRHIRKQVAEGRQVYVICPLVEESEKLDLPSAEEM
                     YERLQHEVFPDLRVALLHGKLSAREKDDVMRAFRDHQYDILVATAVIEVGIDVPNATT
                     IVIEGAERFGLAQLHQFRGRVGRGHHQSYCILISDSDNQQSKERLAALEQTTDGFKLA
                     EIDLQLRGPGEFFGTRQSGTPDLKMAQQGDTRLLAEARALADAILADDPELKRPEHDL
                     LRRKVNDFWAAATQSG"
     misc_feature    333073..335220
                     /locus_tag="Caur_0261"
                     /note="ATP-dependent DNA helicase RecG; Provisional;
                     Region: PRK10917"
                     /db_xref="CDD:236794"
     misc_feature    333259..333474
                     /locus_tag="Caur_0261"
                     /note="RecG_wedge_OBF: A subfamily of OB folds
                     corresponding to the OB fold found in the N-terminal
                     (wedge) domain of Escherichia coli RecG. RecG is a
                     branched-DNA-specific helicase, which catalyzes the
                     interconversion of a DNA replication fork to a...; Region:
                     RecG_wedge_OBF; cd04488"
                     /db_xref="CDD:239934"
     misc_feature    order(333259..333261,333406..333408,333412..333414,
                     333418..333420)
                     /locus_tag="Caur_0261"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239934"
     misc_feature    order(333292..333294,333313..333315,333364..333366,
                     333376..333378,333454..333456)
                     /locus_tag="Caur_0261"
                     /note="ssDNA binding site; other site"
                     /db_xref="CDD:239934"
     misc_feature    333931..334485
                     /locus_tag="Caur_0261"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    333952..333966
                     /locus_tag="Caur_0261"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    334396..334407
                     /locus_tag="Caur_0261"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    334597..334986
                     /locus_tag="Caur_0261"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(334663..334674,334765..334770,334843..334851)
                     /locus_tag="Caur_0261"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(334867..334869,334933..334935,334945..334947,
                     334954..334956)
                     /locus_tag="Caur_0261"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            335304..336581
                     /locus_tag="Caur_0262"
                     /db_xref="GeneID:5824869"
     CDS             335304..336581
                     /locus_tag="Caur_0262"
                     /note="PFAM: biotin/lipoyl attachment domain-containing
                     protein; catalytic domain of components of various
                     dehydrogenase complexes; E3 binding domain protein;
                     KEGG: rrs:RoseRS_1675 catalytic domain of components of
                     various dehydrogenase complexes"
                     /codon_start=1
                     /transl_table=11
                     /product="E3 binding domain-containing protein"
                     /protein_id="YP_001633904.1"
                     /db_xref="GI:163845860"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="GeneID:5824869"
                     /translation="MQVHTISIPPALGEATLLEWLVAVGESVTPTTPLARVLTAHAEW
                     VIPAQYVGIVAEHVVAAGATIPVGGELARCTPPPRVRATPLARRLATALGVDLTALAG
                     SGPGGRIMRADVVKAVDVASGSSDSLPPPAVVGDTVHARAVADATVGTIVSSTTELRI
                     VDAQPVPLAGATVAAVDVASDLSDSLPPPAVVGDTVHARAVADATVGTNTSSTIRLRI
                     VDAQPVPLASATIAIDLQSVLHQCRVQNATFARYGLQATPQSALIAAAAGLFPEHPLI
                     NAAWTETAIVLRHRYHVAAGLTDGRWVLIRDAGDLNERGIARALTGTGHDLGMATCAI
                     AVTADWWQITPPLPGTVAALTLSEAQLKPVALGDTTIAVGAVAHLSLCYDARVLDHPT
                     AMAFLNALCRRLGVRPLAEPQEDEVGLVSSGIA"
     misc_feature    335331..336515
                     /locus_tag="Caur_0262"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Reviewed; Region: PRK11856"
                     /db_xref="CDD:237001"
     misc_feature    335331..335522
                     /locus_tag="Caur_0262"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(335394..335396,335415..335432,335442..335444)
                     /locus_tag="Caur_0262"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    335424..335426
                     /locus_tag="Caur_0262"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    335535..335651
                     /locus_tag="Caur_0262"
                     /note="e3 binding domain; Region: E3_binding; pfam02817"
                     /db_xref="CDD:251550"
     misc_feature    335973..336515
                     /locus_tag="Caur_0262"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            complement(336935..337735)
                     /locus_tag="Caur_0263"
                     /db_xref="GeneID:5824870"
     CDS             complement(336935..337735)
                     /locus_tag="Caur_0263"
                     /note="KEGG: rrs:RoseRS_4154 phosphate ABC transporter,
                     ATPase subunit;
                     TIGRFAM: phosphate ABC transporter, ATPase subunit;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATPase"
                     /protein_id="YP_001633905.1"
                     /db_xref="GI:163845861"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005670"
                     /db_xref="GeneID:5824870"
                     /translation="MTVHDLDHNNPNALEARNMSVYYGSFRAVKNVNLAIEKNRITAL
                     IGPSGCGKSTVLRSFNRMNDLVPSARVEGEILFHGENIYAPGVDPVNVRRRIGMVFQK
                     PNPFPKSIYENVAYGPRINGWRLSKREMDELVERSLRGAALWDEVKDKLNQNGLSLSG
                     GQQQRLCIARALAVEPEVILMDEPCSALDPISTLKIEELMFELRQRYTIVIVTHNMQQ
                     ASRASDYTAFFLMDSDRAGQLIEYGPTSQIFQNPKDERTEQYISGRFG"
     misc_feature    complement(336938..337717)
                     /locus_tag="Caur_0263"
                     /note="ABC-type phosphate transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: PstB; COG1117"
                     /db_xref="CDD:224042"
     misc_feature    complement(336992..337696)
                     /locus_tag="Caur_0263"
                     /note="ATP-binding cassette domain of the phosphate
                     transport system; Region: ABC_PstB_phosphate_transporter;
                     cd03260"
                     /db_xref="CDD:213227"
     misc_feature    complement(337577..337600)
                     /locus_tag="Caur_0263"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(order(337094..337096,337187..337192,
                     337433..337435,337574..337582,337586..337591))
                     /locus_tag="Caur_0263"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(337433..337444)
                     /locus_tag="Caur_0263"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(337235..337264)
                     /locus_tag="Caur_0263"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(337187..337204)
                     /locus_tag="Caur_0263"
                     /note="Walker B; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(337169..337180)
                     /locus_tag="Caur_0263"
                     /note="D-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(337088..337108)
                     /locus_tag="Caur_0263"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213227"
     gene            complement(337755..338690)
                     /locus_tag="Caur_0264"
                     /db_xref="GeneID:5824871"
     CDS             complement(337755..338690)
                     /locus_tag="Caur_0264"
                     /note="TIGRFAM: phosphate ABC transporter, inner membrane
                     subunit PstA;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: sru:SRU_2295 phosphate ABC transporter, permease
                     protein PstA"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="YP_001633906.1"
                     /db_xref="GI:163845862"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR005672"
                     /db_xref="GeneID:5824871"
                     /translation="MSAQEQIRVSAQTAEPIVDRGGGNLKWRHFKGTLLTIFGWLSII
                     FGLGVLLILILDVINRATGIFSGGTNWLTWDFFNNFDSRFPQRAGAKAAIVGTLYTIS
                     LTILFAFPLGVAAAIYLEEYARDNWFSRLVEINISNLAAVPSIIYGLLGLQVFARWLL
                     LGRSILTGALTLALLVVPIIIVASRESIRAVPLSLRQASYALGATRWQTVWHVVLPQS
                     IGGILTGSILAVSRAIGETAPLITIGALTFVPFLPRNILDIFTVLPIQIFNWTSRPQD
                     EFRALAAAGILVLLTILLTINALAIYLRNRYQKRY"
     misc_feature    complement(337758..338615)
                     /locus_tag="Caur_0264"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstA; COG0581"
                     /db_xref="CDD:223654"
     misc_feature    complement(337956..338411)
                     /locus_tag="Caur_0264"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(337965..337970,337977..337988,
                     338007..338009,338016..338021,338061..338063,
                     338112..338114,338121..338126,338136..338138,
                     338142..338147,338154..338156,338160..338162,
                     338166..338171,338235..338237,338241..338246,
                     338253..338276,338289..338294,338298..338309,
                     338331..338333,338346..338351,338358..338363))
                     /locus_tag="Caur_0264"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(337971..337988,338235..338276,
                     338289..338291))
                     /locus_tag="Caur_0264"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(337968..337970,338184..338186,
                     338235..338237))
                     /locus_tag="Caur_0264"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(338040..338042,338052..338057,
                     338073..338111))
                     /locus_tag="Caur_0264"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(338690..339604)
                     /locus_tag="Caur_0265"
                     /db_xref="GeneID:5824872"
     CDS             complement(338690..339604)
                     /locus_tag="Caur_0265"
                     /note="TIGRFAM: phosphate ABC transporter, inner membrane
                     subunit PstC;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: syf:Synpcc7942_2443 phosphate ABC transporter,
                     permease protein PstC"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="YP_001633907.1"
                     /db_xref="GI:163845863"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR011864"
                     /db_xref="GeneID:5824872"
                     /translation="MAVFDLRRQPNQARAIGEKIIQILLTIAATVSILTTAGIVFSLL
                     FETIAFFREVSIVEFLTETEWTPLFSIKKYGIWPLVSATVLTSAIAMVVAVPLGLIAA
                     IFLSEFASDRIRRTVKPLLEILAGIPTVVYGYFALTVVTPFLKNFIPTLSIFNSLGAG
                     LVMGVMLIPFVASLSEDALSAVPNSLREAAYGLGSTRFEVATRVVAPAAISGIVASIV
                     LAFSRAVGETMIVAIAAGQNPRFTFDPTVPVMTMTSYIVQVSLGDTPYGSLSYYTLYA
                     VGFTLFLFTFVLNIFSYWMVRKFREVYD"
     misc_feature    complement(338696..339604)
                     /locus_tag="Caur_0265"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstC; COG0573"
                     /db_xref="CDD:223646"
     misc_feature    complement(338888..339358)
                     /locus_tag="Caur_0265"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(338906..338911,338918..338929,
                     338948..338950,338957..338962,339002..339004,
                     339053..339055,339062..339067,339077..339079,
                     339083..339088,339095..339097,339101..339103,
                     339107..339112,339194..339196,339200..339205,
                     339212..339241,339245..339256,339287..339289,
                     339302..339307,339314..339319))
                     /locus_tag="Caur_0265"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(338912..338929,339194..339238))
                     /locus_tag="Caur_0265"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(338909..338911,339125..339127,
                     339194..339196))
                     /locus_tag="Caur_0265"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(338981..338983,338993..338998,
                     339014..339052))
                     /locus_tag="Caur_0265"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(339712..341760)
                     /locus_tag="Caur_0266"
                     /db_xref="GeneID:5824873"
     CDS             complement(339712..341760)
                     /locus_tag="Caur_0266"
                     /note="TIGRFAM: phosphate binding protein;
                     PFAM: extracellular solute-binding protein family 1;
                     KEGG: rrs:RoseRS_4157 phosphate binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate binding protein"
                     /protein_id="YP_001633908.1"
                     /db_xref="GI:163845864"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="InterPro:IPR011862"
                     /db_xref="GeneID:5824873"
                     /translation="MVGNPKRWIYGLMLIALIVPVIAACGPQPAAQPTAAPAQPTAAS
                     AQPTAPASELASLSGDIIIDGSSTVYPPTAAAAEEFSRLAPNVRVSVGISGTGGGFKK
                     FCNGETDISNASRPIREEEQAICAQNGIEFIELPVAYDGLSVVVNPQNDWVTCLTVAE
                     LKKIWEPAAQGVITNWNQVREGFPNRPLVLLGAGTDSGTFDYFTEAIVGEAKASRGDY
                     QATEDDNVTITGVSGDLNAMGYLGYAYVVENQGKIKPIAIDNGNGCVEPSFETIADAS
                     YQPLSRPLFIYVNKEAAERPEVQAFVNFYLSPEFTPIIQTPQVGYVKLSDELYAAIAK
                     RFNDRVLGTMVRPGEEVGLTLDRYLTGEMPPLPSSAPTFDYATLSGDIIIDGSSTVYP
                     PTAAAAEEFSRLASNVRVSVGISGTGGGFKKFCNGETDISNASRPIREEEQAICAQNG
                     IEFIELPVAYDGLSVVVNPQNDWATCLTVAELKKIWEPAAQGVITNWNQVREGFPDRP
                     LVLLGAGTDSGTFDYFTEAIVGEAKASRGDYQATEDDNVTITGVSGDLNAMGYLGYAY
                     VVENQGKIKPIAVDNGNGCVEPSFETIADATYQPLSRPLFIYVNKEAAERPEVQAFVN
                     FYLSPEFTPIIQTPQVGYVKLSDELYAAIAKRFNDRVVGTLVKPGEEVGLTLDRYLGK
                     "
     sig_peptide     complement(341665..341760)
                     /locus_tag="Caur_0266"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.912) with cleavage site probability 0.669 at
                     residue 32"
     misc_feature    complement(340789..341748)
                     /locus_tag="Caur_0266"
                     /note="phosphate binding protein; Region: ptsS_2;
                     TIGR02136"
                     /db_xref="CDD:233743"
     misc_feature    complement(339826..340683)
                     /locus_tag="Caur_0266"
                     /note="phosphate binding protein; Region: ptsS_2;
                     TIGR02136"
                     /db_xref="CDD:233743"
     gene            complement(343090..345027)
                     /locus_tag="Caur_0267"
                     /db_xref="GeneID:5824874"
     CDS             complement(343090..345027)
                     /locus_tag="Caur_0267"
                     /note="KEGG: rrs:RoseRS_2393 polymorphic outer membrane
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polymorphic outer membrane protein"
                     /protein_id="YP_001633909.1"
                     /db_xref="GI:163845865"
                     /db_xref="InterPro:IPR003368"
                     /db_xref="GeneID:5824874"
                     /translation="MNLHRWLHLASLLFAMVGFLWPSIPVQAAPKVVGTGTPASCTAT
                     ALVNAVTGGGEVSFNCGPNSHTIVLNSPLIINAPQTLIDGGGLITLQGGGGRIIDHFT
                     YGNIGPSRLELRNLTITGGRASGGGTDQSAVDGSGGAIRSYFAAANSAFTPTLVIDRV
                     IFRDNQTTLTAVPPGRDAYDYGGGAIYSRGGAVIVTNSRFENNHANNGAGGAIHLLQS
                     SLSVEDSVFLGNTAIGARPQDSFGGAISADGLGGPDRRLRVVRCRFEQNQTYNSGGAI
                     HANLYEDSSRLEVIDSSFIANAVVGGQRAQGGAIGGGGTAIGTGTGNPEILISGSLFH
                     ANRARRTPGADGNPREDGSGGAIAFPQQVRLRIVNSTFVANRAEGTGFNANGGALYVL
                     NNRPEPFVIESSTFAENYAGWVGGAISHSGNGSVSNSLFAYNTAGNGGNGWNIQQHCS
                     RELTHDGRSLQYPPRLTGASFWNDVTCFAGKSAPSQTGDIQFRDPLLKPLAAYGGLTM
                     TMAIPADSPARDAGSGCPPTDQRGVARPQLNACDLGAFELQVFLVATPSLLARNQLPP
                     PLILHGVDFSNATQAFIDGQPRSTTFLDSQRLRLTLTMTDVADLGPLTVTLSGPGSAV
                     GSTQVQVVEAVYSIYVPQISR"
     sig_peptide     complement(344941..345027)
                     /locus_tag="Caur_0267"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 29"
     misc_feature    complement(<344191..344622)
                     /locus_tag="Caur_0267"
                     /note="adhesin; Provisional; Region: PRK09752"
                     /db_xref="CDD:182059"
     misc_feature    complement(<343378..>344058)
                     /locus_tag="Caur_0267"
                     /note="Acinetobacter rhombotarget A; Region: GlyGly_RbtA;
                     TIGR04212"
                     /db_xref="CDD:234502"
     gene            complement(345099..347018)
                     /locus_tag="Caur_0268"
                     /db_xref="GeneID:5824875"
     CDS             complement(345099..347018)
                     /locus_tag="Caur_0268"
                     /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
                     KEGG: rrs:RoseRS_2175 N-acetylmuramoyl-L-alanine amidase,
                     family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="YP_001633910.1"
                     /db_xref="GI:163845866"
                     /db_xref="InterPro:IPR002502"
                     /db_xref="GeneID:5824875"
                     /translation="MPDFPTEGSPPFINRMLTIAEWREYVASYDFGKLTPTRLVLHHT
                     YRPDETSWRGLTTMRGIQKFYAGKGWTAGPHIFAAPDGIWLATPMSQIGIHAGAGNGS
                     LAKGWYSIGLEMVGYFDKVLPSGKVWEHSLAVMGELSRRLKIPPRQLISFHRDYTNQK
                     SCPGWAVTKEWVWSQVEAYLNNSTPPTIPPGQIGTPTPDDERLIEALLEEGYKHKTNG
                     QGYNADWAFHAYALEHQLGMPMGPSARLTVAGKEYNYQPFARDTLYCEVPNWGDVKTL
                     SELLGGSIPPSGLGRALLDATYQAGGSPFRPDWAFHQYAVARRLGPPVGKSAQITVDG
                     KQYAYQAFAVDTLYNLVPNWSDVRQLSQIGTATDPATVRLRDALLTETFKQAGTTYRP
                     DWAFHQLARQWAIGAPLANSYQITLEKTTYALQPFALDVLYNVVPNWADVKRLSDLAR
                     QHGMPVLGMAMAIAPLVSAESLTPPDDGGFSITQVTPPAMAFGERHGERVSMVVLHAV
                     PGAVAETIAAMTDFNARFATHYLIGLDGRIYRLIDEAKAAWHAGFATGGGVRYNLNRI
                     SIGIALERPAGWPATRDAGDTDAQIRALRWLLRQLDARYRLSPDAIVLWTSLAGSDDE
                     ALSGLPLGALREALS"
     misc_feature    complement(346521..346913)
                     /locus_tag="Caur_0268"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     misc_feature    complement(order(346533..346535,346539..346541,
                     346560..346562,346797..346799,346893..346895))
                     /locus_tag="Caur_0268"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    complement(order(346533..346535,346560..346562,
                     346893..346895))
                     /locus_tag="Caur_0268"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    complement(order(346533..346541,346548..346550,
                     346560..346562,346716..346718,346734..346739,
                     346758..346760,346797..346799,346809..346811,
                     346887..346892))
                     /locus_tag="Caur_0268"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     misc_feature    complement(<346332..346532)
                     /locus_tag="Caur_0268"
                     /note="MobA/MobL family; Region: MobA_MobL; pfam03389"
                     /db_xref="CDD:251918"
     misc_feature    complement(345189..345524)
                     /locus_tag="Caur_0268"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     gene            complement(347037..347996)
                     /locus_tag="Caur_0269"
                     /db_xref="GeneID:5824876"
     CDS             complement(347037..347996)
                     /locus_tag="Caur_0269"
                     /note="PFAM: Integral membrane protein TerC;
                     KEGG: gvi:glr4409 putative transmembrane transport
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein TerC"
                     /protein_id="YP_001633911.1"
                     /db_xref="GI:163845867"
                     /db_xref="InterPro:IPR005496"
                     /db_xref="GeneID:5824876"
                     /translation="MDITLWAWIGFHAIVFLVLALDLGVFHRRSHKVSIREAGLWTLV
                     WVTLSLIFNGIIWLWRGPEDGLNFLTGYLVEYSLSVDNIFVFILLFSYFRVPAQYQHR
                     VLFWGILGALIMRGTMILLGSALIEQFEWILYLFGAFLLVTGVRLIFHDDEPEVDPQR
                     NLLVRLARRLLPITPDMRGDRFFVREADRFSATPLFLVLLIVESTDLLFAVDSIPAIF
                     GITHDPFIVYTSNICAILGLRSLYFLLAGVMESFYYLRFGLAIILSFIGVKMLTPLVT
                     GWFLGGHSVHIPTTISLGVIVVTLLASVVASLIRSRRLASATD"
     misc_feature    complement(347058..347987)
                     /locus_tag="Caur_0269"
                     /note="integral membrane protein, TerC family; Region:
                     R_switched_Alx; TIGR03718"
                     /db_xref="CDD:234327"
     gene            complement(348026..350029)
                     /locus_tag="Caur_0270"
                     /db_xref="GeneID:5828027"
     CDS             complement(348026..350029)
                     /locus_tag="Caur_0270"
                     /note="PFAM: GAF domain protein; ATP-binding region ATPase
                     domain protein; histidine kinase
                     dimerisation/phosphoacceptor;
                     KEGG: rca:Rcas_4451 signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF domain-containing protein"
                     /protein_id="YP_001633912.1"
                     /db_xref="GI:163845868"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011495"
                     /db_xref="GeneID:5828027"
                     /translation="MKDATVRSMYEVLTSQPPDLVGVLRETIPSIGMLIDALEQQSDP
                     TLRLSLLRQIGAEWYACGGMAEVLTELGLHLAARLPMAQGIVVSELLLAFGAAQEEQR
                     TREWEARLVARATQLDGLHRIISAANSTLDLDTSLQTVVETVAQVMNVEACSIYLYDK
                     HRDDLVLRATHGLNRAAIGQVVARLGEGVTGWAAQLGYPVAVSDVYKDPRYHREPQLG
                     EEMFRSMLAVPIVLFSAERFQFSADKLQGVINVQTIAPREFTQEEISFVETAAGELAF
                     FIANAQLYQQTDERLHQKLRELTTLQQVSKLIAEQIGLHDVLNLIVEKAVHLSKVDRA
                     AIFQMGEDGQLKLVASYGGEGDGVRDLVIQTVRDGRPLAVMNAYQDARFPQLPAVARA
                     ENFHSLFCMPLRARGRTIGGICLYRREPHLFDYEQVRLLNTFADEAAIAIENARLYEE
                     SLRALRIKSALLQEMHHRVRNNLQTIAALLSMQLRRLDPASPGAKALRESAARIQAIA
                     AIHNLLSRDDIGVTTVGAVARQVIESVQSTLFESDIRVDFAILGDEVRIGSRDATVLA
                     LVINELVDNALTHGLAVEGGRIEVEAVLEHGQVLVELRDDGPRHPPPPSRHSSGLGLQ
                     IIETLVNSDLNGSFSLIRDEEAGWMRARIRFPQRIIDEDRIEV"
     misc_feature    complement(349172..349636)
                     /locus_tag="Caur_0270"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    complement(348665..349144)
                     /locus_tag="Caur_0270"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(348062..348694)
                     /locus_tag="Caur_0270"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG3920"
                     /db_xref="CDD:226434"
     misc_feature    complement(348416..348640)
                     /locus_tag="Caur_0270"
                     /note="Histidine kinase; Region: HisKA_2; pfam07568"
                     /db_xref="CDD:203685"
     misc_feature    complement(348065..348337)
                     /locus_tag="Caur_0270"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(348071..348073,348077..348079,
                     348089..348091,348104..348106,348110..348112,
                     348161..348172,348209..348211,348215..348217,
                     348221..348223,348296..348298,348305..348307,
                     348317..348319))
                     /locus_tag="Caur_0270"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(348305..348307)
                     /locus_tag="Caur_0270"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(348164..348166,348170..348172,
                     348209..348211))
                     /locus_tag="Caur_0270"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(350256..351056)
                     /locus_tag="Caur_0271"
                     /db_xref="GeneID:5828028"
     CDS             complement(350256..351056)
                     /locus_tag="Caur_0271"
                     /note="PFAM: ABC-2 type transporter;
                     KEGG: rca:Rcas_0420 ABC-2 type transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_001633913.1"
                     /db_xref="GI:163845869"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="GeneID:5828028"
                     /translation="MIMLRWEPIKVIIAKEWLELRRSRGLLLSMLLPPIFLPLFALGL
                     IFVMGLVSDPDTADIPAAAVDPALANLGLEALAQVIFGRQFSTLFLLLPMIIPNVLAS
                     YSIVGEKNRRTLEPLLAAPIKVSELLLGKVLAAIIPGIVLTWGCAIVFAVGLAIVVVD
                     PQVPALVLQPGWVATLLLSSPLLAIISVALTVMISSRVNDPRSAQQIAGVLIVPVMLL
                     FFGQMLGLFVLNVVVALIFALVLALIAAGLIWLATNVFQREEILTRWR"
     misc_feature    complement(350274..351026)
                     /locus_tag="Caur_0271"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_2; pfam12679"
                     /db_xref="CDD:257216"
     misc_feature    complement(350337..>350804)
                     /locus_tag="Caur_0271"
                     /note="ABC-type Na+ efflux pump, permease component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatB; COG1668"
                     /db_xref="CDD:224582"
     gene            complement(351341..352273)
                     /locus_tag="Caur_0272"
                     /db_xref="GeneID:5828029"
     CDS             complement(351341..352273)
                     /locus_tag="Caur_0272"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: rrs:RoseRS_4617 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001633914.1"
                     /db_xref="GI:163845870"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5828029"
                     /translation="MNAIECYQLSRRFQTITAVDNLDLVVPAGTIFGFLGPNGAGKTT
                     TVRMLCALIAPSSGSARVAGFDVQTEADSVRANTGILTETPALYDTLSALENLTFFAR
                     LYGLSATQASERAAHYLRLFELWERRNDPVGGFSKGMRQKLAIARALLHDPAVLFLDE
                     PTSGLDPAASRSVRDVIKSLRASGRTIFLTTHNLAEADELCDLIGVFRTRLISLDTPA
                     NLRTRLFGRSVRVVLAGPAAPLAPLVQQLSFVMNVTVDDERTLLVQLTDPEKDNPVLV
                     RALVAAGADVCYIEPFTPSLEAVYLELIQEPVAG"
     misc_feature    complement(351356..352273)
                     /locus_tag="Caur_0272"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(351611..352264)
                     /locus_tag="Caur_0272"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(352145..352168)
                     /locus_tag="Caur_0272"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(351698..351700,351794..351799,
                     352025..352027,352142..352150,352154..352159))
                     /locus_tag="Caur_0272"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(352025..352036)
                     /locus_tag="Caur_0272"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(351842..351871)
                     /locus_tag="Caur_0272"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(351794..351811)
                     /locus_tag="Caur_0272"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(351776..351787)
                     /locus_tag="Caur_0272"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(351692..351712)
                     /locus_tag="Caur_0272"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            352841..353362
                     /locus_tag="Caur_0273"
                     /db_xref="GeneID:5828030"
     CDS             352841..353362
                     /locus_tag="Caur_0273"
                     /EC_number="2.4.2.7"
                     /note="catalyzes a salvage reaction resulting in the
                     formation of AMP which is metabolically less costly than a
                     de novo synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="YP_001633915.1"
                     /db_xref="GI:163845871"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR002375"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="GeneID:5828030"
                     /translation="MTRQDLASLIRNIPDFPIPGIQFKDITTLIGNGQAFSEVIDRLH
                     ERYQNQQIDAVVGIESRGFIFSAPLAYRLGVGLVPIRKPGKLPAATYQIEYQLEYGTN
                     RLEIHRDAFQPGARVLVIDDLLATGGTIAAACDLIEMAGGQVAELAFVIELTFLNGRE
                     RLRERPVFSLIQF"
     misc_feature    352955..353353
                     /locus_tag="Caur_0273"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(353015..353017,353021..353023,353201..353209,
                     353213..353227,353297..353299)
                     /locus_tag="Caur_0273"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            354152..355486
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /db_xref="GeneID:5828031"
     CDS             354152..355486
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="YP_001633916.1"
                     /db_xref="GI:163845872"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004665"
                     /db_xref="InterPro:IPR011112"
                     /db_xref="InterPro:IPR011113"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="GeneID:5828031"
                     /translation="MTVAELETKTLADLREMARKLDISGISSLKKRELIDKLIQAQTA
                     TQTQTITVTEPPALPDLNPIETTTVDRTSIEFSTIYSDGILDIMAEGFGFLRGNRMLP
                     SPEDVYVSQSQIRRFALRSGDRIWGQIRPPKESERYYSLLRVEKINDQDPETARKRPF
                     FDQLTPIFPNEQIKLETEPNLLHTRLVDLIAPIGRGQRGLIVSPPKAGKTMLLKAIAN
                     GITTNYPDIILMVLLIGERPEEVTDMRRSVRGEVISSTFDEPVENHTKVAEMTLERAK
                     RLVEIGHDVVILMDSITRLARAYNVAMPPSGRTLSGGIDPVALYPPKRFFGAARNIEN
                     GGSLTIIATCLIDTGSRMDDVIYEEFKGTGNMELHLDRKLAEKRIFPAIDIQRSGTRR
                     EDLLLSPDTLRQVWTLRRMVSMLGENEGTELMLTRMAKTKSNAEFLQTLSKS"
     misc_feature    354152..355480
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="transcription termination factor Rho; Provisional;
                     Region: rho; PRK09376"
                     /db_xref="CDD:236490"
     misc_feature    354164..>354265
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="Rho termination factor, N-terminal domain; Region:
                     Rho_N; pfam07498"
                     /db_xref="CDD:254238"
     misc_feature    354392..354589
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="Rho_CSD: Rho protein cold-shock domain (CSD). Rho
                     protein is a transcription termination factor in most
                     bacteria. In bacteria, there are two distinct mechanisms
                     for mRNA transcription termination. In intrinsic
                     termination, RNA polymerase and nascent mRNA...; Region:
                     Rho_CSD; cd04459"
                     /db_xref="CDD:239906"
     misc_feature    order(354407..354409,354413..354415,354425..354427,
                     354431..354433,354437..354439,354467..354469,
                     354473..354475,354548..354550,354557..354565)
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239906"
     misc_feature    354695..355438
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="Transcription termination factor rho is a bacterial
                     ATP-dependent RNA/DNA helicase. It is a homohexamer. Each
                     monomer consists of an N-terminal domain of the OB fold,
                     which is responsible for binding to cysteine rich
                     nucleotides. This alignment is of the...; Region:
                     rho_factor; cd01128"
                     /db_xref="CDD:238548"
     misc_feature    order(354743..354745,355076..355078,355109..355111,
                     355118..355123,355130..355132,355139..355141,
                     355148..355150,355223..355228,355232..355246,
                     355250..355252,355322..355327,355367..355369,
                     355379..355381)
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238548"
     misc_feature    354758..354781
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238548"
     misc_feature    order(354767..354769,354773..354784,355289..355291)
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238548"
     misc_feature    355007..355021
                     /gene="rho"
                     /locus_tag="Caur_0274"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238548"
     STS             355527..356762
                     /standard_name="D1S3696"
                     /db_xref="UniSTS:474274"
     gene            355566..356513
                     /locus_tag="Caur_0275"
                     /db_xref="GeneID:5828032"
     CDS             355566..356513
                     /locus_tag="Caur_0275"
                     /note="PFAM: protein of unknown function DUF124;
                     KEGG: rca:Rcas_3709 protein of unknown function DUF124"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633917.1"
                     /db_xref="GI:163845873"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="GeneID:5828032"
                     /translation="MNCPQCGAPVAPNARFCTNCGARLTPAAAAPSSFIPPSGESVSM
                     ADVYDNRPGERLDLPEPTIVGTGVGASGLRYKIIGTTMQAVVLEVPAGQTIFSERGGM
                     SWMSANVQMQTNMEGGLGGAFKRMFSGESIFMVNFTPQGGPGIIGFSAELPGKIVPLN
                     LAPGQTMICQKDSFMCAERSVSLDIHFRRKLGAGFFGGEGFIMQKLTGPGLAFVELDG
                     EVVEYTLEANQMLKVDTGHVAMYEPTINFDVEMVRGFKNILFGGEGLFLTTLRGPGRV
                     WLQTMPAMNLAKKLAQYMPTTSSSSGSGGINLGNLFTND"
     misc_feature    355566..355637
                     /locus_tag="Caur_0275"
                     /note="zinc-ribbon domain; Region: zf-ribbon_3; pfam13248"
                     /db_xref="CDD:257604"
     misc_feature    355572..>355646
                     /locus_tag="Caur_0275"
                     /note="Double zinc ribbon; Region: DZR; pfam12773"
                     /db_xref="CDD:257289"
     misc_feature    355788..356411
                     /locus_tag="Caur_0275"
                     /note="Mitochondrial biogenesis AIM24; Region: AIM24;
                     pfam01987"
                     /db_xref="CDD:251018"
     gene            complement(358297..358665)
                     /locus_tag="Caur_0276"
                     /db_xref="GeneID:5828033"
     CDS             complement(358297..358665)
                     /locus_tag="Caur_0276"
                     /note="PFAM: Roadblock/LC7 family protein;
                     KEGG: rrs:RoseRS_0746 roadblock/LC7 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="roadblock/LC7 family protein"
                     /protein_id="YP_001633918.1"
                     /db_xref="GI:163845874"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="GeneID:5828033"
                     /translation="MASRTEEMVRHLKALSMNTPDIEASAVVSVDGLIMASALPADVE
                     EDRVSAMSAAMLSLGERIASELRRGQLDQVFVRGEDGYVILMAIGEEAVLTALAQSRA
                     KLGLVFLDMRRTANELVNLV"
     misc_feature    complement(358312..358650)
                     /locus_tag="Caur_0276"
                     /note="Roadblock/LC7 domain; Region: Robl_LC7; cl00886"
                     /db_xref="CDD:260680"
     gene            complement(359276..360508)
                     /locus_tag="Caur_0277"
                     /db_xref="GeneID:5828034"
     CDS             complement(359276..360508)
                     /locus_tag="Caur_0277"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: rrs:RoseRS_0747 extracellular solute-binding
                     protein, family 1"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_001633919.1"
                     /db_xref="GI:163845875"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:5828034"
                     /translation="MLTACSVLPSTAPVRTSERVVLRLWHAWPAADSRVLQSLVDQFN
                     QTHPESQIVIQSRPAVSLPSDVATTISEGGGPHLVIVQSHMLGMLVQAGVLRSLDDML
                     SNSEVNSLLPAAVGAAQVSVSGQPVLFGVPITFDTLALYYNRANVLQPPSSTEEMLLT
                     ARALTNRNQTPPVWGLAYNLSLDRTIGYLYAFGGRVFDENGAVVLGSSGRAGTERWLT
                     WLSQLYRDEQLLATLDGVLVDRALQAREAIMTIDWAHAQAEYRAIWNDQLGVTPLPVL
                     SAEDRVPQPYVQADVIALNARLDNQAEQAAAQAFIRFMIDVNSQRALLAAGRQPTQLA
                     LQLSDNDLADSVQLAAARAFRLQAQNGLPMPADRVAHEIVWTTLVEMQLNAVRGLLTP
                     EQAVTLADEFLRSRLASP"
     misc_feature    complement(359288..360505)
                     /locus_tag="Caur_0277"
                     /note="Maltose-binding periplasmic proteins/domains
                     [Carbohydrate transport and metabolism]; Region: MalE;
                     COG2182"
                     /db_xref="CDD:225093"
     misc_feature    complement(359648..360418)
                     /locus_tag="Caur_0277"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            360997..362346
                     /locus_tag="Caur_0278"
                     /pseudo
                     /db_xref="GeneID:5828035"
     gene            363255..363833
                     /locus_tag="Caur_0279"
                     /db_xref="GeneID:5828036"
     CDS             363255..363833
                     /locus_tag="Caur_0279"
                     /note="TIGRFAM: phosphoheptose isomerase;
                     KEGG: wsu:WS0681 phosphoheptose isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="YP_001633920.1"
                     /db_xref="GI:163845876"
                     /db_xref="InterPro:IPR004515"
                     /db_xref="GeneID:5828036"
                     /translation="MSFQQQLDEAITVLQACTTLAPAIDRITELVADAILSGHTLYTA
                     GNGGSAADAMHLAEELIGRYRHNRRPLPAICLNADVGAMTCIANDFGYDEVFARQLTA
                     LGKPGDVLIVFSTSGNSPNIINALSTARARGMINIALLGKDGGMARNLADHALIVPSQ
                     NTARIQEVHTLFLHAICEQVEQRLASASEPYV"
     misc_feature    363273..363800
                     /locus_tag="Caur_0279"
                     /note="Phosphoheptose isomerase is a member of the SIS
                     (Sugar ISomerase) superfamily. Phosphoheptose isomerase
                     catalyzes the isomerization of sedoheptulose 7-phosphate
                     into D-glycero-D-mannoheptose 7-phosphate. This is the
                     first step of the biosynthesis of...; Region: SIS_GmhA;
                     cd05006"
                     /db_xref="CDD:240139"
     misc_feature    order(363282..363284,363294..363296,363327..363329,
                     363336..363338,363396..363398,363414..363419,
                     363750..363755,363765..363767,363774..363776,
                     363786..363788,363798..363800)
                     /locus_tag="Caur_0279"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240139"
     misc_feature    order(363390..363398,363594..363602,363609..363611,
                     363738..363740,363750..363752)
                     /locus_tag="Caur_0279"
                     /note="active site"
                     /db_xref="CDD:240139"
     gene            363843..365420
                     /locus_tag="Caur_0280"
                     /db_xref="GeneID:5828037"
     CDS             363843..365420
                     /locus_tag="Caur_0280"
                     /EC_number="1.1.1.95"
                     /note="catalyzes the formation of 3-phosphonooxypyruvate
                     from 3-phospho-D-glycerate in serine biosynthesis; can
                     also reduce alpha ketoglutarate to form
                     2-hydroxyglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="YP_001633921.1"
                     /db_xref="GI:163845877"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR006236"
                     /db_xref="GeneID:5828037"
                     /translation="MNRILVTEKIAAEGLAVLRQAGTVDVRLDLDKPTLISIIGEYDA
                     LVVRSATKVTAEVIAAGERLRVIGRAGTGVDNIDVEAATRRGIIVVNAPASNNVAVAE
                     LTIGLLISLARRIPQAHASLQSGRWARNDFVGWEVRGKTLGLVGLGRIGSEVARRARS
                     LEMEVLAYDPVVSFDRAEQLGVSLVTLDELVQRSDVISLHVPLIESTRNLFDQQRIMQ
                     MKRGAYLINASRGGIVDEVALVEALNSGHLGGAALDVYNQEPLPADSPLLGHPKIITV
                     PHIGASTTEAQLSAGTEMAEGVVTALNGGTPRYAVNAPFVAPEAWNVLQPYLNLGRLL
                     GTLVMQLVQEPVRSYDLELGGELADMDTQPVRLAVLQGLLAASSSERITPVNAPIIAR
                     ERGVRMTERVSPEAENYAGLITLHVQTAERTRTFSGTVLRGEPHIVQMDGYFVDFVPQ
                     GSLLITYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPRERAVMVLTLDEPAPPQVM
                     EQIATIPGIQAAFSVEL"
     misc_feature    363849..365417
                     /locus_tag="Caur_0280"
                     /note="D-3-phosphoglycerate dehydrogenase; Provisional;
                     Region: PRK13581"
                     /db_xref="CDD:237436"
     misc_feature    363849..364757
                     /locus_tag="Caur_0280"
                     /note="Phosphoglycerate dehydrogenases, NAD-binding and
                     catalytic domains; Region: PGDH_4; cd12173"
                     /db_xref="CDD:240650"
     misc_feature    order(363984..363989,364047..364049,364053..364058,
                     364128..364130,364530..364532,364674..364676,
                     364683..364685,364701..364703)
                     /locus_tag="Caur_0280"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240650"
     misc_feature    order(364056..364058,364128..364130,364140..364142,
                     364278..364280,364284..364292,364344..364355,
                     364440..364448,364461..364463,364524..364532,
                     364602..364607,364674..364676,364680..364685)
                     /locus_tag="Caur_0280"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240650"
     misc_feature    order(364134..364139,364146..364151,364155..364160,
                     364167..364172,364179..364181,364185..364190,
                     364194..364199,364206..364211,364215..364223,
                     364227..364229,364236..364256,364260..364262,
                     364311..364313,364320..364325,364608..364610,
                     364617..364625,364641..364655,364659..364682,
                     364686..364697,364707..364709)
                     /locus_tag="Caur_0280"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240650"
     misc_feature    order(364530..364532,364617..364619,364674..364676)
                     /locus_tag="Caur_0280"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240650"
     misc_feature    365199..365417
                     /locus_tag="Caur_0280"
                     /note="C-terminal ACT (regulatory) domain of
                     D-3-phosphoglycerate dehydrogenase (3PGDH); Region:
                     ACT_3PGDH-xct; cd04902"
                     /db_xref="CDD:153174"
     misc_feature    order(365214..365216,365220..365222,365274..365276)
                     /locus_tag="Caur_0280"
                     /note="putative L-serine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153174"
     gene            complement(365477..366610)
                     /locus_tag="Caur_0281"
                     /db_xref="GeneID:5828038"
     CDS             complement(365477..366610)
                     /locus_tag="Caur_0281"
                     /note="KEGG: wsu:WS0992 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633922.1"
                     /db_xref="GI:163845878"
                     /db_xref="GeneID:5828038"
                     /translation="MNCKALIFLVPHPNTPIVTFDSIAALWAKTDVTGQMLLLIALAG
                     VAIFAIRHLQSLIWNLSEFSRFRRSSAYLQLRETNGAVMLMALPLTLAMTINVAFVSG
                     AVFVPGLWNVVEYLFPFAMTAFLLVGVLALRTFADIFGRALANGHFDCTRNNNLTQLL
                     AAFAFAMVGVGMAAPAAMSTVKLTIGLSMLGTIFFITAAVVIALILLVLGARAMLTNG
                     LAVEAGPSLWMPIPLLTLIGIAMLRISHGLHSGFELHIEAPHRLLITAVFFSLQLLAG
                     LLGLSVLRRVGYFRTYLNGPARSPGAYGLICPAVGLFVFGMFFLHVGLVQNGLIEKFS
                     PVYFVALAALAVVQVLGIITMFRLDRRLLAQPARSPAEAERVA"
     gene            complement(366863..367246)
                     /locus_tag="Caur_0282"
                     /db_xref="GeneID:5828039"
     CDS             complement(366863..367246)
                     /locus_tag="Caur_0282"
                     /note="PFAM: helix-turn-helix Fis-type"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix Fis-type protein"
                     /protein_id="YP_001633923.1"
                     /db_xref="GI:163845879"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="GeneID:5828039"
                     /translation="MAHRETSRDEVIAALHANRGLIALAARDLGVSRQALYARIKRDP
                     ELLACIEHEREAIVDLAEQKLFEALDKGERWAVMLVLTRLGRHRGWADAPASGGPEGR
                     VAKALEQASLDDLMLSLTTLNGQRR"
     misc_feature    complement(367121..367237)
                     /locus_tag="Caur_0282"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; cl17420"
                     /db_xref="CDD:266671"
     gene            complement(367288..368313)
                     /locus_tag="Caur_0283"
                     /db_xref="GeneID:5828040"
     CDS             complement(367288..368313)
                     /locus_tag="Caur_0283"
                     /note="PFAM: zinc finger CHC2-family protein;
                     KEGG: fra:Francci3_3307 zinc finger, CHC2-type"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc finger CHC2-family protein"
                     /protein_id="YP_001633924.1"
                     /db_xref="GI:163845880"
                     /db_xref="InterPro:IPR002694"
                     /db_xref="GeneID:5828040"
                     /translation="MTLTTAPTIDLPALIERLGVRLHRYGRSYRCACPLHAGDNELAF
                     SIYQSRSGQWRWHCFSGDCGDGDAIAFVRRYYGVGYREACQMLGVTPASAPSGPRSPQ
                     PPPVEPPSAQWQHTVGRLVDQAVQALWSPAGQAARAYLYQRGLTDALIRRAGLGYHPA
                     ATRIRAETLGLDGDNPYYPAGIVIPYWVEGDLWRVQVRRLSNTEPRYLSLAGSSGAPP
                     YLIAPITSAKPLVLAEGPVDVLAIMQAAGDLVTAIGTGATGCRAVRWIARCAVAPLVL
                     AAHDADEAGDAAAAYWCDALQPRCTRWRPTLHDPAEMLQLGGLALVRQWIEQGLASAE
                     GDGYNRR"
     misc_feature    complement(368044..368289)
                     /locus_tag="Caur_0283"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     misc_feature    complement(<367837..367932)
                     /locus_tag="Caur_0283"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; pfam08275"
                     /db_xref="CDD:254701"
     misc_feature    complement(<367510..367629)
                     /locus_tag="Caur_0283"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     gene            complement(368429..370912)
                     /locus_tag="Caur_0284"
                     /db_xref="GeneID:5828041"
     CDS             complement(368429..370912)
                     /locus_tag="Caur_0284"
                     /note="KEGG: dvl:Dvul_0087 toprim sub domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633925.1"
                     /db_xref="GI:163845881"
                     /db_xref="GeneID:5828041"
                     /translation="MKKHTSTSSYHNGSPASTPPDHLIAEALRALAGPDDAAAQQAAQ
                     TDCGPWNHVRDALATARASGGQPAAQRALAALQHQYPDLTTLLASAQALDLDDDDEPA
                     SDAPSPLPLGGLPGWVREMVRHTAEAVQVPVDLAHALALGALSVATAGAMRVQLTSDW
                     NEETCLYVMPALPSGERKSAAFALLIGPIEQWEDDERNRRAPEYTTSQARKRVLDKEI
                     ERLTAEAAKEQDASRKKQLEWALATAITEYERVALAAPFRRLLQNATPEALTSALVAH
                     QRIAVVSPEPDSMQVLIGAGRDGPPMLEAILKGYNGERLIIDRQTRQSQRVAAPALTM
                     VLAAQPHAVRDLIRNRALIERGVLARYLILLPPSRLGARAIAPPVIPELVKATYATHL
                     RWLLDTCQPPAPEQRHTVTLSAEALHAVHAMQAMIEPRLHEQRGDLAGHPLLRAWAGK
                     LTGHVVRIAANLHAAHCAARKVLPWAEPISGEVMRAAVAYCEPLIAHMRAVLGDAVMS
                     DADRVARRVRAIIARYAAHGQITERMIYQAMRTESREMIERALQTLLKDGDLEGPLKV
                     TGRKGGRPSKVYRVLIAPNATSAATTTPPGASYAAPEPAPEPAPEPAPEPAPEPAPEP
                     APEPAPEPEPVPPAAPPSAATNAAAPASKRVISMPPTPPAWYDVVKPLTQRLPATLSA
                     EMGAPAGQPLGILIRRNDRPASSPDATLYIAPFDLPEGVSRAEAIAAGVQHVLAELRR
                     RWPDAHPASAEGAEGAEGDEGDEGDNDLPPLPAGVKPSAWRAVNWRYVMHLATKRPAD
                     WERGVRTHAVLKGIPPEALLAAAQARAGL"
     misc_feature    complement(369398..370534)
                     /locus_tag="Caur_0284"
                     /note="Protein of unknown function (DUF3987); Region:
                     DUF3987; pfam13148"
                     /db_xref="CDD:257520"
     gene            complement(371491..372018)
                     /locus_tag="Caur_0285"
                     /db_xref="GeneID:5824942"
     CDS             complement(371491..372018)
                     /locus_tag="Caur_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633926.1"
                     /db_xref="GI:163845882"
                     /db_xref="GeneID:5824942"
                     /translation="MTNDTTPMSNVDQRRIRAALRIIVLASLYAERVAREHIPDSDAL
                     DELQGYIALIRDAAAIAGAELDGFESQLIAETVTHLNAHEVVRLFAEHHAAFFAKVAI
                     AVANAAADRALCDIRPGRKPGPAIEEEKLQAALDYYERNAGCITLEEAATRHCIAPRT
                     LSRYRSQRRKQANNQ"
     gene            complement(372098..372427)
                     /locus_tag="Caur_0286"
                     /db_xref="GeneID:5824943"
     CDS             complement(372098..372427)
                     /locus_tag="Caur_0286"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633927.1"
                     /db_xref="GI:163845883"
                     /db_xref="GeneID:5824943"
                     /translation="MTPPELPATGPEQPGDAPAAPARALVRAHRLIGYVVGHITLDGV
                     DHAIIHTQPHRYEVAPAHLVQPADADAALMDIRLALADAVALARWRGIEPATVLAALT
                     AIIAQAE"
     misc_feature    complement(<372272..372358)
                     /locus_tag="Caur_0286"
                     /note="valyl-tRNA synthetase-like protein; Provisional;
                     Region: PTZ00419"
                     /db_xref="CDD:240411"
     gene            complement(372641..373387)
                     /locus_tag="Caur_0287"
                     /db_xref="GeneID:5824944"
     CDS             complement(372641..373387)
                     /locus_tag="Caur_0287"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633928.1"
                     /db_xref="GI:163845884"
                     /db_xref="GeneID:5824944"
                     /translation="MKRHIGLAIHGGLALVIVGWSLWGAYTFWQFVFLTPWAAVGALL
                     LIEAFALAGFALHVLGIPTPVAAARHLLPVASAAPALHSIHALAKGVGDLEAWALAGI
                     VTLVLMLASYAVWRGLEALLLDRALLVQAEVEARAKHAEVAVQRIAAEAAAMVRIITA
                     MRNAVQAHERAALPPAADLVLARVASYPEPQPAAPDSSPSATARTSDAAPRYQCPHCG
                     APLANLGQYGAARKHGYCRQCRPGTEARNG"
     misc_feature    complement(<372977..373345)
                     /locus_tag="Caur_0287"
                     /note="exopolysaccharide biosynthesis polyprenyl
                     glycosylphosphotransferase; Region: EPS_sugtrans;
                     TIGR03025"
                     /db_xref="CDD:234093"
     gene            complement(373384..374895)
                     /locus_tag="Caur_0288"
                     /db_xref="GeneID:5824945"
     CDS             complement(373384..374895)
                     /locus_tag="Caur_0288"
                     /note="KEGG: ana:alr9504 unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633929.1"
                     /db_xref="GI:163845885"
                     /db_xref="GeneID:5824945"
                     /translation="MSNLTINRIGPEAQADSAWHDEDVEAARFAALDVRPAPARWRGR
                     DALGVALAGLVALGGWLALVIVFWVAARITESAYPPAPGWVLFWQVLLGITASAPAWL
                     GILAASVWVYERRIYARRANVIRDKLMNPVPAHLINQLTLPSYYALFERAAALEREVA
                     PYRAYRGVESLSLSASAAKPSGEEARKALESVVTPAIERLDDWVTDVAAREAHILVSG
                     KTASGKTTTGAALLARRIDAGDAICVIDPHHEPGKWWGIDAIGAGRDYAAIGAALDAL
                     DAEMTERYRRLADGEPPGQRLTVLIDEAPAIAAALERRWKALATRLGSEARKVGIALI
                     ILSQSPLVEDLMMNSVMRRNYTIIGLDMASIRVMLRDARNARDILATLEGRPYPALRE
                     VDGEFRICDRTGIHQVRPQRSPNVWRLPVCDEAASGPAQTDRRADAETIERLKAFIRA
                     GITRDEARAQGVAFDNSDWTRARREVEAETELLNGLLVASPRDGLRATTEVQG"
     misc_feature    complement(<374155..374793)
                     /locus_tag="Caur_0288"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    complement(373813..374262)
                     /locus_tag="Caur_0288"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(374221..374244)
                     /locus_tag="Caur_0288"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(373882..373884,373990..373992,
                     374218..374241))
                     /locus_tag="Caur_0288"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(373987..374004)
                     /locus_tag="Caur_0288"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(373837..373839)
                     /locus_tag="Caur_0288"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(375155..375367)
                     /locus_tag="Caur_0289"
                     /db_xref="GeneID:5824946"
     CDS             complement(375155..375367)
                     /locus_tag="Caur_0289"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633930.1"
                     /db_xref="GI:163845886"
                     /db_xref="GeneID:5824946"
                     /translation="MISEEARRLALAIWAEQAASGIGPAMVEAERLAEWLANRTYPLT
                     LLERAANGDVTALLAVRIEAGLPAIV"
     gene            complement(375521..375757)
                     /locus_tag="Caur_0290"
                     /db_xref="GeneID:5824947"
     CDS             complement(375521..375757)
                     /locus_tag="Caur_0290"
                     /note="KEGG: xau:Xaut_0314 putative transcriptional
                     regulator, XRE family"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_001633931.1"
                     /db_xref="GI:163845887"
                     /db_xref="GeneID:5824947"
                     /translation="MNSHLRILIAQKELRERRRLSVRVIAEESGASRSAIERLMNNTI
                     REVPLDDLARLCVWLDCQPGDILRLEPLPEEPAR"
     misc_feature    complement(<375530..375724)
                     /locus_tag="Caur_0290"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(375560..375724)
                     /locus_tag="Caur_0290"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(375635..375637,375710..375712,
                     375722..375724))
                     /locus_tag="Caur_0290"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(375638..375640,375713..375715))
                     /locus_tag="Caur_0290"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(375632..375637,375647..375649,
                     375656..375658,375689..375694))
                     /locus_tag="Caur_0290"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            375923..377446
                     /locus_tag="Caur_0291"
                     /db_xref="GeneID:5824948"
     CDS             375923..377446
                     /locus_tag="Caur_0291"
                     /note="PFAM: Resolvase domain; Recombinase;
                     KEGG: bja:bll1959 DNA invertase"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="YP_001633932.1"
                     /db_xref="GI:163845888"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="InterPro:IPR011109"
                     /db_xref="GeneID:5824948"
                     /translation="MHAVIYARVSTEEQGDNFSIPAQLAACREYAERNGLQVVAECID
                     TMSGARLDRPGLQQVRDLVSQQLVQAVIVYHQDRLSRNLAHFLYLRDEFQNARIALHF
                     TTLGQARDTPEDKLIQNMIGSFAEHERLRIIERTKQGRRARLLSGKPLGLGNHPAYGY
                     HWHGTKHDRHLHINEAEAAIVRRIFAWALEGVPTQRIAKLLTDMGVTPRGRAGRPPRP
                     EWDHTTVAGMLRNPVYKGQYYSAAHNLFVPVPAIVDAETWEAVQEQLTRNQAMAKRNA
                     KRVYSLRGRIRCGICGNRMSGNGAGTRASGKTYHYYMCHAAKGALIASCNHGTSYRAE
                     RLEALVWQWVIETVLDETRLVRAIEAARANEAGQREALEHERAAYARQIAEAGTRTAR
                     LIELYTAGVCTLDEVAATKKQYELQRQSAQRELDRIDAQLAALNSHHANRDALLAMAR
                     ALKAALQIEATPEEQMKVYEALDVQVVVRENNIDVRAVLTGDAGTFLIAGEPISSTR"
     misc_feature    375923..376525
                     /locus_tag="Caur_0291"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    375935..376339
                     /locus_tag="Caur_0291"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    order(375944..375946,375950..375952,376151..376156,
                     376163..376165)
                     /locus_tag="Caur_0291"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    375950..375952
                     /locus_tag="Caur_0291"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     misc_feature    376445..376726
                     /locus_tag="Caur_0291"
                     /note="Recombinase; Region: Recombinase; pfam07508"
                     /db_xref="CDD:254248"
     misc_feature    376766..376954
                     /locus_tag="Caur_0291"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     gene            complement(377436..377510)
                     /locus_tag="Caur_0292"
                     /pseudo
                     /db_xref="GeneID:5824949"
     gene            complement(378519..379559)
                     /locus_tag="Caur_0293"
                     /db_xref="GeneID:5824950"
     CDS             complement(378519..379559)
                     /locus_tag="Caur_0293"
                     /note="PFAM: Vitamin K epoxide reductase;
                     KEGG: rrs:RoseRS_0493 vitamin K epoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin K epoxide reductase"
                     /protein_id="YP_001633933.1"
                     /db_xref="GI:163845889"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR012932"
                     /db_xref="GeneID:5824950"
                     /translation="MRTRWLWVGLLSSLLVIVEWLSLPDALAQSPVARAVLFFSPTCP
                     HCHVVLDEVLPPLQARYGDQLHILTIDVTTPDGMALYEAAITTFAVPRERFGVPALFF
                     EQVHLVGSTEIPAQLPGLIEQALTTGGSRWPPIPGLEPYITRLEAGTPSLPSASASTS
                     PFSRDPANTLALLVLTGMVIVIFITIRRLRWPFDRSLPASSNRLIPVFAVVGLVLAGY
                     LAVVELSQQSAVCGPIGDCNLVHQSPYARIAGIPVGLVGVAGYLAILGAWMINYVRDW
                     RVARQLLVGFVLVGTLVSLYLTFLEPFVIGATCLWCLLSAITMTTLLWLVALPVDRPV
                     MRGRRSLSAAKR"
     sig_peptide     complement(379473..379559)
                     /locus_tag="Caur_0293"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.636) with cleavage site probability 0.570 at
                     residue 29"
     misc_feature    complement(379230..379454)
                     /locus_tag="Caur_0293"
                     /note="DsbA family; consists of DsbA and DsbA-like
                     proteins, including DsbC, DsbG, glutathione (GSH)
                     S-transferase kappa (GSTK),
                     2-hydroxychromene-2-carboxylate (HCCA) isomerase, an
                     oxidoreductase (FrnE) presumed to be involved in
                     frenolicin biosynthesis, a...; Region: DsbA_family;
                     cd02972"
                     /db_xref="CDD:239270"
     misc_feature    complement(order(379422..379424,379431..379433))
                     /locus_tag="Caur_0293"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239270"
     misc_feature    complement(378576..378959)
                     /locus_tag="Caur_0293"
                     /note="Vitamin K epoxide reductase family in bacteria and
                     plants; Region: VKOR_1; cd12916"
                     /db_xref="CDD:240599"
     misc_feature    complement(order(378615..378617,378624..378626,
                     378660..378662,378669..378671,378681..378683,
                     378690..378692,378702..378704,378777..378779,
                     378789..378794,378798..378803,378822..378830,
                     378840..378842,378912..378914))
                     /locus_tag="Caur_0293"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240599"
     misc_feature    complement(order(378624..378626,378633..378635,
                     378831..378833,378849..378851,378867..378869))
                     /locus_tag="Caur_0293"
                     /note="putative active site [active]"
                     /db_xref="CDD:240599"
     misc_feature    complement(378624..378635)
                     /locus_tag="Caur_0293"
                     /note="redox center [active]"
                     /db_xref="CDD:240599"
     gene            379922..381352
                     /locus_tag="Caur_0294"
                     /db_xref="GeneID:5824951"
     CDS             379922..381352
                     /locus_tag="Caur_0294"
                     /note="KEGG: ava:Ava_4725 polymorphic membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633934.1"
                     /db_xref="GI:163845890"
                     /db_xref="GeneID:5824951"
                     /translation="MERHNTVLSLPTLRGLVGKLVYTSGSHAFSRSILKGRRYAQDRW
                     GSFIESRSWGWIMLMIVAGVVGGWLLLHNARPTLSAGSIVVTTTDDELNSDGDCSLRE
                     AIQAVNTQSPVDACPTGSGNDTITLPAGVYTLNIAGAGEDNNTTGDLDIFATASAVTR
                     TLIIQGNGASTTVVDGNQLDRVFHLVARAPVRFQDDLLVLRDLTVRNGRLPAATREGG
                     AGLLSWGRLELYNVIIENNATTGTSSSDVGGGFCIGCGPGTGSGYLENVIVRNNAAQR
                     GGGVFSNRPLTITASSIISNTAVARGAIENYGALTLINVTVSNNFASNNTGGIGHFAG
                     SLSVLNSTISHNTSRGILFDAPATLKNTLLAYNTPGGNCFISTPPTSQGYNLSNDNSC
                     ASLLTASGDLNNVDPQLGPLQNNGGFTPTRALALTSPAVNAGTNSDCPATDQRGVTRP
                     QDGTCDIGAYELQVQRVHLPLVLKQS"
     misc_feature    380168..>381337
                     /locus_tag="Caur_0294"
                     /note="Acinetobacter rhombotarget A; Region: GlyGly_RbtA;
                     TIGR04212"
                     /db_xref="CDD:234502"
     misc_feature    380168..380245
                     /locus_tag="Caur_0294"
                     /note="CSLREA domain; Region: CSLREA_Nterm; TIGR04214"
                     /db_xref="CDD:211937"
     gene            381515..382009
                     /locus_tag="Caur_0295"
                     /db_xref="GeneID:5824952"
     CDS             381515..382009
                     /locus_tag="Caur_0295"
                     /note="KEGG: rrs:RoseRS_1018 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633935.1"
                     /db_xref="GI:163845891"
                     /db_xref="GeneID:5824952"
                     /translation="MITKLFSHLTGGFIMIIFGAIFVGVGLFARDWMVPSSHLSASGV
                     VVDLDEVRSSRGSTGYKAVVEFTTSTGQVVRFQDPTSSNPPAYRRGQEVTVLYDPENP
                     EFAVIDSPFTWLPSTVFIGFGGLFVVLGIFALLNWLLILLKLGGILGVLGLLLRRSRS
                     PVSH"
     sig_peptide     381515..381604
                     /locus_tag="Caur_0295"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.740) with cleavage site probability 0.724 at
                     residue 30"
     misc_feature    381539..381913
                     /locus_tag="Caur_0295"
                     /note="Protein of unknown function (DUF3592); Region:
                     DUF3592; pfam12158"
                     /db_xref="CDD:256879"
     gene            382247..383155
                     /locus_tag="Caur_0296"
                     /db_xref="GeneID:5824953"
     CDS             382247..383155
                     /locus_tag="Caur_0296"
                     /note="KEGG: rca:Rcas_0402 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633936.1"
                     /db_xref="GI:163845892"
                     /db_xref="InterPro:IPR004829"
                     /db_xref="GeneID:5824953"
                     /translation="MPITRFVLIAVILALSACSSGGSSTVEPSPVAVNPTPTVQPSPV
                     AENPTPTVQPSPVAANPSPTVQPSPVVENPTPTVQPSPVAENPTAPVPPVAAAGQCQN
                     PYYPVVQGATWQYQISGASSDTFVRTITQVREDGFDDQDVFSSGATRQGSWQCQQGNL
                     IGLSAGSNPSVALSDQMNFTFTVESNTGISFPADPQPGAEWTQTIVYGGQSDIGGTTV
                     ALRNTMQLSCKAIGVERVSVPVGNLEALRVDCTTRFDISFAGATALSTTTTGSAWYAS
                     GVGLVKSRDSSDTGVTEIVLLSYSIP"
     sig_peptide     382247..382324
                     /locus_tag="Caur_0296"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.708 at
                     residue 26"
     misc_feature    382529..383146
                     /locus_tag="Caur_0296"
                     /note="Protein of unknown function (DUF3108); Region:
                     DUF3108; pfam11306"
                     /db_xref="CDD:256405"
     gene            383184..384170
                     /locus_tag="Caur_0297"
                     /db_xref="GeneID:5824954"
     CDS             383184..384170
                     /locus_tag="Caur_0297"
                     /note="KEGG: mlo:mlr7467 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633937.1"
                     /db_xref="GI:163845893"
                     /db_xref="GeneID:5824954"
                     /translation="MWDFSIGKAFSLLIRTTPFIGFRFAIYFGITLAYIVATGGGAGI
                     GYLIGSVLGDAETAGGSAFWGGLFGFGFVSGALYFAREYLMYIVKAGHIAVLVRLMDD
                     QPIPEGTGQIAYASQIVKARFAEASLLFGLDQLIKGIIRTVNSTLLTISSFLPIPGLT
                     NAMEFVTAVIRFSLTYVDEAILAYIIRTDQANSWASARDGVILYAQNYRLLLKNAVFL
                     TIFAWILSFVIFLIVIAPVAALVSVMPGLGGFWTLIIAIITAYALKAALIDPFAMACI
                     VQVYFQAIAGQTPSPEWVDRLNSLSAQFRELGEKAAAAMGGSSRLPISTWKG"
     gene            384353..386542
                     /locus_tag="Caur_0298"
                     /db_xref="GeneID:5824955"
     CDS             384353..386542
                     /locus_tag="Caur_0298"
                     /note="TIGRFAM: polymorphic outer membrane protein;
                     PFAM: Polymorphic membrane protein Chlamydia;
                     KEGG: rrs:RoseRS_4272 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polymorphic outer membrane protein"
                     /protein_id="YP_001633938.1"
                     /db_xref="GI:163845894"
                     /db_xref="InterPro:IPR003368"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="GeneID:5824955"
                     /translation="MTITRFPRMLALLIVMALIVGGLPVRSMYAAGFVVNSLGDTAMP
                     TAGDGFCTLREAIASANNAGNGDCGPNSAADDTITFSVSGTITLAAVLPFIAGGAGAL
                     TIDGGGNIAISGGGSDQVLLINSDANLTLQRLTITNGYSLGFGGGIQNSGTLTVTNSV
                     LSNNAAGFGAGIDNTGTLTITNSTFSNNAATTSGGGIYNAGTLTITNSSFSNNAATIS
                     GGGISNDTNGTLTITNNTLSNNMADYGAGIYNDTNGTLTITNSTLSNNIASNSGGGMY
                     NSGTLTITNSTFSTNQTGAFDGGGIYNQGALTIANSTFSNNIATNGGGIYNANALTVT
                     NSTFEGNTVSSSGGGIYNDTVGTLAITNSTFSNNGAPNGGGIGSTGTLTLNNTIIANS
                     FGGDCRGSVASADHNLIENTGTNACNLTNGVNGNIIGQDPNLGTLAGTPAYFPLNTDS
                     PAIDKGSNAICAAAPVNNQSQNGVTRPQDGNGDSSATCDIGSYELDVTPPTVTSITRA
                     DPNPTNAASVSFTVTFSEAVTGVDSNDFSLNPTGGVSGAGITGVSGAGSSYTVTVNTG
                     TGSGTLGLTLVDNDSIVDVAGNPLAGLGAGNGNFTGESYTVDKGAPTVTAITRAGPNP
                     TGAASVNFTVTFSEAVTGVDSGDFSLTTTDSLSGVGITGVSGSGSSYTVTVNTGTGSG
                     TLRLDVPATATITDPSGNSLSSLPFTTGESYLVRSSFVYLPLVVKAP"
     sig_peptide     384353..384436
                     /locus_tag="Caur_0298"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.975) with cleavage site probability 0.736 at
                     residue 28"
     misc_feature    384449..384535
                     /locus_tag="Caur_0298"
                     /note="CSLREA domain; Region: CSLREA_Nterm; TIGR04214"
                     /db_xref="CDD:211937"
     misc_feature    384857..385366
                     /locus_tag="Caur_0298"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    385253..385636
                     /locus_tag="Caur_0298"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    <385787..386377
                     /locus_tag="Caur_0298"
                     /note="Putative flagellar system-associated repeat;
                     Region: SWM_repeat; pfam13753"
                     /db_xref="CDD:258044"
     gene            388020..390056
                     /locus_tag="Caur_0299"
                     /db_xref="GeneID:5824956"
     CDS             388020..390056
                     /locus_tag="Caur_0299"
                     /note="KEGG: aba:Acid345_2296 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633939.1"
                     /db_xref="GI:163845895"
                     /db_xref="GeneID:5824956"
                     /translation="MPVGAPDTNNGYGSTSQWEVMTNHILRQTRWSAPERSHCCRHEE
                     GRQEMVQPLSGCSVAVPVRNLPYPTAQKERRMSNHSGHFFAGRQPTRHRLIGIAGVLL
                     VSVILMIGSVQAAPLGTAFTYQGQLQKNGSPYNGTCSFQFSLWDAVSGGAQVGSTLTQ
                     TGVTVSNGLFTVTLDFGTGVFTGDVRWLQIAVQCSGDSGYTTLSPRHALTAAPYALGL
                     RPGAQVIGSVVDASLLVQNTAAGGFGYGVFVQTDSTSSDAAGVMGYAAATSGVTYGVY
                     GRSNSPNGTGVYGIHQASSGSAPGIHGVTRSTSNDAVAILGEVPFSSLPGATSTAVRG
                     LNKGTGGTGIGVWGSHDGGGWGVYGTSVSGIGVYGRTTTETGISTGVFGETTSTSGRG
                     VYGLAVANTGTTYGVYGGSISPSGTGVYGVATDTSGINYGVRGKSNSSNGYGGYFENT
                     SDGIALYAEGNGNGRNKAALRVNNTDTGQGMAAYFTNNSGFHTAHFYNAQSGNVLYLQ
                     GSSTGTGDFITAVNNAETNTLFRVTSTGQVQSDVGFSTPAADFAEMLPAVSGLEPGDV
                     LVIGADGRLARSTQPYQATVVGVYSTRPGFIGGQPVDGNLEGHIPLAVVGVVPVKVST
                     ENGPIQPGDLLVASATPGHAMRAGTNPPQGTVIGKALEGLDDGTGVIRMLVVLQ"
     gene            390067..390357
                     /locus_tag="Caur_0300"
                     /db_xref="GeneID:5827809"
     CDS             390067..390357
                     /locus_tag="Caur_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633940.1"
                     /db_xref="GI:163845896"
                     /db_xref="GeneID:5827809"
                     /translation="MRGIRRLLVPGLIPLLLLLSALALASSGGPYNLNWWTVDGGGYT
                     VSTGGSYALGGTVGQSDAGVLSGGSYTLRGGFWGGVEVTYQVWTPLIMRDSP"
     sig_peptide     390067..390144
                     /locus_tag="Caur_0300"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.949 at
                     residue 26"
     gene            complement(390570..391142)
                     /locus_tag="Caur_0301"
                     /db_xref="GeneID:5827810"
     CDS             complement(390570..391142)
                     /locus_tag="Caur_0301"
                     /note="TIGRFAM: 2'-5' RNA ligase;
                     PFAM: Phosphoesterase HXTX;
                     KEGG: deb:DehaBAV1_1257 2'-5' RNA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase"
                     /protein_id="YP_001633941.1"
                     /db_xref="GI:163845897"
                     /db_xref="InterPro:IPR004175"
                     /db_xref="InterPro:IPR014051"
                     /db_xref="GeneID:5827810"
                     /translation="MSQTPPAEPTLRLFIALELPQPVRDELKRIQQRLQGHSRAARWT
                     DPTGMHLTLHFLGETPERLVEPLLTGLRSVSAPALSLTLDRLGCFPANGALRVVWVGL
                     RGDLAALATLHRSLATVIQSLGLPTETRPFVPHITLARARPNATAADLRALRTALDTV
                     APQSLTWQSDSPRLFRSQLTPRGAVYTVLG"
     misc_feature    complement(390576..391109)
                     /locus_tag="Caur_0301"
                     /note="2'-5' RNA ligase; Region: 2_5_ligase; TIGR02258"
                     /db_xref="CDD:233802"
     misc_feature    complement(390846..391094)
                     /locus_tag="Caur_0301"
                     /note="LigT like Phosphoesterase; Region: LigT_PEase;
                     pfam02834"
                     /db_xref="CDD:251562"
     misc_feature    complement(390597..390824)
                     /locus_tag="Caur_0301"
                     /note="LigT like Phosphoesterase; Region: LigT_PEase;
                     pfam02834"
                     /db_xref="CDD:251562"
     gene            complement(391419..392201)
                     /locus_tag="Caur_0302"
                     /db_xref="GeneID:5827811"
     CDS             complement(391419..392201)
                     /locus_tag="Caur_0302"
                     /note="PFAM: DSBA oxidoreductase;
                     KEGG: rca:Rcas_3717 DsbA oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="YP_001633942.1"
                     /db_xref="GI:163845898"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="GeneID:5827811"
                     /translation="MRVRLLVLIMLLSLTACTAATPVPSPTAIPRLPTVTPEPLSQST
                     PTPRIIRLSESPLPVFTPTPIPTPVISADGITTASMAQLGISAEPYAILGDPNAPVTI
                     IEFTDFGCTFCRRHHVLTFPALREEFISSGQVFYVVRQLPVTSPHGDQAALAALCAGE
                     QGKYWEMHDQLFAAGDAWYSDATTARRRIIALATDLGLDSAVLQRCMEHPATQATLAR
                     HVSEAHALRVFGTPTFFINNQLFAGAQPIARWRDVLEGGGRR"
     sig_peptide     complement(392142..392201)
                     /locus_tag="Caur_0302"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.780 at
                     residue 20"
     misc_feature    complement(391458..392027)
                     /locus_tag="Caur_0302"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    complement(391437..391928)
                     /locus_tag="Caur_0302"
                     /note="Thioredoxin; Region: Thioredoxin_4; pfam13462"
                     /db_xref="CDD:257786"
     gene            complement(392574..394946)
                     /locus_tag="Caur_0303"
                     /db_xref="GeneID:5827812"
     CDS             complement(392574..394946)
                     /locus_tag="Caur_0303"
                     /EC_number="3.4.21.53"
                     /note="KEGG: rca:Rcas_2557 ATP-dependent protease La;
                     TIGRFAM: ATP-dependent protease La;
                     PFAM: peptidase S16 lon domain protein; AAA ATPase central
                     domain protein; ATPase associated with various cellular
                     activities AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease La"
                     /protein_id="YP_001633943.1"
                     /db_xref="GI:163845899"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:5827812"
                     /translation="MNDPNPMQRPPMPEIPDVLPVLPINNAILFPGMFLPLVVSGEAW
                     VRLVDEAALSTKIIGVFRRIQSGAEFEPEMLAQTGTAALIVRMMRLPQGGVQLLLQGQ
                     ARIKVQRWVTVKPYPQAHVTVALDPVDVSMETTGLARAVLAGFQQIVEQSPNLPDELA
                     IAAANAPHPGMLADLIAANLNLNLDDQQKVLDTFDVHERLQLVLRLLEREREILLIGR
                     KAQEEVSKNQREYVLRQQLEAIKRELGETDDHAAEIAELRRRIEEANLPAEARQEAER
                     ELLRLERMPPGAAEYTVARTYLDWLLDLPWHTSTEDNLDITQARQVLDEDHYDLERIK
                     ERIIEYLAVRKLRREEGADNEARGPILCFVGPPGVGKTSLGASIARALGRKFVRVALG
                     GVRDEAEIRGHRRTYIGALPGRIIQGLSRAKSNNPVLLLDEVDKLSIGFQGDPAAALL
                     EVLDPEQNVAFVDRYLDVPFDLSKVLFVCTANRADTIPPALLDRMELLELAGYTEQEK
                     LEIARRYLIPRQRREQGMTNRGPELTTAALQRLIREYTHEAGVRDLERRIGAIYRKMA
                     TRLASEQTLPDQVDAADLDDLLGPPRFRSETILGDNEVGVVTGLAWTPTGGDVLFVEV
                     SVIPGNGQLILTGQLGDVMKESARAALTYARSRASALGIDPEVFQKSDIHIHVPAGAV
                     PKDGPSAGITIASALISALTRREVDKRIAMTGEVTLRGKVLPIGGVKEKLLAAQRAGV
                     RKVLLPTENEIDLRDVPAETKEQLEIVLVKHMDEVLHELGLEIAPQPVSE"
     misc_feature    complement(392577..394919)
                     /locus_tag="Caur_0303"
                     /note="ATP-dependent Lon protease, bacterial type
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: Lon; COG0466"
                     /db_xref="CDD:223542"
     misc_feature    complement(394320..394895)
                     /locus_tag="Caur_0303"
                     /note="ATP-dependent protease La (LON) domain; Region:
                     LON; pfam02190"
                     /db_xref="CDD:251146"
     misc_feature    complement(393456..393947)
                     /locus_tag="Caur_0303"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(393831..393854)
                     /locus_tag="Caur_0303"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(393501..393503,393651..393653,
                     393828..393851))
                     /locus_tag="Caur_0303"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(393648..393665)
                     /locus_tag="Caur_0303"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(393465..393467)
                     /locus_tag="Caur_0303"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(392610..393215)
                     /locus_tag="Caur_0303"
                     /note="Lon protease (S16) C-terminal proteolytic domain;
                     Region: Lon_C; pfam05362"
                     /db_xref="CDD:191262"
     gene            complement(394943..395350)
                     /locus_tag="Caur_0304"
                     /db_xref="GeneID:5827813"
     CDS             complement(394943..395350)
                     /locus_tag="Caur_0304"
                     /note="KEGG: rrs:RoseRS_2779 molecular chaperone (small
                     heat shock protein)-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone (small heat shock
                     protein)-like protein"
                     /protein_id="YP_001633944.1"
                     /db_xref="GI:163845900"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="GeneID:5827813"
                     /translation="MSDSSYIRILRTRLPYVQFDTRPWTPPLNVFETDREMILVIELA
                     GVDPATLQIEAYPELVRIAGARQLTLPTGLRRLHRMEIAAGVFQIEVPFERLIDPEQT
                     SARSVHGLLEIRLPFAGRTLRQVVIPVLEGEQS"
     misc_feature    complement(395003..>395302)
                     /locus_tag="Caur_0304"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(395003..395266)
                     /locus_tag="Caur_0304"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    complement(order(395021..395026,395084..395086,
                     395216..395221,395225..395227,395231..395233,
                     395252..395266))
                     /locus_tag="Caur_0304"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(395369..395629)
                     /locus_tag="Caur_0305"
                     /db_xref="GeneID:5827814"
     CDS             complement(395369..395629)
                     /locus_tag="Caur_0305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633945.1"
                     /db_xref="GI:163845901"
                     /db_xref="GeneID:5827814"
                     /translation="MPIYSIDFRPFDYLTAELSALWWFYLSQGLALIALGVAVIIWPE
                     LLAFLAAAFFIAIGIVLLVLGWRVRQVKRRYELFKRSFIIEA"
     gene            complement(395749..396066)
                     /locus_tag="Caur_0306"
                     /db_xref="GeneID:5827815"
     CDS             complement(395749..396066)
                     /locus_tag="Caur_0306"
                     /note="KEGG: rca:Rcas_2941 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633946.1"
                     /db_xref="GI:163845902"
                     /db_xref="GeneID:5827815"
                     /translation="MLVRRMSLEELAVAVGLPVPVLQYLTDMGYIHPVPELPAAEFAE
                     LRLIRRLINDLEVPSEAVDIILHMRRRMLEMQREIARLRAELAYRRAFEHSRNWIDAE
                     WYE"
     misc_feature    complement(395818..396048)
                     /locus_tag="Caur_0306"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     gene            complement(396085..397275)
                     /locus_tag="Caur_0307"
                     /db_xref="GeneID:5827816"
     CDS             complement(396085..397275)
                     /locus_tag="Caur_0307"
                     /EC_number="1.3.1.74"
                     /note="KEGG: rca:Rcas_1750 2-alkenal reductase;
                     PFAM: peptidase S1 and S6 chymotrypsin/Hap;
                     SMART: PDZ/DHR/GLGF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="2-alkenal reductase"
                     /protein_id="YP_001633947.1"
                     /db_xref="GI:163845903"
                     /db_xref="InterPro:IPR001254"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="GeneID:5827816"
                     /translation="MERQSGRGRWIVLFIELALLVVIAGAFVWTAFTGNRPATIVVAP
                     SPTPVVLPAPTVVPLTATDLEAQIAAVYREAGVSVVNITSRSISYDFFFNPVPRQGSG
                     SGFFYDDQGHIVTNYHVIADADELQVTLADGQTVPARIVGSDPSNDLAVIKVDLPTAT
                     IRPLPIGDSTQVYVGQFVLAIGNPFGLERTLTFGIVSALGRVIESPNQRFIGEVIQSD
                     VAINPGNSGGPLLDLSGRVIGVNSAILSPSGANAGIGFAISSRTVQRVVPVLIREGRY
                     PHPSLGVRVIELTPQRASLFERAGMQLPVTQGLLIAELITNGPAAQAGLRGPDRLVRV
                     GNLNLPVGGDVIVAVNDRPITTSQDLLVYLETETQVGETVQVKIIRDGREQVVPVTLA
                     ELQF"
     misc_feature    complement(396097..397164)
                     /locus_tag="Caur_0307"
                     /note="periplasmic serine pepetdase DegS; Region:
                     protease_degS; TIGR02038"
                     /db_xref="CDD:233696"
     misc_feature    complement(396556..396972)
                     /locus_tag="Caur_0307"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(396109..396441)
                     /locus_tag="Caur_0307"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(396193..396198,396205..396210,
                     396421..396423,396427..396438))
                     /locus_tag="Caur_0307"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            complement(397414..398340)
                     /locus_tag="Caur_0308"
                     /db_xref="GeneID:5827817"
     CDS             complement(397414..398340)
                     /locus_tag="Caur_0308"
                     /note="PFAM: heat shock protein DnaJ domain protein;
                     chaperone DnaJ domain protein;
                     KEGG: rrs:RoseRS_3094 chaperone DnaJ domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone DnaJ domain-containing protein"
                     /protein_id="YP_001633948.1"
                     /db_xref="GI:163845904"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR003095"
                     /db_xref="GeneID:5827817"
                     /translation="MEFKDYYAILGLSPDADEQAIKQAYRKLARQYHPDVNPGDKKAE
                     ERFKEINEAYQALSDPERRRKYDELRSYYQRWQRSGGRGDFNWSQWQAAPGQQVYTYN
                     VSPEDLEDLFGADSPFSDFFSSIFGQPQFRRASRAARGRDLEAPVTVSLEEAFSGTTR
                     SLQVGDRRIEARIPRGVRTGTRVRLSGQGAPGIGGGPDGDLYLVVEVAPHPQFERDGD
                     DLTTTIAVDAFTAAVGGEVRVPTIDGSVTLKIPPRTQADRVFRLRGKGMPRLENPAER
                     GDLFARVKLVLPEPLSDAELATLRELVRKRQR"
     misc_feature    complement(397435..398331)
                     /locus_tag="Caur_0308"
                     /note="DnaJ-class molecular chaperone with C-terminal Zn
                     finger domain [Posttranslational modification, protein
                     turnover, chaperones]; Region: DnaJ; COG0484"
                     /db_xref="CDD:223560"
     misc_feature    complement(398164..398328)
                     /locus_tag="Caur_0308"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    complement(order(398185..398190,398197..398202,
                     398209..398211,398236..398244))
                     /locus_tag="Caur_0308"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    complement(397468..397917)
                     /locus_tag="Caur_0308"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(397771..397773,397843..397845,
                     397849..397863,397906..397908))
                     /locus_tag="Caur_0308"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(397468..397482,397573..397584,
                     397642..397647,397654..397659))
                     /locus_tag="Caur_0308"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            complement(398453..399634)
                     /locus_tag="Caur_0309"
                     /db_xref="GeneID:5827818"
     CDS             complement(398453..399634)
                     /locus_tag="Caur_0309"
                     /note="KEGG: cya:CYA_1262 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633949.1"
                     /db_xref="GI:163845905"
                     /db_xref="GeneID:5827818"
                     /translation="MIDREAVQQIRADLGALQPPVLSLYVEVDPTRPENERRAWVLRA
                     RNAVKALAVPAEVEQVVLAALEAEIAPEARTLALFAAAPATERKSATVAVTKVPLHIT
                     LPLIDITNGKVEARWGEPYIAPLIYALDQYERTAVVWLRGEGWRFFEVFLGEIVEHTD
                     VFRSVEADLWQQVTEFDPRRLRDDLRAQAMGNRDRFARRMENIAARYLQRLAELTERA
                     LDHFRIRRLVLLGREEATKQFADLLPRSVRQMVIAHVADLPHPDASPAHVLAKVLPAL
                     EQVEQSHEQALLEQVTRQPGVWGIDPTLNALQEGRLSVLIAPWQLDAQVWMASNGLLA
                     GSREQIATLVPDGEAQPVALRDVLVDACAAFATRLEFVSGPAQDHLSRDFGGLAGLLR
                     W"
     misc_feature    complement(398459..>399079)
                     /locus_tag="Caur_0309"
                     /note="Peptide chain release factor 1 (eRF1) [Translation,
                     ribosomal structure and biogenesis]; Region: eRF1;
                     COG1503"
                     /db_xref="CDD:224420"
     gene            complement(399655..399876)
                     /locus_tag="Caur_0310"
                     /db_xref="GeneID:5827819"
     CDS             complement(399655..399876)
                     /locus_tag="Caur_0310"
                     /note="KEGG: rca:Rcas_1373 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633950.1"
                     /db_xref="GI:163845906"
                     /db_xref="GeneID:5827819"
                     /translation="MTELGRWLIGAGVILVVIGLVVLAAGRLPWLGRLPGDILIERDN
                     LTIFIPLGTMLVVSLILTVIANLIARWWR"
     sig_peptide     complement(399802..399876)
                     /locus_tag="Caur_0310"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.883) with cleavage site probability 0.872 at
                     residue 25"
     misc_feature    complement(399673..399867)
                     /locus_tag="Caur_0310"
                     /note="Protein of unknown function (DUF2905); Region:
                     DUF2905; pfam11146"
                     /db_xref="CDD:256316"
     gene            400127..401062
                     /locus_tag="Caur_0311"
                     /db_xref="GeneID:5827820"
     CDS             400127..401062
                     /locus_tag="Caur_0311"
                     /note="PFAM: band 7 protein;
                     KEGG: rca:Rcas_2987 band 7 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633951.1"
                     /db_xref="GI:163845907"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="GeneID:5827820"
                     /translation="MNQNRQPFPTSTMRGWSMSAAVGIVLLIMIAIFVVSNSVTTIEA
                     GTRGVLKTFGEITGVLDEGLHFRTPFITSVTVVEVRTQRYESNSSAASRDLQTVTTQV
                     VINYRPDASQVDRLVREIGVDYERRVVDPAIQEALKAATARFTAEELITRRPEVSDLI
                     LNILSERLTPRGVIVESVSITDFNFSPEFARAIEAKQVAEQDALRAARELERARIEAQ
                     QQVARAEAEAKARLEIARAEAESLRLLGEVVSPQLLQLRFIERWDGILPRLVSGDNGL
                     LTMLSIPTDGMLGETPTAQPTPPNSEQPTGTTGGE"
     sig_peptide     400127..400243
                     /locus_tag="Caur_0311"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.936) with cleavage site probability 0.403 at
                     residue 39"
     misc_feature    400190..401011
                     /locus_tag="Caur_0311"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    400241..400849
                     /locus_tag="Caur_0311"
                     /note="Prohibitin family; SPFH (stomatin, prohibitin,
                     flotillin, and HflK/C) superfamily; Region:
                     SPFH_prohibitin; cd03401"
                     /db_xref="CDD:259799"
     gene            401713..403020
                     /locus_tag="Caur_0312"
                     /db_xref="GeneID:5827821"
     CDS             401713..403020
                     /locus_tag="Caur_0312"
                     /note="PFAM: periplasmic binding protein;
                     KEGG: rrs:RoseRS_3086 periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein"
                     /protein_id="YP_001633952.1"
                     /db_xref="GI:163845908"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:5827821"
                     /translation="MRRFLFRILALVLIHLLVACGNQQTSSPTLTAVPTNSTAAMTAP
                     TATAIPTVVPTVAPTVAVLEPPTANLTDECVSEFDPEIDYFPEKVTLSDATGWTIEYF
                     NHYKVITVLNPWRNADTQFQYILVQCGTPPPPASDNALIIEIPVQRVIAMSTTQLPHL
                     DGLGVLDKLIGVDSFLYINNEAVRKKIDAGELVEIGSGGQVNVEQALDLEPDLIMTYG
                     VGNPEYDAHPKLLEAGLNVVLNSEYMEGSPLGRAEWIKFTAAFFNQEAKANELYTAIA
                     QRYRDIAAKARAVAEKPTVFANAPFRGTWYMPGGKSYVAQLLADAGANYLWADDTSSG
                     SQQLSFEEVFERAQNASFWLNPGSAKSLSELQQMDERFTQFAAFQNGAVFNNNKRLNE
                     NGGNDYWETGVTNPHLILADLIKIFHPELLPDHELFFYQQLTP"
     sig_peptide     401713..401790
                     /locus_tag="Caur_0312"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.958) with cleavage site probability 0.374 at
                     residue 26"
     misc_feature    402127..402699
                     /locus_tag="Caur_0312"
                     /note="Periplasmic binding protein TroA_d.  These proteins
                     are predicted to function as initial receptors in the ABC
                     metal ion uptake in eubacteria and archaea.  They belong
                     to the TroA superfamily of helical backbone metal receptor
                     proteins that share a...; Region: TroA_d; cd01141"
                     /db_xref="CDD:238561"
     misc_feature    402157..402882
                     /locus_tag="Caur_0312"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    402259..402261
                     /locus_tag="Caur_0312"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238561"
     gene            403030..403359
                     /locus_tag="Caur_0313"
                     /db_xref="GeneID:5827822"
     CDS             403030..403359
                     /locus_tag="Caur_0313"
                     /note="KEGG: rrs:RoseRS_3087 ferredoxin-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-like protein"
                     /protein_id="YP_001633953.1"
                     /db_xref="GI:163845909"
                     /db_xref="GeneID:5827822"
                     /translation="MSKPQMNPYVRHIFICTGRYCDPEGTAPQLYAQLAQLLGPLGNY
                     HNPCRVKRGTTPCLGVCSAGPIVVIYPEGIWYHHVDKTVLERIVREHLVQNRPVVEHI
                     FHQLHEQ"
     misc_feature    403060..403302
                     /locus_tag="Caur_0313"
                     /note="Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd)
                     family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like
                     Fds) and proteins containing domains similar to TRX-like
                     Fd including formate dehydrogenases, NAD-reducing
                     hydrogenases and the subunit E of NADH:...; Region:
                     TRX_Fd_family; cd02980"
                     /db_xref="CDD:239278"
     misc_feature    order(403063..403065,403069..403071,403189..403197)
                     /locus_tag="Caur_0313"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239278"
     misc_feature    order(403075..403077,403090..403092,403198..403200,
                     403210..403212)
                     /locus_tag="Caur_0313"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239278"
     gene            403374..404462
                     /locus_tag="Caur_0314"
                     /db_xref="GeneID:5827823"
     CDS             403374..404462
                     /locus_tag="Caur_0314"
                     /note="PFAM: transport system permease protein;
                     KEGG: rrs:RoseRS_3088 transport system permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_001633954.1"
                     /db_xref="GI:163845910"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:5827823"
                     /translation="MSMTKTLSAAIQSTRWPRPGLQPLVLLAMVGVTLCIFLLSLSLG
                     SVSIPPEQVLSILLYQEAERKSWVTIIYDFRLPKALTAALAGAALGVSGLQMQTLFRN
                     PLADPFVLGISSGASLGVAIVVLSVGAANTALLAVAGLLGNVSLVVAASLGAGMVMMI
                     ILTLAQRVRSSITLLILGLMIGYVTSAVVSLLLYFSIAERIQAYIAWSFGNFGGVTWS
                     QMQVLAPTIGIGLILALLLTKVLNALLLGEAYARSMGMDIQLARCGIVLSSSVLAGTI
                     TAFCGPIAFLGIAIPHLCRALFRTADHRILLPACMWIGATIALLGDLIAQVPGYSIVL
                     PLNAINALFGAPIVMWVVLQRYRGVFGL"
     sig_peptide     403374..403517
                     /locus_tag="Caur_0314"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.723) with cleavage site probability 0.283 at
                     residue 48"
     misc_feature    403644..404429
                     /locus_tag="Caur_0314"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(403662..403664,403674..403682,404076..404081,
                     404085..404093,404097..404102,404106..404123,
                     404127..404135,404256..404258,404280..404282)
                     /locus_tag="Caur_0314"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(403677..403679,403683..403685,403698..403700,
                     403890..403892,403896..403901,403908..403913,
                     403920..403925,403932..403934,403941..403946,
                     403950..403952,403983..403988,403998..404000,
                     404226..404228,404385..404387,404394..404399,
                     404406..404408,404415..404420,404427..404429)
                     /locus_tag="Caur_0314"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(403950..403952,404028..404030,404202..404204,
                     404214..404216,404349..404351,404376..404378)
                     /locus_tag="Caur_0314"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            404459..405535
                     /locus_tag="Caur_0315"
                     /db_xref="GeneID:5827658"
     CDS             404459..405535
                     /locus_tag="Caur_0315"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: rrs:RoseRS_3089 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001633955.1"
                     /db_xref="GI:163845911"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:5827658"
                     /translation="MSRSILVTEHLRIGYANRRGEARVVADQLNLTLNEGDVVCLLGP
                     NGIGKSTLLRTLIGMQAPLAGRVLLDGIDIATLKPRDIARRVSVVLTERIEVGQLSVY
                     HLVALGRYPYTNWIGKLTPHDEEVIQRALSAVQAEQLAGRFVHELSDGERQRVMVARA
                     LAQEPHVMVLDEPMAFLDLPRRIEMMRLLRRLAHEMRQAVILSIHDLDLAIRTADLLW
                     LMTPDGKIQAGAPEDLVLSGAFEKAFAGNNLVFDRFHGQFRLHEPPSRHAVLLGDGLI
                     YKWTMHALERAGYQCNQADDTAALHITIHGNEQNPLWLMQLNRQTVKNFHSLRDLVTF
                     LRGMPYPYQSQETSDDDHEPIFHR"
     misc_feature    404468..405190
                     /locus_tag="Caur_0315"
                     /note="iron-dicitrate transporter ATP-binding subunit;
                     Provisional; Region: fecE; PRK11231"
                     /db_xref="CDD:183044"
     misc_feature    404483..405142
                     /locus_tag="Caur_0315"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    404585..404608
                     /locus_tag="Caur_0315"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(404594..404599,404603..404611,404729..404731,
                     404969..404974,405071..405073)
                     /locus_tag="Caur_0315"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    404720..404731
                     /locus_tag="Caur_0315"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    404897..404926
                     /locus_tag="Caur_0315"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    404957..404974
                     /locus_tag="Caur_0315"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    404981..404992
                     /locus_tag="Caur_0315"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    405059..405079
                     /locus_tag="Caur_0315"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            405504..406079
                     /locus_tag="Caur_0316"
                     /db_xref="GeneID:5827659"
     CDS             405504..406079
                     /locus_tag="Caur_0316"
                     /note="KEGG: rrs:RoseRS_3090 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633956.1"
                     /db_xref="GI:163845912"
                     /db_xref="GeneID:5827659"
                     /translation="MTTTNQSFIVEEPGNGTLEIFPLQPDEAALTALMTELFRDHWDK
                     IHFGPLIQGAVFEIKVTQPPQRIGMLDGYLTVDFGVWHFHLCIGEHKGSKTRPVDPEL
                     ARHRRTGRAEFYRRLNPDGTVGSWGIRLFNGKGENQIYIFLPNPFLTDEMKFRREPDW
                     SRLELWDDLRQRYLGLPPDPKDRSGRTMFHG"
     gene            complement(406302..406709)
                     /locus_tag="Caur_0317"
                     /db_xref="GeneID:5827660"
     CDS             complement(406302..406709)
                     /locus_tag="Caur_0317"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633957.1"
                     /db_xref="GI:163845913"
                     /db_xref="GeneID:5827660"
                     /translation="MCRKLTILARDSATRIVAQCEHGTIHLYWTRAALFLHPAELMPL
                     LALVQCWKPEFDEARSEPFLIIRQPDGSLHLWYHEIGVCLSQSDLYDLAALLWHAAAR
                     LKLLSPDSSPPPRHPLEPSRPVTCVLPRPEWRN"
     gene            complement(406719..407675)
                     /locus_tag="Caur_0318"
                     /db_xref="GeneID:5827661"
     CDS             complement(406719..407675)
                     /locus_tag="Caur_0318"
                     /note="PFAM: periplasmic binding protein;
                     KEGG: ana:alr2583 iron(III) dicitrate transport system
                     substrate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein"
                     /protein_id="YP_001633958.1"
                     /db_xref="GI:163845914"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:5827661"
                     /translation="MHRMVLFAILVLLLLSACTSSTSTAQSLEVVSTTDSYRLIRHVF
                     GETQVPLNPSRVLALGEEGLLIDLIDSGMRPVAASVNLPDRVPLLSAEELAGIELFPS
                     AGDISLETLSTYQPDFIIGTEFFIDQIGYRQLSQIAPTVALSGATPLTQYIETLTVFG
                     RAEEALREVDALRAEIQRVAIARGTATQRVSLVTVYPGMNVALWFDGPSPIPLLVRAL
                     GLQIRPDPTTTTDLNIRNGRAFISLEQLSMADGDMIFLLQTADVEGEASAVAEMMDHP
                     LWQQLPAVQAQRVVELDRIGFPGLRGQRVLLTMLEEILASGT"
     sig_peptide     complement(407598..407675)
                     /locus_tag="Caur_0318"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.963 at
                     residue 26"
     misc_feature    complement(406755..407522)
                     /locus_tag="Caur_0318"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    complement(406797..407510)
                     /locus_tag="Caur_0318"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    complement(order(407268..407270,407277..407282))
                     /locus_tag="Caur_0318"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            complement(407692..408267)
                     /locus_tag="Caur_0319"
                     /db_xref="GeneID:5827662"
     CDS             complement(407692..408267)
                     /locus_tag="Caur_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633959.1"
                     /db_xref="GI:163845915"
                     /db_xref="GeneID:5827662"
                     /translation="MPRLDKSVPTTADPLRWLSRDWLLVGNIGLLSGLLLSGLFWLVL
                     LPLVHLWLGVIGLLPLVIGMALIWFPGALAAVAVGKPGAALAVQVPQAIVLLLLTPID
                     GEVLLVCTFFALVAEPVIALCTRYRRLTPARLGWCGLFVGVGMVILFGWLFPFVFTSL
                     PLSAMIGCSAVGLTCLLGICAGWIGQRWLKA"
     gene            complement(408360..408932)
                     /locus_tag="Caur_0320"
                     /db_xref="GeneID:5827663"
     CDS             complement(408360..408932)
                     /locus_tag="Caur_0320"
                     /note="TIGRFAM: flavodoxin;
                     PFAM: flavodoxin/nitric oxide synthase;
                     KEGG: cyb:CYB_2267 flavodoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="YP_001633960.1"
                     /db_xref="GI:163845916"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010086"
                     /db_xref="GeneID:5827663"
                     /translation="MIAVVYGSSTDNTKGAASLIADMLRAKTTVPVDLIDVATVKRDL
                     RPLLRYWVWIIGCPTWNIGELQDDWYDAFPLLDQLDLQGTIVALFGFGDQQGYPDTFQ
                     DALGILGRKVRERGAMIIGRWPIDGYDFFHSLGVEDGMFFGLALDYENEDEKTIARLQ
                     AWVDQLLSELAAHPEGIVRRDVSGTHLIHP"
     misc_feature    complement(408417..408932)
                     /locus_tag="Caur_0320"
                     /note="flavodoxin FldA; Validated; Region: PRK09267"
                     /db_xref="CDD:236439"
     gene            409856..410476
                     /locus_tag="Caur_0321"
                     /db_xref="GeneID:5827664"
     CDS             409856..410476
                     /locus_tag="Caur_0321"
                     /note="KEGG: bcl:ABC0821 restriction endonuclease R XbaI"
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease R XbaI"
                     /protein_id="YP_001633961.1"
                     /db_xref="GI:163845917"
                     /db_xref="REBASE:CauJORF322P"
                     /db_xref="GeneID:5827664"
                     /translation="MESVTDKIRSLASKYAQELQHKIETRTKELESDDQSHYLIYKVL
                     GIQDDEGRLIDLYQNKGRFLYKYAGAFLEEATFLCFKERFPHARRAQVENTSGQRPRQ
                     FHIDCLIDREAIEIKWRDATTDGDHIIKEHARIKVIKDHGFYPVRVMFFYPNREQAKR
                     IQETIKTVYQGIGGACYTGDDAWEYVRTRTGIDLKVILVNIAKDLQ"
     misc_feature    409862..410428
                     /locus_tag="Caur_0321"
                     /note="ApaLI-like restriction endonuclease; Region:
                     RE_ApaLI; pfam09499"
                     /db_xref="CDD:118036"
     gene            410488..411690
                     /locus_tag="Caur_0322"
                     /db_xref="GeneID:5827665"
     CDS             410488..411690
                     /locus_tag="Caur_0322"
                     /note="PFAM: DNA methylase N-4/N-6 domain protein;
                     KEGG: bcl:ABC0822 adenine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4/N-6 domain-containing protein"
                     /protein_id="YP_001633962.1"
                     /db_xref="GI:163845918"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002295"
                     /db_xref="InterPro:IPR002941"
                     /db_xref="GeneID:5827665"
                     /translation="MTVLCGDCRIVLQSINDSSIDLVYMDPPFFTQKTHALVNRDGNA
                     SYSFEDTWESIETYLAFMREVLIQCKRVLKDTGSIFVHCDRSASHHLRVLLDQIFGPE
                     HFQSEIIWTYRRWSNSKKGLLPAHQTIYFYSKTENFKFNVLFTDYSPTTNIDQILQAR
                     ARNEKGKSVYRRDQHGNIVAGKEKKGVPLSDVWYIPFLNPKAKERVGYPTQKPVLLLE
                     RIIKIATDSGDSVLDPFCGSGTTLVAAKLLGRTYIGIDISREAVSLSEERLRQPIKSE
                     SQLLVVGEEGFRMKSNYERNLLKALDAVPVERNSGIDGFLFIDEQPIPVRIQKDDEDI
                     ATARQKLKAASRAKQCSSMILIRTKTENNLCLFETEDDDVLVIDAYDLIIRSWLHKRK
                     YRKKTTVS"
     misc_feature    <410524..>411327
                     /locus_tag="Caur_0322"
                     /note="Adenine specific DNA methylase Mod [DNA
                     replication, recombination, and repair]; Region: COG2189"
                     /db_xref="CDD:225100"
     misc_feature    410545..411288
                     /locus_tag="Caur_0322"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     misc_feature    411178..>411300
                     /locus_tag="Caur_0322"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(411187..411207,411253..411258)
                     /locus_tag="Caur_0322"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(412364..413473)
                     /locus_tag="Caur_0323"
                     /db_xref="GeneID:5827666"
     CDS             complement(412364..413473)
                     /locus_tag="Caur_0323"
                     /note="PFAM: ABC transporter related; Transport-associated
                     OB domain protein;
                     SMART: AAA ATPase;
                     KEGG: hma:rrnAC0908 spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_001633963.1"
                     /db_xref="GI:163845919"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="GeneID:5827666"
                     /translation="MNFSAEPALQLQNVTRRYGKVVAVNNVSLAAAQGECLVIVGPSG
                     CGKTTLLRLIAGLDVQDEGSIKIQNRIVSGKGVFVPPEKRRVGLVFQDYALFPHMTIA
                     RNVAFGLHGRSKADVQRRVYEMLEMVHLAHMADRYPHELSGGERQRVALARALAPQPD
                     ILLLDEPFSSLDAGLRTAMREQLQSLLKEINITTFFVTHDQEEALLLGNRVAVVNQGR
                     IEQIGTPEQVFHQPATHFVAEFFGYTVFISGRATADGLETELGFLPQRLSLDSGAEVN
                     ILVRPDDLTVYPDETGQAYIARTGFQGMHCMYQIALPSGRTIYSLMPHTRIYAPGTRV
                     RVELHPGHDLVCFRNGRAVTDVGRGEGVEEIENRR"
     misc_feature    complement(412439..413464)
                     /locus_tag="Caur_0323"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(412805..413449)
                     /locus_tag="Caur_0323"
                     /note="ATP-binding cassette domain of the carbohydrate and
                     solute transporters-like; Region: ABC_Carb_Solutes_like;
                     cd03259"
                     /db_xref="CDD:213226"
     misc_feature    complement(413330..413353)
                     /locus_tag="Caur_0323"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(order(412877..412879,412976..412981,
                     413201..413203,413327..413335,413339..413344))
                     /locus_tag="Caur_0323"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(413201..413212)
                     /locus_tag="Caur_0323"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(413024..413053)
                     /locus_tag="Caur_0323"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(412976..412993)
                     /locus_tag="Caur_0323"
                     /note="Walker B; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(412958..412969)
                     /locus_tag="Caur_0323"
                     /note="D-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(412871..412891)
                     /locus_tag="Caur_0323"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(412448..412645)
                     /locus_tag="Caur_0323"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(413496..415220)
                     /locus_tag="Caur_0324"
                     /db_xref="GeneID:5827667"
     CDS             complement(413496..415220)
                     /locus_tag="Caur_0324"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hha:Hhal_1189 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_001633964.1"
                     /db_xref="GI:163845920"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:5827667"
                     /translation="MRSMIVPLTRRYWNVMLIKRQQLAGNWSLPDRWSIIAFLIAGLA
                     LLPIAIILRMLVQPAPDVWQHLWATRLAEFLSNTVVLLIRVGLGTTLLGTALAWLVTA
                     YRFPGQRLFDWALMLPMAVPSYVLAFVFMATFDYAGPVQKALRAWFGSSAWFPSIRSG
                     GGAIFVMTLTLYPYVYLLARAAFHEHGRGTFEVARTLGVTRLQAFLRVVLPMARPSLV
                     AGLSLVLMEVLTDVGTVRFLNFPTLSDGIFRIWHGMMDRDAALQSAAVLLLFAFGALL
                     IERYTRGRARYVQEGSRGHGLAQVPLTGWRALAATLVCSFVLATAFLLPVSQLIQWSV
                     HELWHRMPEGLLAIYWRHVRATLILAGAGAVISVLAAVLLAYGTHLSRSPVTRLAARG
                     ATLGYAIPGAVIGLGVLLPLSWLDHTLNDVTYQWWGVLPGLIFTGSITGLIYAYVVRF
                     MAVAHSSVEASLEKISPGIEAAARTLGARPIRVLWHVHLPLIRAGMLTGAALVFVDVM
                     KELPITLLLRPFGYETLALWIWQNVAESLWSEAALPALTIVVADLLVVGILIRSATLR
                     GRHSIERT"
     misc_feature    complement(413514..415142)
                     /locus_tag="Caur_0324"
                     /note="ABC-type Fe3+ transport system, permease component
                     [Inorganic ion transport and metabolism]; Region: ThiP;
                     COG1178"
                     /db_xref="CDD:224099"
     misc_feature    complement(<414507..414998)
                     /locus_tag="Caur_0324"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(414510..414515,414522..414533,
                     414552..414554,414561..414566,414606..414608,
                     414657..414659,414666..414671,414681..414683,
                     414687..414692,414699..414701,414708..414713,
                     414828..414830,414834..414839,414846..414875,
                     414879..414890,414918..414920,414933..414938,
                     414945..414950))
                     /locus_tag="Caur_0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(414516..414533,414828..414872))
                     /locus_tag="Caur_0324"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(414513..414515,414726..414728,
                     414828..414830))
                     /locus_tag="Caur_0324"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(414585..414587,414597..414602,
                     414618..414656))
                     /locus_tag="Caur_0324"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(413562..414161)
                     /locus_tag="Caur_0324"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(413562..413567,413574..413579,
                     413586..413591,413595..413600,413607..413612,
                     413640..413645,413673..413678,413685..413696,
                     413715..413717,413724..413729,413769..413771,
                     413820..413822,413829..413834,413886..413888,
                     413892..413897,413904..413906,413910..413912,
                     413916..413921,413994..413996,414000..414005,
                     414012..414041,414045..414056,414084..414086,
                     414099..414104,414111..414116))
                     /locus_tag="Caur_0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(413679..413696,413994..414038))
                     /locus_tag="Caur_0324"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(413610..413612,413640..413642,
                     413649..413651,413676..413678,413934..413936,
                     413994..413996))
                     /locus_tag="Caur_0324"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(413748..413750,413760..413765,
                     413781..413819))
                     /locus_tag="Caur_0324"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(415261..416391)
                     /locus_tag="Caur_0325"
                     /db_xref="GeneID:5827668"
     CDS             complement(415261..416391)
                     /locus_tag="Caur_0325"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: nmu:Nmul_A0732 extracellular solute-binding protein,
                     family 1"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_001633965.1"
                     /db_xref="GI:163845921"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="InterPro:IPR011587"
                     /db_xref="GeneID:5827668"
                     /translation="MLFTRRKKAGITLVGFILLVVSLVACTNQSASQTAPQTIRETVV
                     VTQEVPVRETVVVRETVEVPVEEPIVYVYSARHYGQMETAFAEFTKETGIEVRFTFGS
                     DAELRERLKAEGRFTPADVLFTVDAANLWLAAQEGLLRPINSDVLESNIPDYLQDPSN
                     QWYALSLRVRTIAYHPDRVNPEEIATYESLADPKWAGRICWRPSTKSYTQSLVSSLIV
                     HHGYDKAKEIVTGWAQNAKEYIDSDTRILQTIAEGGCDISVVNHYYLARLLSEDANYP
                     VKLLWANQAEQGVHVNASGAGVTTYARHPENAIRLLEWLSTERGQRLFADSNFEYPAN
                     PNVAPHELIQQWGDFKRDTLQISEIGSLQADAIKLMNEAGYQ"
     sig_peptide     complement(416296..416391)
                     /locus_tag="Caur_0325"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.310 at
                     residue 32"
     misc_feature    complement(415270..416139)
                     /locus_tag="Caur_0325"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            complement(416608..417420)
                     /locus_tag="Caur_0326"
                     /db_xref="GeneID:5827669"
     CDS             complement(416608..417420)
                     /locus_tag="Caur_0326"
                     /note="KEGG: rrs:RoseRS_4462 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633966.1"
                     /db_xref="GI:163845922"
                     /db_xref="GeneID:5827669"
                     /translation="MQQHNSAATTKPAPVRLRPIALPIEHGGWSMVGAPIALGLWLAP
                     SPAGFWLSLAALGAFLGRQPLKLAISDYRRGKRYPRTVWAERFVLGYGAITLIAVGMA
                     WWYAAFSFWPPIILAVPFAVVQLFFDLRKQSRALLAELAGAIAISALAAVIVMAAGWT
                     LWSALGLWLLLSLQAVTAIVYVRIRLRLARNEPAHRAPALILHLAALVTVAGLLSIGW
                     VSWPVLLVFALLFMRCWIGLSPRSLATPTPLVGVQEVIVALLVVVGIRFGLS"
     misc_feature    complement(416953..417357)
                     /locus_tag="Caur_0326"
                     /note="YwiC-like protein; Region: YwiC; pfam14256"
                     /db_xref="CDD:258442"
     gene            complement(417462..417782)
                     /locus_tag="Caur_0327"
                     /db_xref="GeneID:5827670"
     CDS             complement(417462..417782)
                     /locus_tag="Caur_0327"
                     /note="PFAM: Cupin 2 conserved barrel domain protein;
                     KEGG: rca:Rcas_0816 cupin 2 conserved barrel domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="YP_001633967.1"
                     /db_xref="GI:163845923"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:5827670"
                     /translation="MNPATVRHVLEQISIPDDSTISRTIYQDDQIKAVLFGFAAGQEL
                     SEHTAATPAIMHFVQGEARVTLGQEVVEAKPGTWVHMPAHLPHSIQAHTPVIMLLLLL
                     RGTR"
     misc_feature    complement(417477..>417704)
                     /locus_tag="Caur_0327"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            419279..420406
                     /locus_tag="Caur_0328"
                     /db_xref="GeneID:5827671"
     CDS             419279..420406
                     /locus_tag="Caur_0328"
                     /note="PFAM: pyruvate carboxyltransferase;
                     KEGG: afw:Anae109_2393 homocitrate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxyltransferase"
                     /protein_id="YP_001633968.1"
                     /db_xref="GI:163845924"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="GeneID:5827671"
                     /translation="MSLPERLFFVDTTLREGEQFASARFTTAQRIAIAEMLDAFGVEY
                     IELTSPAASPQSARDLATIARRGLRARILTHIRCHMADARLAVEHGAQGANLLFATSE
                     PLRTVSHGRSLSEILAEAKRVICYLRDHDIEVRFSCEDSFRTDLADLIRIYRAVETMG
                     VQRVGLADTVGIATPRQVYDVVRAVRNEVQCDIEFHGHNDSGCAIANTFSAYEAGATH
                     LDVTVLGIGERNGIASLSGMIARIASIDPSRVQRYRLDLLPKIDETVATMLGIEIPFN
                     QCITSPTAFHHKAGMHTKAVLSDPRSYEVLDPNLFGRQRTIAIAHRLVGWHAVAERAR
                     ELGITLSEAQARAAAARIKALGDEHDLDGAMIDEILYSYAE"
     misc_feature    419297..420079
                     /locus_tag="Caur_0328"
                     /note="Saccharomyces cerevisiae homocitrate synthase and
                     related proteins, catalytic TIM barrel domain; Region:
                     DRE_TIM_HCS; cd07948"
                     /db_xref="CDD:163685"
     misc_feature    419306..420340
                     /locus_tag="Caur_0328"
                     /note="homocitrate synthase; Region: LysS_fung_arch;
                     TIGR02146"
                     /db_xref="CDD:162728"
     misc_feature    order(419321..419326,419333..419335,419414..419416,
                     419501..419503,419507..419509,419693..419695,
                     419777..419779,419864..419866,419870..419872)
                     /locus_tag="Caur_0328"
                     /note="active site"
                     /db_xref="CDD:163685"
     misc_feature    order(419321..419326,419414..419416)
                     /locus_tag="Caur_0328"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163685"
     misc_feature    order(419324..419326,419777..419779,419864..419866,
                     419870..419872)
                     /locus_tag="Caur_0328"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163685"
     gene            420422..421678
                     /locus_tag="Caur_0329"
                     /db_xref="GeneID:5827672"
     CDS             420422..421678
                     /locus_tag="Caur_0329"
                     /EC_number="4.2.1.33"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="YP_001633969.1"
                     /db_xref="GI:163845925"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006251"
                     /db_xref="InterPro:IPR011826"
                     /db_xref="GeneID:5827672"
                     /translation="MPTMSEQILSRVAGRTVRAGDVVTANVDLVMVHDSLAPGIIRIL
                     HQELGAERVWDPQRVAVVIDHVAPAASVQTAEKQQEVRRWVRAQGIPHLFDVGRGISH
                     PVLVEEGLAQPGMLILGSDSHSTAYGCVGAFGTGMGSTDIALALATGKTWLRVPETIV
                     VRARGRFGFGVGPKDLALRAARLLRADGATYAAIEWHGVEFLSVMERMTLATLSIEMG
                     AKAGIVPPTGLNVTGPLLPTVTADAGYQEVVEIDLDQLEPQVSAPHYVDNVANLSDLG
                     RVAVDVVYLGTCTNGHYEDMAVAAQILAGRRLAPGVRMIVVPASAQALQRAAADGTLA
                     TLLAAGATIGTPGCGACIGRHMGVLAPGEVCLFTGNRNFRGRMGSPEAQIYLASPAVA
                     AATALTGYLTDPRTVMDGQPAIASRN"
     misc_feature    420422..421645
                     /locus_tag="Caur_0329"
                     /note="3-isopropylmalate dehydratase large subunit;
                     Reviewed; Region: PRK00402"
                     /db_xref="CDD:234748"
     misc_feature    order(420518..420520,420527..420529,420782..420787,
                     421475..421477,421532..421534,421547..421549)
                     /locus_tag="Caur_0329"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153129"
     misc_feature    order(420788..420790,421283..421285,421463..421465,
                     421472..421477,421529..421531)
                     /locus_tag="Caur_0329"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153129"
     gene            421701..422201
                     /gene="leuD"
                     /locus_tag="Caur_0330"
                     /db_xref="GeneID:5827943"
     CDS             421701..422201
                     /gene="leuD"
                     /locus_tag="Caur_0330"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="YP_001633970.1"
                     /db_xref="GI:163845926"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR011827"
                     /db_xref="GeneID:5827943"
                     /translation="MARVWLFGPDINTDQIVPGRYAPYMLKDESELRRYPFIEHRPDF
                     AANVRPGDIIVAGKNFGCGSSREYAPLALRMVGIGAIIAPLFARIFFRNALNLGIPCF
                     TADLTGELADGDEVELDLEQGRITTADGRVIHLPPPPLFLREVWAAGGIVPFYRTYGR
                     FPGEVA"
     misc_feature    421716..422060
                     /gene="leuD"
                     /locus_tag="Caur_0330"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    421890..421898
                     /gene="leuD"
                     /locus_tag="Caur_0330"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            422201..423199
                     /locus_tag="Caur_0331"
                     /db_xref="GeneID:5827944"
     CDS             422201..423199
                     /locus_tag="Caur_0331"
                     /EC_number="1.1.1.85"
                     /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
                     KEGG: rrs:RoseRS_1057 3-isopropylmalate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="YP_001633971.1"
                     /db_xref="GI:163845927"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="GeneID:5827944"
                     /translation="MQICVIPGDGIGPEVIAVATAALRVLAPDLTIKEAEAGWAVFQR
                     TGTALPETTLALAREATAILFGAVASPSHPVPGYRSPIVELRRTLDLYANIRPTVGNE
                     VDLVVVRENTEDLYIGRERLEDDGATAIAERVITRAASARIVRTACELARTRQAYGHP
                     GKVTIVHKANVLRVSDGLFRTVALEVAADYPELTFEERLVDVAAMQLAAQPQRFDVIV
                     TTNMFGDILSDIACIHGGGLGVAASSNLGHGRALFEPVHGAAPDIAGRGIANPTAALN
                     CVVMLLDWIGRPHAAERLRSAITAVAAAGIRTPDVGGQATTREVADEILNQLSAQM"
     misc_feature    422201..423184
                     /locus_tag="Caur_0331"
                     /note="Isocitrate/isopropylmalate dehydrogenase [Amino
                     acid transport and metabolism]; Region: LeuB; COG0473"
                     /db_xref="CDD:223549"
     gene            423214..423381
                     /locus_tag="Caur_0332"
                     /db_xref="GeneID:5827945"
     CDS             423214..423381
                     /locus_tag="Caur_0332"
                     /note="TIGRFAM: lysine biosynthesis protein LysW;
                     KEGG: rca:Rcas_3470 lysine biosynthesis protein LysW"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysW"
                     /protein_id="YP_001633972.1"
                     /db_xref="GI:163845928"
                     /db_xref="InterPro:IPR005906"
                     /db_xref="GeneID:5827945"
                     /translation="MHAECPECVAQITLPASTLESEIVACPDCGAELEVVSLNPPTLA
                     LAPEVEEDWGE"
     misc_feature    423220..423378
                     /locus_tag="Caur_0332"
                     /note="Lysine biosynthesis protein LysW; Region: LysW;
                     cd13946"
                     /db_xref="CDD:260118"
     misc_feature    order(423226..423228,423235..423237,423289..423291,
                     423298..423300)
                     /locus_tag="Caur_0332"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:260118"
     misc_feature    order(423232..423240,423262..423264,423271..423282,
                     423298..423303,423313..423315,423319..423321,
                     423343..423345,423352..423354,423361..423378)
                     /locus_tag="Caur_0332"
                     /note="ArgX binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:260118"
     misc_feature    423376..423378
                     /locus_tag="Caur_0332"
                     /note="AAA attachment site [active]"
                     /db_xref="CDD:260118"
     gene            423425..423592
                     /locus_tag="Caur_0333"
                     /db_xref="GeneID:5827946"
     CDS             423425..423592
                     /locus_tag="Caur_0333"
                     /note="TIGRFAM: lysine biosynthesis protein LysW;
                     KEGG: rca:Rcas_3470 lysine biosynthesis protein LysW"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysW"
                     /protein_id="YP_001633973.1"
                     /db_xref="GI:163845929"
                     /db_xref="InterPro:IPR005906"
                     /db_xref="GeneID:5827946"
                     /translation="MQAECPECGATIALPAGTMANEIVACPDCGAELEVVNLDPPTLA
                     LAPEVEEDWGE"
     misc_feature    423431..423589
                     /locus_tag="Caur_0333"
                     /note="Lysine biosynthesis protein LysW; Region: LysW;
                     cd13946"
                     /db_xref="CDD:260118"
     misc_feature    order(423437..423439,423446..423448,423500..423502,
                     423509..423511)
                     /locus_tag="Caur_0333"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:260118"
     misc_feature    order(423443..423451,423473..423475,423482..423493,
                     423509..423514,423524..423526,423530..423532,
                     423554..423556,423563..423565,423572..423589)
                     /locus_tag="Caur_0333"
                     /note="ArgX binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:260118"
     misc_feature    423587..423589
                     /locus_tag="Caur_0333"
                     /note="AAA attachment site [active]"
                     /db_xref="CDD:260118"
     gene            423655..424503
                     /locus_tag="Caur_0334"
                     /db_xref="GeneID:5827947"
     CDS             423655..424503
                     /locus_tag="Caur_0334"
                     /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
                     lysine biosynthesis enzyme LysX;
                     PFAM: ATP-dependent carboxylate-amine ligase domain
                     protein ATP-grasp; protein of unknown function DUF201;
                     RimK domain protein ATP-grasp;
                     KEGG: rca:Rcas_3469 lysine biosynthesis enzyme LysX"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysX"
                     /protein_id="YP_001633974.1"
                     /db_xref="GI:163845930"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR003806"
                     /db_xref="InterPro:IPR004666"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011870"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="GeneID:5827947"
                     /translation="MRIAVLCSRIRAEEKLLFQELERRGLDYVKVDDREQIFDLHTTT
                     YPFDVVLERCIQHSRALYMLKIFNDAGVPTVNTYHVALTCGDKFLTTQALIHAGVPTP
                     RCLLAFTPESALEAMEQLGYPVVLKPVIGSWGRMVSKINDRDAAEAILEHRDVLGNYQ
                     HSIFYIQQYIHKPGRDIRSFVIGDECIAAIYRTSPHWITNTARGGVATNCPVTPELAD
                     ISVRAAHAVGGGVVAIDLLETPEGELLVNEVNYTMEFRNSIDTTGVDIPARIIDYVLE
                     VGRGRG"
     misc_feature    423661..424491
                     /locus_tag="Caur_0334"
                     /note="Lysine biosynthesis enzyme LysX; Region: LysX_arch;
                     TIGR02144"
                     /db_xref="CDD:131199"
     misc_feature    423907..424476
                     /locus_tag="Caur_0334"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            424633..425667
                     /locus_tag="Caur_0335"
                     /db_xref="GeneID:5827948"
     CDS             424633..425667
                     /locus_tag="Caur_0335"
                     /EC_number="1.2.1.38"
                     /note="KEGG: rrs:RoseRS_1060
                     N-acetyl-gamma-glutamyl-phosphate reductase;
                     TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase;
                     PFAM: Semialdehyde dehydrogenase NAD - binding;
                     Semialdehyde dehydrogenase dimerisation region"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="YP_001633975.1"
                     /db_xref="GI:163845931"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="GeneID:5827948"
                     /translation="MSLRVSIVGASGYVGGELLRLLLDHPHVSIIQATSARNAGRYLY
                     QVHPNLRGRTNLQFVHPDTLQPCDVLFLALPHGEAAQAIERYASLAERIIDCSADFRL
                     RDPAVYQQWYGSAHPAPAWLERFVYGLPEVNRAALTGARYASGVGCNATATNLALLPL
                     VEANLIDRSRPIIADVKVGSSEGGATVNEASHHPERSGAVRSFAPVGHRHLAEVEQVT
                     GLRNVHLSITAIELVRGALATVHAFASRELSEKELWQAYRTFAREQPFIRIVKERQGI
                     YRYPEPKILAGTNYADIGFAYEPATGRIVSICAIDNLMKGAAGSAVQCMNLMCGFAET
                     TALTFAGLHP"
     misc_feature    424633..425664
                     /locus_tag="Caur_0335"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Validated; Region: argC; PRK00436"
                     /db_xref="CDD:234761"
     misc_feature    424642..425052
                     /locus_tag="Caur_0335"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; smart00859"
                     /db_xref="CDD:214863"
     misc_feature    425101..425577
                     /locus_tag="Caur_0335"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; cl19935"
                     /db_xref="CDD:268288"
     gene            complement(425782..426054)
                     /locus_tag="Caur_0336"
                     /db_xref="GeneID:5827949"
     CDS             complement(425782..426054)
                     /locus_tag="Caur_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633976.1"
                     /db_xref="GI:163845932"
                     /db_xref="GeneID:5827949"
                     /translation="MEGYVRQRIEVLTARLNSLRPGLERARQSVARLENEAVPAGATA
                     LARAAQLSAARAMATTLAERERHLLIAIQALQAELADQTLTGHEQE"
     gene            complement(427180..428205)
                     /locus_tag="Caur_0337"
                     /db_xref="GeneID:5827950"
     CDS             complement(427180..428205)
                     /locus_tag="Caur_0337"
                     /note="PFAM: band 7 protein;
                     KEGG: rrs:RoseRS_3855 band 7 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633977.1"
                     /db_xref="GI:163845933"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="GeneID:5827950"
                     /translation="MSQRAPVRGSMTSRLSLVGGFILLLIIVGIGLSTMKYVQVDEGQ
                     AAIELVQGRIVAVHGPGPIFRPFAPFTEIELVNIRRQSRQISQNVASSDKQLYDIDIQ
                     VDFRRLPTEQALRAAYAEIGVSDAQLNDFLDGFINDALKSASTQFTLDEALSDRGAFA
                     ERIRRFLTTPPGDGQRAPVDQLYITIEAVKVLDIKVGETYAQLLAEKANLEVQIETEQ
                     KRRQQIEAQQANNLFQAEQEALVALTRERGITAAALEAANREAQVRAIEGRYWRENPE
                     LFELRKRELLVQMMANGNIWFVDPNTNLTLLLNNQAGEGQALVIPQPGAGQSVTPPAP
                     TEPSVSP"
     misc_feature    complement(427324..428157)
                     /locus_tag="Caur_0337"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    complement(427528..428094)
                     /locus_tag="Caur_0337"
                     /note="SPFH domain / Band 7 family; Region: Band_7;
                     pfam01145"
                     /db_xref="CDD:250396"
     gene            complement(428220..429239)
                     /locus_tag="Caur_0338"
                     /db_xref="GeneID:5827951"
     CDS             complement(428220..429239)
                     /locus_tag="Caur_0338"
                     /note="PFAM: glycosyl transferase family 2;
                     KEGG: rca:Rcas_1513 ribonuclease III"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001633978.1"
                     /db_xref="GI:163845934"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5827951"
                     /translation="MVKQQPTFSVVAPVYNEEQLIAEFCRRVIAALEPLGEPFELVLV
                     NDGCRDRSPEIMRELHQRDPRIKVINFSRNFGHQIAITAGTDYATGKAVIVIDSDLQD
                     PPEVIPELIARWREGYQVVYGVREEREGETWFKKTTAAIFYRLIVRITNVNIPVDTGD
                     FRLMDRKVVDALKRMREHHRFMRGLSAWIGFRQTGVPYRRHARAAGTTKYPLRKMLRF
                     ALDGITSFSYLPLQLATYLGFIVAAISMIFLLVVFVMRLADPSAPEPAFYGQASTLAS
                     VLFLGAVQLISLGIIGEYVGRIYDEVKGRPLYIVAEALGVEEEPATSPASVRTTHMEQ
                     STSVK"
     misc_feature    complement(428274..429215)
                     /locus_tag="Caur_0338"
                     /note="undecaprenyl phosphate
                     4-deoxy-4-formamido-L-arabinose transferase; Provisional;
                     Region: PRK10714"
                     /db_xref="CDD:182669"
     misc_feature    complement(428667..429212)
                     /locus_tag="Caur_0338"
                     /note="Bacterial DPM1_like enzymes are related to
                     eukaryotic DPM1; Region: DPM1_like_bac; cd04187"
                     /db_xref="CDD:133030"
     misc_feature    complement(order(428943..428945,429195..429197,
                     429201..429203))
                     /locus_tag="Caur_0338"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133030"
     misc_feature    complement(order(428943..428948,429102..429104))
                     /locus_tag="Caur_0338"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133030"
     misc_feature    complement(428943..428951)
                     /locus_tag="Caur_0338"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133030"
     gene            429574..431100
                     /locus_tag="Caur_0339"
                     /db_xref="GeneID:5827952"
     CDS             429574..431100
                     /locus_tag="Caur_0339"
                     /note="PFAM: DNA mismatch repair protein MutS domain
                     protein;
                     KEGG: ace:Acel_0734 DNA mismatch repair protein MutS
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS
                     domain-containing protein"
                     /protein_id="YP_001633979.1"
                     /db_xref="GI:163845935"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="GeneID:5827952"
                     /translation="MVSLSILHYHDGLQTEATSQPDFFPDLNLDQVVEAITKPGQEYN
                     LQPFFWTPLRDAQAVRYRQEVFQDLEKAPILEAIKQFAEGMRVVRRYLAMMEQLNFAD
                     HRKGWLLEAALVYCDTVTTLARHLVDLPLRSNGLSTFREHLTTCIQSPAFRSLATDSQ
                     HVKNALAAIKYSVIIESGKFSVKRYEGEVDYSSEVEHVFSKFKQRDAQDYLVHLPERA
                     GMSHIEAKILEFVARLYPEPFEELDRFCTEHNQFLDETIRTFDREIQFYVAYLEYIAD
                     LKRQGLPFCYPHVSATSKAVYVRDGFDLALAHAWRYEQKTITLNDFFLTGPERILVVT
                     GPNQGGKTTFARMFGQLHYLASLGCPVPGREAGLFLADRIFTHFERIEDSQNLRGKLE
                     DDLVRMHRALIQATPDSIFILNEIFSSTTVQDALFLSKEIMARLTDLDVLGVWVTFLD
                     ELASLSEKMVSMVASVDPNDPVRRTFQIIRKPADGLAYALSLARKHGLSREQLQERIR
                     "
     misc_feature    430462..431067
                     /locus_tag="Caur_0339"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    430576..430599
                     /locus_tag="Caur_0339"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(430585..430590,430594..430602,430708..430710,
                     430813..430818,430915..430917)
                     /locus_tag="Caur_0339"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    430699..430710
                     /locus_tag="Caur_0339"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    430723..430764
                     /locus_tag="Caur_0339"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    430801..430818
                     /locus_tag="Caur_0339"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    430825..430836
                     /locus_tag="Caur_0339"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    430903..430923
                     /locus_tag="Caur_0339"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            431097..432614
                     /locus_tag="Caur_0340"
                     /db_xref="GeneID:5827953"
     CDS             431097..432614
                     /locus_tag="Caur_0340"
                     /note="PFAM: DNA mismatch repair protein MutS domain
                     protein;
                     KEGG: tpt:Tpet_1786 DNA mismatch repair protein MutS
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS
                     domain-containing protein"
                     /protein_id="YP_001633980.1"
                     /db_xref="GI:163845936"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="GeneID:5827953"
                     /translation="MMKVFLLHPDQDFDPSTPLLPNVDDLTQDLSLNILFKAMARGDT
                     FLFQVVRQVVLSPLDESASILYRQEILKDCLKYPDVVRQMYLIPLTFLERKHKRWLWI
                     SLRHSTPTSILSSARELLAASLDLLRQLRLIADQHVNTFESQGFRRFFTMIQRELDDD
                     YLNLVEKHVQQLRFSRGTLLSAQPGKGNEGSNYVLCYPNDADQHWLQRMLTSHSPTYS
                     YTLHPRDEAGARILEELRDRGLARAANAVGQAAEHIESFFRVLQWELAFYIGCLNLYE
                     QLTALGKPVTFPQPVPAHERRLSCAELYDVTLALTLGSSVVGNDISADGKSLIIVTGP
                     NRGGKTVFLRSVGVAQLMMQCGMFVPAESFLANLTTGLFTHFKREEDKTMERGKFEEE
                     LARMSVIVDYLTPNALLLLNESFSATNEREGSEIARQIVSTLIEKGIKVYFVTHLYEF
                     TRSFNGDNILFLRAERLPDGERTFRLKEADPLKTSYSVDLYYRIFGTEQQQEMTD"
     misc_feature    432012..432584
                     /locus_tag="Caur_0340"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    432093..432116
                     /locus_tag="Caur_0340"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(432102..432107,432111..432119,432225..432227,
                     432330..432335,432432..432434)
                     /locus_tag="Caur_0340"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    432216..432227
                     /locus_tag="Caur_0340"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    432240..432281
                     /locus_tag="Caur_0340"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    432318..432335
                     /locus_tag="Caur_0340"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    432342..432353
                     /locus_tag="Caur_0340"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    432420..432440
                     /locus_tag="Caur_0340"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(433144..435972)
                     /locus_tag="Caur_0341"
                     /db_xref="GeneID:5827954"
     CDS             complement(433144..435972)
                     /locus_tag="Caur_0341"
                     /EC_number="2.7.7.7"
                     /note="KEGG: rrs:RoseRS_3415 DNA polymerase I;
                     TIGRFAM: DNA polymerase I;
                     PFAM: DNA-directed DNA polymerase; 5'-3' exonuclease;
                     3'-5' exonuclease;
                     SMART: Helix-hairpin-helix domain protein class 2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_001633981.1"
                     /db_xref="GI:163845937"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR002421"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="GeneID:5827954"
                     /translation="MAYPLLVLVDGHALAYRAFFALRESGLRSSRGEPTYAVFGFAQI
                     LLTALAEYRPDYAAVAFDVGRTFRDDLYAEYKAGRAETPEEFYPQFERIKQLVQALNI
                     PIYTAEGYEADDVIGTLARQATERGVDTIILTGDSDVLQLVNDHVRVALANPYGGKTS
                     VTLYDLEQVRKRYDGLEPDQLADLRGLKGDTSDNIPGVRGIGEKGAIALLKQFRSLDA
                     LLEQIDAAPKRYQTLLREQAEAARFSRQLATIVTDVPVQLDLEAARIGVYDRSAVMAL
                     FQELEFGVSSNLIKKLPSVVQAPTLAELPADLPAAPLTTAPTQLSLFAGESEPAQPTA
                     EPPPVTIVRDATALADLVSRLRNAPAFAFDTECTSLQPVASDLVGISIAIAPDTVCYI
                     PVGHQSETQVPCGEVVTALAPFFANPQQPKFAHNAKFDMEVLAGAGIKVSGLAFDTMI
                     AAAMLGKRQGLKDLAFYELKLPEPPTTIEDLIGRGNKQISFAEVPVEQAAPYAAADAL
                     YTLRLTERLQRQLEAEPALHDLYYRVELPLIEVLTDMELTGIRLDQEYLRELGRHFAQ
                     RIADLVERIYQQAGGPFNINSGQQLNDVLFGRLGIDPRAHGLSKLKSGGYSITAEVLE
                     ELSQLYPIAADILTYRQLTKLKSTYIDALPDLVNPRTGRIHTSYNQLGAATGRLSSNN
                     PNLQNIPVRTEEGREIRRAFVAEPGWRFVAADYSQIELRVLAHMSGDENLIAAFQQGL
                     DIHAATASRLFGVEPTAVDKNQRRVAKTVVFGVIYGISAFGLAQRLGIERDLARQLID
                     NLFAQFPGIRRYIDQTLEFGRQHGYVQTLFGRRRVMEDLRASGARRAAAEREAINAPI
                     QGTAADLMKMAMVNVHRALREQGLRTRLLLQVHDELIAEAPEDEVEPAARLLRDVMSS
                     VYRDLVVPLSVNLEVGPNWDEMSPLAMG"
     misc_feature    complement(433165..435963)
                     /locus_tag="Caur_0341"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    complement(435460..435957)
                     /locus_tag="Caur_0341"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(435559..435561,435565..435567,
                     435631..435636,435640..435642,435787..435789,
                     435943..435945))
                     /locus_tag="Caur_0341"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(435565..435567,435634..435636,
                     435943..435945))
                     /locus_tag="Caur_0341"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    complement(435736..435774)
                     /locus_tag="Caur_0341"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(435631..435633,435640..435642))
                     /locus_tag="Caur_0341"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    complement(order(435559..435561,435565..435567))
                     /locus_tag="Caur_0341"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    complement(435223..435441)
                     /locus_tag="Caur_0341"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    complement(order(435340..435351,435355..435384,
                     435388..435411))
                     /locus_tag="Caur_0341"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    complement(order(435394..435396,435403..435405))
                     /locus_tag="Caur_0341"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    complement(434341..434913)
                     /locus_tag="Caur_0341"
                     /note="DEDDy 3'-5' exonuclease domain of Escherichia coli
                     DNA polymerase I and similar bacterial family-A DNA
                     polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139"
                     /db_xref="CDD:176651"
     misc_feature    complement(order(434455..434457,434467..434469,
                     434536..434541,434590..434595,434683..434691,
                     434695..434700,434863..434865,434872..434883))
                     /locus_tag="Caur_0341"
                     /note="active site"
                     /db_xref="CDD:176651"
     misc_feature    complement(order(434455..434457,434467..434469,
                     434683..434685,434875..434877,434881..434883))
                     /locus_tag="Caur_0341"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176651"
     misc_feature    complement(order(434455..434457,434467..434469,
                     434536..434541,434590..434595,434686..434691,
                     434695..434700,434863..434865,434872..434880))
                     /locus_tag="Caur_0341"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176651"
     misc_feature    complement(433171..434316)
                     /locus_tag="Caur_0341"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    complement(order(433303..433311,433402..433404,
                     433423..433425,433672..433674,433684..433686,
                     433744..433746,433828..433833,433927..433938,
                     433942..433944,433948..433956,434029..434034,
                     434041..434043,434053..434055))
                     /locus_tag="Caur_0341"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    complement(order(433303..433311,433402..433404,
                     433414..433416,433423..433425,433648..433650,
                     433927..433938,433942..433944,433948..433956,
                     434029..434034,434041..434043,434053..434055))
                     /locus_tag="Caur_0341"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    complement(order(433303..433305,433672..433674,
                     433684..433686,433744..433746,433822..433824,
                     433828..433833))
                     /locus_tag="Caur_0341"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            436119..437177
                     /locus_tag="Caur_0342"
                     /db_xref="GeneID:5827955"
     CDS             436119..437177
                     /locus_tag="Caur_0342"
                     /note="PFAM: histone deacetylase superfamily;
                     KEGG: rrs:RoseRS_3190 histone deacetylase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase superfamily protein"
                     /protein_id="YP_001633982.1"
                     /db_xref="GI:163845938"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="GeneID:5827955"
                     /translation="MTTAIVTDQRFDLHTWHGHVEQAERLHAIRRAIEVDGLWPRLLQ
                     LPIRPATEAELLAVHSSSMLHRVRQLASYGGGQIDSDTYVTAESWDVALLAAGATICM
                     AEALVSGRCHNAFALVRPPGHHATDIRSMGFCLFNNIAVAARVLLDRHHLRRIAIVDF
                     DVHHGNGTQDIFYRDGRVLFCSIHAAPLYPGTGSLHEMGDPRTAGGTTLNVPLPYGTG
                     DHGYEQVFQRVIGPVLRRFQPEIILVSAGFDAHWSDPIGPMALSIQGFARIVQHLCDW
                     ADELCDGRIGFVLEGGYSLPALAAGVVTTLRLLLGMPAGSDPMGKMNAPEPAIEHIIT
                     SLYTYHPLLMQTTYQGEA"
     misc_feature    436173..437048
                     /locus_tag="Caur_0342"
                     /note="Histone deacetylases and histone-like deacetylases,
                     classII; Region: HDAC_classII; cd09992"
                     /db_xref="CDD:212518"
     misc_feature    order(436485..436490,436512..436517,436599..436601,
                     436605..436607,436863..436865,436989..436991)
                     /locus_tag="Caur_0342"
                     /note="active site"
                     /db_xref="CDD:212518"
     misc_feature    order(436599..436601,436605..436607,436863..436865)
                     /locus_tag="Caur_0342"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:212518"
     gene            437174..437812
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /db_xref="GeneID:5827956"
     CDS             437174..437812
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /note="with HisF IGPS catalyzes the conversion of
                     phosphoribulosyl-formimino-5-aminoimidazole-4-carboxamide
                     ribonucleotide phosphate and glutamine to
                     imidazole-glycerol phosphate,
                     5-aminoimidazol-4-carboxamide ribonucleotide, and
                     glutamate in histidine biosynthesis; the HisH subunit
                     provides the glutamine amidotransferase activity that
                     produces the ammonia necessary to HisF for the synthesis
                     of imidazole-glycerol phosphate and
                     5-aminoimidazol-4-carboxamide ribonucleotide"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="YP_001633983.1"
                     /db_xref="GI:163845939"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011698"
                     /db_xref="InterPro:IPR011702"
                     /db_xref="InterPro:IPR012998"
                     /db_xref="GeneID:5827956"
                     /translation="MIAVINYGAGNLPNVVRALQRVGATLTVTDNPEVIRSAQAVVLP
                     GVGATADTMASLRHLGIAEVLPAVIAASTPFLGICVGMQVLLSESEEFGLHSCLDIIP
                     GTVRRLPEHAGKIPQIGWNQLQISPTFRNHPLFADIPDGADVYFVHSYYCAVADEAII
                     AARTDYGIPFPSVIIRDHLAAVQFHPEKSGDYGLRLLANFVRWSEAVQPKGV"
     misc_feature    437174..437764
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /note="imidazole glycerol phosphate synthase subunit HisH;
                     Provisional; Region: hisH; PRK13142"
                     /db_xref="CDD:171871"
     misc_feature    437177..437776
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in imidazole glycerol phosphate synthase (IGPS);
                     Region: GATase1_IGP_Synthase; cd01748"
                     /db_xref="CDD:153219"
     misc_feature    order(437291..437314,437402..437416,437726..437728,
                     437732..437734)
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /note="putative active site [active]"
                     /db_xref="CDD:153219"
     misc_feature    437291..437314
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /note="oxyanion strand; other site"
                     /db_xref="CDD:153219"
     misc_feature    order(437408..437410,437726..437728,437732..437734)
                     /gene="hisH"
                     /locus_tag="Caur_0343"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153219"
     gene            437815..438540
                     /locus_tag="Caur_0344"
                     /db_xref="GeneID:5827957"
     CDS             437815..438540
                     /locus_tag="Caur_0344"
                     /note="catalyzes the formation of
                     5-(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino-l-
                     (5-phosphoribosyl)imidazole-4-carboxamide from
                     1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide"
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="YP_001633984.1"
                     /db_xref="GI:163845940"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR006063"
                     /db_xref="GeneID:5827957"
                     /translation="MEIIPAIDIKDGRCVRLYQGDFAQMTVYADDPVAVARSWEAQGA
                     TRLHLVDLDGARAGHPQNVDAILAITQAVQIPVQLGGGLRREQDVESALALGVERVII
                     GTAAIAETDLVARLLDRFGEQIVIGIDARNGLVATDGWTVTSSVKATVLAEQMANLGA
                     RRIIYTDISRDGALSGPNFAALSELITPHGPAIIASGGIASIDHVRQLAQLGVEGAII
                     GKALYVGAVKLAEAMAVAHMTNV"
     misc_feature    437818..438516
                     /locus_tag="Caur_0344"
                     /note="HisA.  Phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribonucleotide (ProFAR) isomerase catalyzes
                     the fourth step in histidine biosynthesis, an
                     isomerisation of the aminoaldose moiety of ProFAR to the
                     aminoketose of PRFAR (N-(5'-phospho-D-1...; Region: HisA;
                     cd04732"
                     /db_xref="CDD:240083"
     misc_feature    order(437836..437838,437956..437958,438199..438201)
                     /locus_tag="Caur_0344"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240083"
     gene            438609..439706
                     /locus_tag="Caur_0345"
                     /db_xref="GeneID:5825745"
     CDS             438609..439706
                     /locus_tag="Caur_0345"
                     /note="KEGG: rca:Rcas_2921 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633985.1"
                     /db_xref="GI:163845941"
                     /db_xref="GeneID:5825745"
                     /translation="MSNSDLTARYEEERLRAQEQSQLVYLQGQIDELRRLLKDQTNKY
                     QWAMEQIRKNEGTIAQIQSLFDRHTGEVAQANEIVRRDVVALRREVATALVKIEDGLR
                     PIRDMQAQIQQVAEARKQDRDFLAGWLSRIEQVERQIATLSSQVKELDERQRQLTLQL
                     ERLREADAAVMQEVRRFGDDLQVEKQSMRRMAVEAQQFVADLQPVVEEQRSRIDRLEE
                     IRQHIDLFTEMLPAQIKELSAKIPDLMAEMKRIERISTERFLMNQERLEELRQMADER
                     MSTLQETDEQYLRQMTAWLERIDSWLRELEQRLSRTTDRLELEQKAHLLRIMELERRE
                     ADTLNAQLNLLRQRLELVRAAQIESGGGNAG"
     misc_feature    439005..>439508
                     /locus_tag="Caur_0345"
                     /note="Protein of unknown function (DUF2397); Region:
                     DUF2397; cl19578"
                     /db_xref="CDD:267931"
     gene            complement(440235..441263)
                     /locus_tag="Caur_0346"
                     /db_xref="GeneID:5825746"
     CDS             complement(440235..441263)
                     /locus_tag="Caur_0346"
                     /note="PFAM: putative RNA methylase; Methyltransferase
                     type 11;
                     KEGG: rrs:RoseRS_2276 putative RNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA methylase"
                     /protein_id="YP_001633986.1"
                     /db_xref="GI:163845942"
                     /db_xref="InterPro:IPR000241"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:5825746"
                     /translation="MSHQIEIVVPAGLEELARAEALRITGLRLEPLTERGVIRATMHG
                     SLQALFDLRSVISVFVVRRFAIPRPRALLGDEHFRAVVAMLEMVRRLHPAGTFQTLFL
                     SAAGADSSVLQRFKQMIGERLGLAIGTEDGDMLIRLRPSRDRSGWDVLVRLTPRPLAT
                     RSWRVCNREGALNGPVAHAMAVLSKPHAGDRVLNVGCGSGTLLIERLLITTAAQAIGC
                     DTDPTALACAWRNLGAAGLSKRVELYDWDACQLPLPSASIDVVLADLPFGHLVGSHTT
                     NLTLYPALLAEAARVTRPGGRAVLISHEVRLMERSLATLPQWRVDQQLRVDLGGLYPR
                     IFVLRRTG"
     misc_feature    complement(440328..441239)
                     /locus_tag="Caur_0346"
                     /note="Predicted N6-adenine-specific DNA methylase [DNA
                     replication, recombination, and repair]; Region: COG0116"
                     /db_xref="CDD:223194"
     misc_feature    complement(440349..440693)
                     /locus_tag="Caur_0346"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(440472..440474,440520..440528,
                     440604..440609,440661..440681))
                     /locus_tag="Caur_0346"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            441394..442665
                     /locus_tag="Caur_0347"
                     /db_xref="GeneID:5825747"
     CDS             441394..442665
                     /locus_tag="Caur_0347"
                     /note="KEGG: rca:Rcas_0035 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001633987.1"
                     /db_xref="GI:163845943"
                     /db_xref="GeneID:5825747"
                     /translation="MDIGITIWPPMPAQPQALPASWSSYDHGALREFLQRAHDVGLRQ
                     VRFDLRWAEVQPGTQRISVAALNGFQRGLDLAQANHIQVVVSLMSATLGPTLHLPDWA
                     LGIPTQALSTQAVSALLSAPTLTILDNSFYRQEPVRDLYTDPDMRAAQRYLLREVIGN
                     FADHPAISGWLLAAGFERVRPPTDHRDMAAWWADLAEQARSYGAERLFGHIDATALSS
                     RVSLRPYDIAMAGGAVVVSVGPWPPLGDGPPARGEAACFLHAIVAGLLAEEVNDTAAA
                     QVVVADLGWPTAPRANLSGWQADQVFAQPAHTFLADEEAAASALQESLTTLARAGAAA
                     VWLAGMVDPPESQWNIPPFDRSWIARTWGLWTADGREKAGWEALREAIRQLPATARLP
                     GFPIDPERFWRDPANELRRLWREYRTETLPS"
     gene            complement(442830..443591)
                     /gene="trmD"
                     /locus_tag="Caur_0348"
                     /db_xref="GeneID:5825748"
     CDS             complement(442830..443591)
                     /gene="trmD"
                     /locus_tag="Caur_0348"
                     /EC_number="2.1.1.31"
                     /note="methylates guanosine-37 in various tRNAs; uses
                     S-adenosyl-L-methionine to transfer methyl group to tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /protein_id="YP_001633988.1"
                     /db_xref="GI:163845944"
                     /db_xref="InterPro:IPR002649"
                     /db_xref="GeneID:5825748"
                     /translation="MRFDILTLFPAMFQGPLTESILKRAQQAGRIEIHLHDIRQWTTD
                     RHRTADDTPYGGGAGMVMKAEPLAAAIRAVRAADERPGVTILLTPDGELLTQQIVREL
                     ATLPRLLLVCGHYEGIDERVRETLIDRELSIGDYVLTGGELAAMVVVDAVARLVPGVI
                     DSESIVEESHSDFLLEYPHYTRPAVWEGRAVPPVLLSGHHGEIARWRRAERLRRTLVR
                     RPDLLARAAAAGVLTKADLALLAELGWRPETSNGA"
     misc_feature    complement(442857..443591)
                     /gene="trmD"
                     /locus_tag="Caur_0348"
                     /note="tRNA (guanine-N(1)-)-methyltransferase; Reviewed;
                     Region: trmD; PRK00026"
                     /db_xref="CDD:234581"
     gene            complement(443597..444508)
                     /locus_tag="Caur_0349"
                     /db_xref="GeneID:5825749"
     CDS             complement(443597..444508)
                     /locus_tag="Caur_0349"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: rxy:Rxyl_2331 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold-containing protein"
                     /protein_id="YP_001633989.1"
                     /db_xref="GI:163845945"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="GeneID:5825749"
                     /translation="MAVKPGWSLLPMALAGAFSLLGGITAYYVSLRVSPSPRRTYLDS
                     YTFTPWELEVPYETVEFRSSDGLRLVGWWLPRPETNAVIVGSHGHAGRKDELLGIGSY
                     CWRAGYNVLLFDYRGRGESDPWPQTLVSREVDDLLAALQYVRQRMPEAAIGVIGYSMG
                     AAVGILATARDQSVRALVADSSFTTGDEVVADAVEKVLRVPLRPLVHLADIIVAWRHG
                     YRFSQARPIDAIGQIAPRPVFLIHGVDDSLVPVCHVRQLYAAAREPRLVWEIPGAEHC
                     GGYFVDRVGYCRRVVEFFDQYLRSVEA"
     sig_peptide     complement(444440..444508)
                     /locus_tag="Caur_0349"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.907) with cleavage site probability 0.865 at
                     residue 23"
     misc_feature    complement(444086..444310)
                     /locus_tag="Caur_0349"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(443681..444265)
                     /locus_tag="Caur_0349"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     misc_feature    complement(443615..444193)
                     /locus_tag="Caur_0349"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(444518..445105)
                     /locus_tag="Caur_0350"
                     /db_xref="GeneID:5825750"
     CDS             complement(444518..445105)
                     /locus_tag="Caur_0350"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: rca:Rcas_2087 GCN5-related N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_001633990.1"
                     /db_xref="GI:163845946"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:5825750"
                     /translation="MNDQPVCQDIPTTITTRDGRTLRVRSLAASDAVLLERMFYRLSP
                     ETIYRRFFIAAEHASPELVHKSAKRLAAINPRREAALVALADEQGSEEAIAVARFARL
                     PHNPKVAEASILVRDDYQGTGVGRKLLALLLAEARAAGLERLIFLTHADNTPMIRLAM
                     GLGLPFQGRHADGLYEIHVLLEPQSTTKFEFVRNE"
     misc_feature    complement(444614..445042)
                     /locus_tag="Caur_0350"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    complement(444617..444835)
                     /locus_tag="Caur_0350"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            445343..446233
                     /gene="miaA"
                     /locus_tag="Caur_0351"
                     /db_xref="GeneID:5825751"
     CDS             445343..446233
                     /gene="miaA"
                     /locus_tag="Caur_0351"
                     /EC_number="2.5.1.75"
                     /note="IPP transferase; isopentenyltransferase; involved
                     in tRNA modification; in Escherichia coli this enzyme
                     catalyzes the addition of a delta2-isopentenyl group from
                     dimethylallyl diphosphate to the N6-nitrogen of adenosine
                     adjacent to the anticodon of tRNA species that read codons
                     starting with uracil; further tRNA modifications may
                     occur; mutations in miaA result in defects in translation
                     efficiency and fidelity"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="YP_001633991.1"
                     /db_xref="GI:163845947"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR011593"
                     /db_xref="GeneID:5825751"
                     /translation="MEELIAIVGPTAVGKTELAVAWARRINGEIVSADSRQIYRWMDI
                     GTAKPSPEEQAQAPHHLIDIRDPDQPFSLAEFCDLATAAIADIRGRGRIPLLVGGTGQ
                     YLAAFLEGWQVPRVAPQPDLRAELELIAAREGPAVLHARLAAVDPVAASRIPPTNVRR
                     VVRALEVYLVSGEPISRLQERKEPPFRPRTIWLHRPRAELYARADARIERMIAAGLVE
                     EVAGLLARGYDWSLPAMSSLGYIQFRPYFTGEADLPTCIERLRFDTHAFIRRQEMWFR
                     RLPNLEIWTPDHPSWREITA"
     misc_feature    445343..446212
                     /gene="miaA"
                     /locus_tag="Caur_0351"
                     /note="tRNA delta(2)-isopentenylpyrophosphate transferase;
                     Reviewed; Region: miaA; PRK00091"
                     /db_xref="CDD:234626"
     gene            complement(446203..447006)
                     /locus_tag="Caur_0352"
                     /db_xref="GeneID:5825752"
     CDS             complement(446203..447006)
                     /locus_tag="Caur_0352"
                     /note="PFAM: RDD domain containing protein;
                     KEGG: rca:Rcas_3447 RDD domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RDD domain-containing protein"
                     /protein_id="YP_001633992.1"
                     /db_xref="GI:163845948"
                     /db_xref="InterPro:IPR010432"
                     /db_xref="GeneID:5825752"
                     /translation="MNATPSWREPYLVVTPEGVQVVYTAAGLASRSLAAVVDYVIIIT
                     LLATSLVMIAANEGTSSANQDVILALLAILAFVVNWGYFVFFEWIWNGQTPGKRLLRL
                     RVLREGGRPVDIGAIVVRNLMRAIDFLPLLYGIGLVTMFVDRYHRRLGDLTAGTVVVH
                     EAMPLTLERVMQPVVVQLPPRAPDAPPTPLVPNVERLTAADLALLLEFLQRRDELQTE
                     ARSDLAAHLAAVLRQRLALPSGSGDPERFIEHVLREYHVAQAVISRQDG"
     misc_feature    complement(446542..446931)
                     /locus_tag="Caur_0352"
                     /note="RDD family; Region: RDD; pfam06271"
                     /db_xref="CDD:253650"
     gene            complement(447003..447680)
                     /locus_tag="Caur_0353"
                     /db_xref="GeneID:5825753"
     CDS             complement(447003..447680)
                     /locus_tag="Caur_0353"
                     /note="PFAM: Phosphoglycerate mutase;
                     KEGG: rca:Rcas_3445 phosphoglycerate mutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="YP_001633993.1"
                     /db_xref="GI:163845949"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="GeneID:5825753"
                     /translation="MTIVYLIRHGETDWNMQGRWQGHADVPLNEIGYQQARLLARRLA
                     NEGVTFSAIYSSDLARAYQTAWEIGAALRVPVQLLPALREIDVGAWSGLTTAEVRARF
                     ADDWEQMIRGHDIPRGGGETVAAVRQRVVTAVEAMVAQHRGQTLAFVTHGGCIRVLLA
                     HAENFDGVGFGHYDHIGNTSITILEIGYKHWRVKTVNDMRHLEAEHKTELVSAPPDDA
                     ELPDTAQ"
     misc_feature    complement(447123..447671)
                     /locus_tag="Caur_0353"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    complement(order(447225..447230,447501..447503,
                     447654..447659))
                     /locus_tag="Caur_0353"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            448020..449645
                     /locus_tag="Caur_0354"
                     /db_xref="GeneID:5825754"
     CDS             448020..449645
                     /locus_tag="Caur_0354"
                     /note="PFAM: thymidylate synthase complementing protein
                     ThyX;
                     KEGG: rrs:RoseRS_0926 thymidylate synthase complementing
                     protein ThyX"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase complementing protein ThyX"
                     /protein_id="YP_001633994.1"
                     /db_xref="GI:163845950"
                     /db_xref="InterPro:IPR003669"
                     /db_xref="GeneID:5825754"
                     /translation="METQQPETFTEQEIELLQPFVTNVDRPIFCLRNLPEVVKGALFA
                     RYSRSSKSLRRLLLDEFINEPESGFSAMVSAQDHNPAAQLIATRQAEAFYDRVLIGYG
                     DDSVAELGGAHLACEGVSNIAAKLLEDSRLGISPLEKSTRYVRFDRKGPDGYPYLREP
                     AIMASPLADRYVAVMDHLFTTYSELLEPVQAWLQQQYPRDEATTPRAYRNTIQAKALD
                     LLRGLLPMATQTNVGLFGNGRAFEYLIIKLAASPFAEAQALSKMIQAELDQVIPSFVK
                     RARSDRGQAYADYLATTREQVAALAHQIPVEADSTTPVTVTLVDYDPRAEWKLAAAIL
                     YPHLDLPLPAIEELVAAMPEAERHALINAAVGDRANRFHRPGRAFEEPYYTFDILADI
                     GAYRDLQRHRVLTQERQRFTVRHGYVTPPELEEIGVADRYRTALEQAADLVTALEATL
                     PNEAQYAVPLAFRVRWRIKLNLREAYHLIELRSARQGHPSYRQIAQLMFREISAVHPF
                     LAAGMRFVDHNEYDLERLAAEQRIDQKRQQVGR"
     misc_feature    448077..448871
                     /locus_tag="Caur_0354"
                     /note="Thymidylate synthase complementing protein; Region:
                     Thy1; cl03630"
                     /db_xref="CDD:261811"
     misc_feature    448965..449546
                     /locus_tag="Caur_0354"
                     /note="Thymidylate synthase complementing protein; Region:
                     Thy1; pfam02511"
                     /db_xref="CDD:251342"
     gene            complement(449712..449786)
                     /locus_tag="Caur_R0004"
                     /note="tRNA-Lys2"
                     /db_xref="GeneID:5825755"
     tRNA            complement(449712..449786)
                     /locus_tag="Caur_R0004"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:5825755"
     gene            complement(449835..450569)
                     /locus_tag="Caur_0355"
                     /db_xref="GeneID:5825756"
     CDS             complement(449835..450569)
                     /locus_tag="Caur_0355"
                     /note="PFAM: LmbE family protein;
                     KEGG: rca:Rcas_1525 LmbE family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_001633995.1"
                     /db_xref="GI:163845951"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="GeneID:5825756"
                     /translation="MQQTQSEPKTALVVVAHPDDAEFGCGGTLAAWAAEGWEITLVVC
                     TDGSGGGPDDATDVGPAARRRISEIRKAEQQAAAKILGLKEVIFLDYPDGMLQPTLEL
                     RRDIVRQIRRIRAQRVVCQSPDRVWTPQYSIPRFHPDHLAAANATLAAVYPAAQNGWD
                     FPELLAEGYPPSKVREVYITGAPVLNFAVDISATIEQKLAALRCHVSQLGTDQTELAG
                     RVRQWAAERGQEFGLPLAEAFHRVEN"
     misc_feature    complement(449853..450569)
                     /locus_tag="Caur_0355"
                     /note="Uncharacterized proteins, LmbE homologs [Function
                     unknown]; Region: COG2120"
                     /db_xref="CDD:225031"
     gene            complement(450699..451310)
                     /locus_tag="Caur_0356"
                     /db_xref="GeneID:5825757"
     CDS             complement(450699..451310)
                     /locus_tag="Caur_0356"
                     /note="PFAM: ferredoxin;
                     KEGG: cte:CT0652 chlorosome envelope protein X"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="YP_001633996.1"
                     /db_xref="GI:163845952"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="GeneID:5825757"
                     /translation="MATVIVNDVEMTARPGERILDIARRNSAHIGFVCDGTGFCQTCK
                     VRVLAGAEFLSPPNDREKNWLPDARLQEGWRLGCQASVRGKGPIAVITNAEELRLQAF
                     AAINPPAGSSVATNVSSLITNLTQQSIDQLVGYPWNMLNAIATIGLGRIINPWQSMER
                     FSQWLTDIGKVVEQTLNSPAPAPPSDPLARVRAAAAEVRRASE"
     misc_feature    complement(451059..451304)
                     /locus_tag="Caur_0356"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(451077..451082,451182..451193,
                     451197..451199,451209..451211,451218..451223))
                     /locus_tag="Caur_0356"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(451077..451079,451182..451184,
                     451191..451193,451209..451211))
                     /locus_tag="Caur_0356"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            451481..452401
                     /locus_tag="Caur_0357"
                     /db_xref="GeneID:5825758"
     CDS             451481..452401
                     /locus_tag="Caur_0357"
                     /note="PFAM: phospholipid/glycerol acyltransferase;
                     KEGG: rxy:Rxyl_2580 phospholipid/glycerol acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_001633997.1"
                     /db_xref="GI:163845953"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="GeneID:5825758"
                     /translation="MVSSTTQRTDVVRVEQYTASGESLSSALADLTWLNTADMLRGFG
                     ISKPPWLYGLSTVLARPPALRFARQLLTFDALVGQAGLPAGCAWICSLFAPGLDIVGP
                     QPPAQGPLLIVANHPGLLDAAALITALNRNDLKIIAIARPLLRTLPNTAAAIIPIGTT
                     PQHRMNALRTALRHLQQGGAVLTFPAGRIEPDPAHDDTASASLEDWSSSLDLFGRIAG
                     GVPVVTAIVSNVLAEAALHHPLTLLHRNPEDRRWLAAILQVLWPHLATTPVRIQFSAP
                     CRADHQMRATVLHTARQSIYQARAAQRRTP"
     misc_feature    451793..>452164
                     /locus_tag="Caur_0357"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cl17185"
                     /db_xref="CDD:266537"
     misc_feature    order(451826..451828,451832..451834,451841..451843,
                     451892..451894,451901..451909,452039..452047)
                     /locus_tag="Caur_0357"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153244"
     gene            452398..453608
                     /locus_tag="Caur_0358"
                     /pseudo
                     /db_xref="GeneID:5824748"
     gene            453611..454219
                     /locus_tag="Caur_0359"
                     /db_xref="GeneID:5824749"
     CDS             453611..454219
                     /locus_tag="Caur_0359"
                     /EC_number="3.5.4.25"
                     /note="PFAM: GTP cyclohydrolase II;
                     KEGG: bce:BC4111 GTP cyclohydrolase II"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="YP_001633998.1"
                     /db_xref="GI:163845954"
                     /db_xref="InterPro:IPR000926"
                     /db_xref="GeneID:5824749"
                     /translation="MTTFFPITRAAMADLPTRFGHFQIVVYLDAEQKEQIALTCGQLH
                     TPEPVLTRLHSECLTGDIFGSHRCDCGEQLAAALTAIQQAGRGVLLYLRQEGRGIGLV
                     NKIRAYALQQQGLDTVDANRALGLPDDMRDYRVAAAILTDLGIKSVRLLTNNPAKITG
                     IEQHGIAVTERVPLQMPANNYSAAYLLAKQVRMGHLLDSRLL"
     misc_feature    453629..454201
                     /locus_tag="Caur_0359"
                     /note="GTP cyclohydrolase II (RibA).  GTP cyclohydrolase
                     II catalyzes the conversion of GTP to
                     2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'
                     phosphate, formate, pyrophosphate (APy), and GMP in the
                     biosynthetic pathway of riboflavin. Riboflavin is the...;
                     Region: GTP_cyclohydro2; cd00641"
                     /db_xref="CDD:238348"
     misc_feature    order(453638..453658,453680..453682,453686..453694,
                     453710..453712,453716..453718,453722..453724,
                     453776..453778,453782..453787,453791..453805,
                     453809..453811,453830..453835,453842..453844,
                     453881..453883,453887..453889,453911..453916,
                     453923..453928,453932..453937,453944..453946)
                     /locus_tag="Caur_0359"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238348"
     misc_feature    order(453764..453781,453785..453787,453812..453814,
                     453818..453820,453827..453829,453890..453901,
                     453920..453922,453932..453934,453941..453943,
                     453959..453961,453995..453997,454001..454003,
                     454064..454072,454079..454081)
                     /locus_tag="Caur_0359"
                     /note="active site"
                     /db_xref="CDD:238348"
     gene            complement(454251..455486)
                     /locus_tag="Caur_0360"
                     /db_xref="GeneID:5824750"
     CDS             complement(454251..455486)
                     /locus_tag="Caur_0360"
                     /note="PFAM: glycoside hydrolase family 1;
                     KEGG: sus:Acid_2768 glycoside hydrolase, family 1"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family protein"
                     /protein_id="YP_001633999.1"
                     /db_xref="GI:163845955"
                     /db_xref="InterPro:IPR001360"
                     /db_xref="GeneID:5824750"
                     /translation="MQQFAFPTGFLWGAATSAHQVEGNNINSDSWVLEHLPDTIYAEP
                     SGDACDYYHRYPEDIALLAQLGFNAYRFSIEWARIEPEEGEFSFASLEHYRRMLATCH
                     EHGLKPVVTLHHFTSPRWLIRAGGWLDPKTPDRFVRYCERVVHYLGDLIAGACTFNEP
                     NLPVLLSKIMPASPLASPFWRAAAAEFAVTPDRLGIFQFVSQPRMREIIFAAHRRAFE
                     VLHDGPGSFPVGMTLALVDIHAGPDGERMAAEFRRELAEVYLEQLREDDFVGVQTYSR
                     LVVGPAGIIPPGDDVEKTQTGEEYYPEAIGGTIRHAAAVAGIPVVVTENGLATTDDTR
                     RVEYFRRALRSVAECLIDGIDVRGYFAWSALDNFEWISGYKPKLGIIAVDRTTQARTP
                     KPSAYWLGNVARFNYCVFD"
     sig_peptide     complement(455424..455486)
                     /locus_tag="Caur_0360"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.707) with cleavage site probability 0.625 at
                     residue 21"
     misc_feature    complement(454269..455483)
                     /locus_tag="Caur_0360"
                     /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
                     pfam00232"
                     /db_xref="CDD:249702"
     misc_feature    complement(454269..455474)
                     /locus_tag="Caur_0360"
                     /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta-
                     galactosidase [Carbohydrate transport and metabolism];
                     Region: BglB; COG2723"
                     /db_xref="CDD:225343"
     gene            complement(455634..458492)
                     /locus_tag="Caur_0361"
                     /db_xref="GeneID:5824751"
     CDS             complement(455634..458492)
                     /locus_tag="Caur_0361"
                     /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
                     domain protein;
                     KEGG: kra:Krad_0118 alpha-L-rhamnosidase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-L-rhamnosidase"
                     /protein_id="YP_001634000.1"
                     /db_xref="GI:163845956"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="InterPro:IPR008902"
                     /db_xref="InterPro:IPR013737"
                     /db_xref="GeneID:5824751"
                     /translation="MSYEQLSTSQSQVSRLIVRVEHYQSTLGIGNPCPRLSWIIETNA
                     TNWLQTAYEIECYTKDGRVRGRTGWIHSPESVLVPWPFEPLTSREQVLVRVRVRDNKG
                     DISPWSEMLPIEAGLLKVGDWSARFITPDWDDDILKPQPCPMLRHEFRVDNDVIQARL
                     YITSLGVYEAQINGVVVGDQVLAPGWTVYDRRLRYQTFDVTMHLREGINAIGVILGDG
                     WFRGRLGFGGGRRNIYGNRLAVLAQLEITYRDGSTQQVCTDQTWRSTTGPILASDIYD
                     GEIYDARLELPNWSKPGFADHQWSGVRLLEWDFSTLVAPISPPIRRIEMVLPVAIFSS
                     PSGRTIVDFGQNLVGRVRLTVSGPPGQMITVRHAEVLEGGELSTRPLRFAAATDRYIL
                     RGDGTEVWEPRFTFHGFRYAEIDGWPGELRTTDIVAVVIHSDMERIGWFTCSDQLLNR
                     FHENVVWSMRGNFLDVPTDCPQRDERLGWTGDIQVFAPTAVFLYDVAGLLQSWLIDLA
                     IEQEKLGGAVPHVVPNVLGPSAAGAAAWGDAATVVPWVLFQRYGDKRVLETQYKSMRS
                     WVDYIATKAGHTYLWDRGFQFGDWLDPTAPPDKPGQARTDKAIVASAYFIFSATLVAK
                     AAHVLGYDADADFYADLAHKARFAFAKEYITPAGRLMCDTETAYALALVFDLFPTDTQ
                     RRYAGERLAALVRDSGYHIRTGFVGTPLICDALCSVGHCRVAYRLLMQRECPSWLYPV
                     TMGATTIWERWDSMLPDGSINPGEMTSFNHYALGAVADWMHRTIGGLIPVEPGYRRIE
                     FRPQPGGEIVYARVSHRTPYGLAECFWRIEEGVFYLRVVVPPNTTAQVFLPGRDDQPL
                     DVGSGIWQWSIPCQDTATRGSYTVDDLVDEIIDDEVAREAVNQVLSQVDAWRLFGNLL
                     LNERSASLREAIQALPNSEIVIERLNALLTRIPKKDGI"
     misc_feature    complement(457521..458030)
                     /locus_tag="Caur_0361"
                     /note="Alpha-L-rhamnosidase N-terminal domain; Region:
                     Bac_rhamnosid_N; pfam08531"
                     /db_xref="CDD:254858"
     misc_feature    complement(455949..457502)
                     /locus_tag="Caur_0361"
                     /note="Bacterial alpha-L-rhamnosidase; Region:
                     Bac_rhamnosid; pfam05592"
                     /db_xref="CDD:253267"
     gene            complement(458521..459387)
                     /locus_tag="Caur_0362"
                     /db_xref="GeneID:5824752"
     CDS             complement(458521..459387)
                     /locus_tag="Caur_0362"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: aau:AAur_0944 putative ABC-type sugar transport
                     system, permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_001634001.1"
                     /db_xref="GI:163845957"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:5824752"
                     /translation="MRMLMTSTMLTLRKQSVWKLLIWTLVVILVLIELYPLTWLLLSS
                     FKAPAEFSLNPIYALPEGFYWQNYIRAWTEGRMGVYFRNSLMVTIPSLFLILCLGSMA
                     AFGIEILKWRFNNVVLVIFLLGIMIPVQMILLPLFAIYNQLQLLNTFTGLILVYTAFG
                     LPLTIFLLVSFAKSLPHEVLEAALIDGANIYQIFLYIALPMMANAIITVGLVQFFFIW
                     NDLLISLTFISDSELRTVQTGLLSFVGRFGQREWGPTFASITTSVIPILFLYLILNNA
                     IMKGLTSGAVKG"
     misc_feature    complement(458527..459363)
                     /locus_tag="Caur_0362"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(458587..459147)
                     /locus_tag="Caur_0362"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(458587..458592,458599..458604,
                     458611..458616,458620..458625,458632..458637,
                     458665..458670,458707..458709,458713..458715,
                     458722..458733,458752..458754,458761..458766,
                     458806..458808,458857..458859,458866..458871,
                     458881..458883,458887..458892,458899..458901,
                     458905..458907,458911..458916,458977..458979,
                     458983..458988,458995..459024,459028..459039,
                     459067..459069,459082..459087,459094..459099))
                     /locus_tag="Caur_0362"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(458716..458733,458977..459021))
                     /locus_tag="Caur_0362"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(458635..458637,458665..458667,
                     458674..458676,458713..458715,458929..458931,
                     458977..458979))
                     /locus_tag="Caur_0362"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(458785..458787,458797..458802,
                     458818..458856))
                     /locus_tag="Caur_0362"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(459399..460283)
                     /locus_tag="Caur_0363"
                     /db_xref="GeneID:5824753"
     CDS             complement(459399..460283)
                     /locus_tag="Caur_0363"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: csc:Csac_0127 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_001634002.1"
                     /db_xref="GI:163845958"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:5824753"
                     /translation="MNQTLRDRKALLVFVGPALTLYVMIVIVPIIWTVGYSLFEGSPI
                     TGFQFVGLGNYGKLWQDQDFINAFLFSARYALVVTAGQVGFGLLLALLYLFFLKRSSA
                     FIRTLVFFPVVLPTVAVAQIFVKLFEITPQYGLVNAIFAAIGQESWVQPWLGRSDSAF
                     WVAALMNIWTAMGFYAVILYAGLLDIPNEIIESARLDGANGFNLVVFVIQPLLTPVLV
                     TSIIFSLNGTLKVFDQLLALTNGGPGKTTTPLTLYMYRVAFNYNDYGYGSTIAIILMI
                     ECLIVSLLAFRFARRDVS"
     misc_feature    complement(459411..460268)
                     /locus_tag="Caur_0363"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(459447..460082)
                     /locus_tag="Caur_0363"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(459447..459452,459459..459464,
                     459471..459476,459480..459485,459492..459497,
                     459525..459530,459573..459578,459585..459596,
                     459615..459617,459624..459629,459669..459671,
                     459720..459722,459729..459734,459744..459746,
                     459750..459755,459762..459764,459768..459770,
                     459777..459782,459912..459914,459918..459923,
                     459930..459959,459963..459974,460002..460004,
                     460017..460022,460029..460034))
                     /locus_tag="Caur_0363"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(459579..459596,459912..459956))
                     /locus_tag="Caur_0363"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(459495..459497,459525..459527,
                     459534..459536,459576..459578,459795..459797,
                     459912..459914))
                     /locus_tag="Caur_0363"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(459648..459650,459660..459665,
                     459681..459719))
                     /locus_tag="Caur_0363"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(460430..461776)
                     /locus_tag="Caur_0364"
                     /db_xref="GeneID:5824754"
     CDS             complement(460430..461776)
                     /locus_tag="Caur_0364"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: aau:AAur_0946 putative extracellular sugar-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_001634003.1"
                     /db_xref="GI:163845959"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:5824754"
                     /translation="MMPGKLVVPSLLVLICCVIISCSAPAAQPQPVVTPAQSTTTESQ
                     LPVVIHYLTVQQETEGWPLIIGTLTREYQANHPNVEWKYENYPQTDLVQRIQLLAGSD
                     SLPFMFNYESGAPLRDLAASGKVLELEQTFKELGIYDRLNPGAVSLLKNLVGGSGLYA
                     LPLELNIEGFWYNKQIFAEHNLAVPTTWDELLAVADKLHQAGIQPFAVSGLQKWPLTR
                     LINGYVMRVYGYDVMSRVVNGELKVTDAGFIAAAQIVQDMAMKGYFGQGVNTLDYAPA
                     QDLFLQGRAAMYYMGSWALRDFNNPELNKIGIDNIGFFNIPLVEGGVGTLNDYSINAG
                     LTTSFSQKEFSRNPQGYGEWMKAVFSAYGDRAMSELGMITGFTVSQIPDNVSPLTRLT
                     VAEIDNVKNGAPWFEAYFNARTQAVATDNVQLLVTGDMSPEEYMAELQKAIDEQLP"
     misc_feature    complement(460436..461776)
                     /locus_tag="Caur_0364"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     sig_peptide     complement(461693..461776)
                     /locus_tag="Caur_0364"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.996 at
                     residue 28"
     misc_feature    complement(460694..461566)
                     /locus_tag="Caur_0364"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            complement(462031..463071)
                     /locus_tag="Caur_0365"
                     /db_xref="GeneID:5824755"
     CDS             complement(462031..463071)
                     /locus_tag="Caur_0365"
                     /note="PFAM: regulatory protein LacI; periplasmic binding
                     protein/LacI transcriptional regulator;
                     KEGG: rso:RSc1014 probable transcriptional regulatory
                     DNA-binding repressor transcription regulator protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="YP_001634004.1"
                     /db_xref="GI:163845960"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:5824755"
                     /translation="MKRPTQMDVARRAGVSRATVSHVINGLSGGRVPISPETRERVWQ
                     AIKELGYEPDAGARALRLGKSRTIGLIMPDLYNPHFWENAEGVEQEARANGYRLLLCS
                     MNLNIQYGEDAFKDLVGRRIDALILMGSFVYESEEARNTLIRSLERGLPIVEISDRVT
                     KDYLADCVLSDYRAVAAAAMQHLIMLGHRRIGLIYGVANSSLAEDRLIPYKKSLQAVG
                     IPIDEQLIVHCGPTIEEGYRAAIHLLQKPNRPTAIVAINDLLAIAVLRAAGDMGLRVP
                     ADVSLIGFDDIAIANYLIPRLTTAAKDAVQLGREAVKLALARLRDPKRPRQVIEVPAR
                     LILRESTAPPSC"
     misc_feature    complement(462040..463062)
                     /locus_tag="Caur_0365"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(462889..463050)
                     /locus_tag="Caur_0365"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(462889..462894,462898..462903,
                     462910..462912,462919..462921,462958..462960,
                     462967..462972,462997..462999,463006..463011,
                     463015..463029))
                     /locus_tag="Caur_0365"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(462892..462921)
                     /locus_tag="Caur_0365"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(462064..462873)
                     /locus_tag="Caur_0365"
                     /note="Ligand binding domain of the LacI tanscriptional
                     regulator family belonging to the type I
                     periplasmic-binding fold protein superfamily; Region:
                     PBP1_LacI_sugar_binding_like; cd06267"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(462262..462267,462274..462276,
                     462286..462288,462370..462372,462709..462717,
                     462724..462726,462733..462735,462766..462768,
                     462772..462786,462805..462810,462814..462819,
                     462826..462834,462871..462873))
                     /locus_tag="Caur_0365"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(462166..462168,462217..462219,
                     462379..462381,462454..462456,462562..462564,
                     462601..462603,462688..462690,462823..462825,
                     462832..462837))
                     /locus_tag="Caur_0365"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107262"
     gene            463509..463772
                     /locus_tag="Caur_0366"
                     /db_xref="GeneID:5824756"
     CDS             463509..463772
                     /locus_tag="Caur_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634005.1"
                     /db_xref="GI:163845961"
                     /db_xref="GeneID:5824756"
                     /translation="MWSAAAWLPRQPCSRSSAWYSVDPAGHGDAGCGVPSLVGLGTLS
                     ACYARGAACGVRQRGCRASRAHDPARGIPLTRLVTGMPGVMFF"
     gene            complement(463963..464589)
                     /locus_tag="Caur_0367"
                     /db_xref="GeneID:5824757"
     CDS             complement(463963..464589)
                     /locus_tag="Caur_0367"
                     /note="PFAM: protein of unknown function DUF88;
                     KEGG: mca:MCA1614 cold-shock DNA-binding domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634006.1"
                     /db_xref="GI:163845962"
                     /db_xref="InterPro:IPR002790"
                     /db_xref="GeneID:5824757"
                     /translation="MNNVCRIGVFYDGSYFTYAQFYFYSEKKVGWLSFVPFHRLIEQF
                     VSSKEQRYAAHRVVYASWHQGLFHSAQTSEKQFQIERNRHIDLVHAGIEPKYVPMPPN
                     GQEKGVDVSLAIDAMERAMEGKIDVAVLVTGDGDLTPLVRALMKHGVRVGLLYFEYES
                     SQRTSHVNRRLLDACNYALNVNQLEHTPQAAAIFKGLFRQPQGVVARN"
     misc_feature    complement(464065..464571)
                     /locus_tag="Caur_0367"
                     /note="LabA_like proteins; Region: LabA_like; cd06167"
                     /db_xref="CDD:199895"
     misc_feature    complement(order(464182..464184,464188..464190,
                     464194..464196,464263..464265,464545..464547,
                     464554..464556))
                     /locus_tag="Caur_0367"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199895"
     misc_feature    complement(464035..>464280)
                     /locus_tag="Caur_0367"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1432"
                     /db_xref="CDD:224349"
     gene            complement(464693..465463)
                     /locus_tag="Caur_0368"
                     /db_xref="GeneID:5824758"
     CDS             complement(464693..465463)
                     /locus_tag="Caur_0368"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     KEGG: rba:RB8188 probable glyoxylate-induced protein"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_001634007.1"
                     /db_xref="GI:163845963"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:5824758"
                     /translation="MSALAPLRFSVCLDMIFTDRPFEQRLEHIADLGFRAYEFWTRKG
                     KDMNITIALQTALRLHCVAIFGSEAAPNDPDQRARFRDEVTRSAALAVDLACDNLIVH
                     GGITRTDLDYATQRAHLVDALHEAAETAADAGLNLLLEPRNPVDHPGSFLWSSDEGFA
                     IVRELGQPHVKLLFDCYHQQISEGNLTRRILANLDLIGHIHVADVPGRHEPGTGEINY
                     EHIFGVLREHGYSGYVGLEYTPRIDAAASLRVVRMMSQ"
     misc_feature    complement(464720..465448)
                     /locus_tag="Caur_0368"
                     /note="Hydroxypyruvate isomerase [Carbohydrate transport
                     and metabolism]; Region: Hfi; COG3622"
                     /db_xref="CDD:226149"
     misc_feature    complement(464717..465442)
                     /locus_tag="Caur_0368"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     gene            complement(465894..469082)
                     /locus_tag="Caur_0369"
                     /db_xref="GeneID:5824759"
     CDS             complement(465894..469082)
                     /locus_tag="Caur_0369"
                     /note="PFAM: peptidase S9B dipeptidylpeptidase IV domain
                     protein; peptidase S41; WD40 domain protein beta
                     Propeller;
                     KEGG: rrs:RoseRS_2312 peptidase S41"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="YP_001634008.1"
                     /db_xref="GI:163845964"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR005151"
                     /db_xref="InterPro:IPR011659"
                     /db_xref="GeneID:5824759"
                     /translation="MSKSQALLRQPALDPDGRLLAFIAAGDVWLVSIEGGVAERLTAH
                     PASHYGPRFSPDGQRILFSAGRDGSGDLYVLDLAGGPPRQITFQDEQCTPEDWANDGD
                     AVFFTTAIEQMGSAIYRVKTSGGTPAPIYLEPYEQLGQVAVSPDGTRLAFVNIRERWW
                     RRGPHPFSSNEIWLGPTDPDYRALCQIAGPFGQRLVYAGKLGWPLWAPDGQGLYIVCD
                     SDGNENLWYLPLGEGEARQITHFRDGRLLFPAIARRNNVIVCERGDGQLWRIDPISGE
                     SVPVPIRVRIDSKRTPVRVERWTSGFSEVRLSPDGKKLAIVARGDVFADFADKETDRD
                     LRQGPAFRVTNTPAREWSIAWAPDSQRLIYLSDRYGEVELFAYDFSSGQEQQLTRDGR
                     PKMLPRIAPDGKSIAYIRDQRIIEVIEVTDPSPREVCQARFAVAADLCWSPDSRYLAF
                     IAQDDRLFSNVYIVPAAGGEPRQITFLSNLDGGNLCWSPDGSFIIFTTEQYRLEAQIA
                     RVDLRPSQPVFRETAFERLFEKKEEKPTEPGDQSAKEPRVSQPLTEPIIYEGIERRLR
                     LLTPPQMNAMAGPISPDGKDLLFLASVAGKVDVWTMPLDEPRANQPPRQLTASDTRKG
                     FLQFAPDGRSFYYLEDGQVVVRRFPGGNEPNRLSLRAEVEVDFHREKEQIFIEAWREL
                     RDSFYDPTFRGQDWQAVRDRYASLVGAVQTTGELHTLINLMVGELRASHLGSSFYNSE
                     SEDGFIGIIFAAEPLLREGRLIVERNLPDGPAALTADPPRPGEELVAIDGTRLNGTLS
                     LHKLLLRSVGRRVRLVLRANDGTEREIVVRPINASAYEQLRYRDWVFNNEQYVHTHSQ
                     GRLGYVHIAEMSYAAYQQFLVDLDAETHSKAGVIIDVRYNRGGHTATFILDVLMRRSA
                     LRSGFRDLGTTDASHLAGNRVLDRPTVLVTNERSASNTEMLSESYRRLRLGKVVGRPT
                     AGAVIWTYQIPLLDGSWLRLPRLYVVTPEGEDLEGRGRPVDVEAVRPLGEWAYGRDSQ
                     LDAAIATLLKTVRRRRKNDVPNPVASPDTTYE"
     misc_feature    complement(468861..468968)
                     /locus_tag="Caur_0369"
                     /note="WD40-like Beta Propeller Repeat; Region: PD40;
                     pfam07676"
                     /db_xref="CDD:203719"
     misc_feature    complement(467493..468776)
                     /locus_tag="Caur_0369"
                     /note="Periplasmic component of the Tol biopolymer
                     transport system [Intracellular trafficking and
                     secretion]; Region: TolB; COG0823"
                     /db_xref="CDD:223893"
     misc_feature    complement(467958..468059)
                     /locus_tag="Caur_0369"
                     /note="WD40-like Beta Propeller Repeat; Region: PD40;
                     pfam07676"
                     /db_xref="CDD:203719"
     misc_feature    complement(<467106..>467765)
                     /locus_tag="Caur_0369"
                     /note="Periplasmic component of the Tol biopolymer
                     transport system [Intracellular trafficking and
                     secretion]; Region: TolB; COG0823"
                     /db_xref="CDD:223893"
     misc_feature    complement(465942..467075)
                     /locus_tag="Caur_0369"
                     /note="Periplasmic protease [Cell envelope biogenesis,
                     outer membrane]; Region: Prc; COG0793"
                     /db_xref="CDD:223864"
     misc_feature    complement(465963..467075)
                     /locus_tag="Caur_0369"
                     /note="Tricorn protease; serine protease family S41;
                     Region: Peptidase_S41_TRI; cd07562"
                     /db_xref="CDD:143478"
     misc_feature    complement(order(466023..466034,466059..466067,
                     466083..466100,466125..466127,466131..466151,
                     466161..466172,466209..466211,466221..466223,
                     466230..466235,466245..466247,466296..466304,
                     466308..466316,466323..466340,466359..466364,
                     466371..466379,466386..466391,466398..466400,
                     466440..466445,466452..466457,466464..466469,
                     466473..466475,466494..466496,466539..466541,
                     466548..466550,466554..466571,466875..466877,
                     466881..466895,466905..466913,466917..466922,
                     466929..466931,466938..466943,466965..466967,
                     466974..466979,466983..466985,467007..467009,
                     467022..467036,467043..467048,467052..467057,
                     467064..467066,467073..467075))
                     /locus_tag="Caur_0369"
                     /note="Domain interface; other site"
                     /db_xref="CDD:143478"
     misc_feature    complement(order(466065..466067,466233..466235,
                     466890..466895))
                     /locus_tag="Caur_0369"
                     /note="Active site tetrad [active]"
                     /db_xref="CDD:143478"
     misc_feature    complement(order(466098..466100,466143..466151,
                     466155..466157,466230..466235,466386..466391,
                     466890..466892))
                     /locus_tag="Caur_0369"
                     /note="Peptide binding site; other site"
                     /db_xref="CDD:143478"
     misc_feature    complement(466593..466847)
                     /locus_tag="Caur_0369"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     misc_feature    complement(order(466671..466676,466833..466835,
                     466839..466847))
                     /locus_tag="Caur_0369"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238080"
     gene            complement(469242..470030)
                     /locus_tag="Caur_0370"
                     /db_xref="GeneID:5824760"
     CDS             complement(469242..470030)
                     /locus_tag="Caur_0370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; Male sterility
                     domain; KR domain protein;
                     KEGG: rrs:RoseRS_1352 short-chain dehydrogenase/reductase
                     SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_001634009.1"
                     /db_xref="GI:163845965"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:5824760"
                     /translation="MDPRDRVVIITGASSGIGAATARCFAAAGARLVLAARSQEALTQ
                     VAADLPQALAVPTDVSDPEACMRLVERAVATYGQVDILINNAGIGLTGPVTRLARADL
                     ERVLAVDLLGPIWLTQAVVPIMRAGGRGQIINVSSVLAVQPLPFLGGYAAAKAALEQI
                     SNALRIELHGSGIAVTVVRPGTTRTDFNQRRLGRGRERRRIAPPGVPPEVVARTILRA
                     ARTEPRLAYVSWSDRLALWIGRLFPGLIDAILARAFVWEEQAYH"
     sig_peptide     complement(469950..470030)
                     /locus_tag="Caur_0370"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.821) with cleavage site probability 0.755 at
                     residue 27"
     misc_feature    complement(469284..470021)
                     /locus_tag="Caur_0370"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(469272..470018)
                     /locus_tag="Caur_0370"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06181"
                     /db_xref="CDD:235726"
     misc_feature    complement(order(469482..469493,469569..469571,
                     469581..469583,469620..469628,469770..469778,
                     469917..469925,469980..469982,469986..469991,
                     469995..469997))
                     /locus_tag="Caur_0370"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(469569..469571,469581..469583,
                     469620..469622,469704..469706))
                     /locus_tag="Caur_0370"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(470049..470990)
                     /locus_tag="Caur_0371"
                     /db_xref="GeneID:5824761"
     CDS             complement(470049..470990)
                     /locus_tag="Caur_0371"
                     /note="PFAM: pyruvate carboxyltransferase;
                     KEGG: rrs:RoseRS_4162 pyruvate carboxyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxyltransferase"
                     /protein_id="YP_001634010.1"
                     /db_xref="GI:163845966"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="GeneID:5824761"
                     /translation="MTTMTIGTLPTFVHIREVGPRDGLQNEPTILTTAQKITLIELLA
                     ATGLRAIEVGAFVRPQQVPQMADTEAVFAGIKRQPGVVYSAIAPNVIGARRAIAAGAD
                     VVQVFLSASESHNRSNVNMSIEQSLVQVAEMATLVHAAGKPFDAVLSVAFGCPFEGDV
                     PIERVLDLCQRLLDLGAEQLTLGDTTGMAHPLLVQEVVRAFRARFPRQPLRLHLHSAR
                     GAGLANLLAALQLGVDLFDSSIGGIGGCPFAPGAPGNLCTEDVTHLLHEMGIATGLNL
                     PALMATARELERMLGHEVPGQTIKAGICKHLRDRGEG"
     misc_feature    complement(470127..470948)
                     /locus_tag="Caur_0371"
                     /note="3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM
                     barrel domain; Region: DRE_TIM_HMGL; cd07938"
                     /db_xref="CDD:163676"
     misc_feature    complement(order(470226..470228,470346..470348,
                     470352..470354,470670..470672,470820..470822,
                     470826..470828,470916..470918,470925..470930))
                     /locus_tag="Caur_0371"
                     /note="active site"
                     /db_xref="CDD:163676"
     misc_feature    complement(order(470835..470837,470925..470930))
                     /locus_tag="Caur_0371"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163676"
     misc_feature    complement(order(470226..470228,470346..470348,
                     470352..470354,470925..470927))
                     /locus_tag="Caur_0371"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163676"
     gene            471261..471809
                     /locus_tag="Caur_0372"
                     /db_xref="GeneID:5824762"
     CDS             471261..471809
                     /locus_tag="Caur_0372"
                     /note="KEGG: aeh:Mlg_2619 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634011.1"
                     /db_xref="GI:163845967"
                     /db_xref="GeneID:5824762"
                     /translation="MDWSKQANDMIKMWTGTQQKVWDSWMASMQYMAAPQNPEAWQKT
                     VDSWRGTVKQTLEAQVELTRMWAEAVAANSVNMPNLPPIPGVPTIPGLNPASPTSVVE
                     WSRQVLELTRNFTESQTRFIEGWFEMLKKSDPTTIARGWDTTQMQKVMQSWQEAMQRV
                     IEAQAELGKVLMGVVNNTVEKK"
     gene            complement(471908..472708)
                     /locus_tag="Caur_0373"
                     /db_xref="GeneID:5825776"
     CDS             complement(471908..472708)
                     /locus_tag="Caur_0373"
                     /note="TIGRFAM: phosphomethylpyrimidine kinase;
                     PFAM: Phosphomethylpyrimidine kinase type-1;
                     KEGG: sfu:Sfum_1692 phosphomethylpyrimidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine kinase"
                     /protein_id="YP_001634012.1"
                     /db_xref="GI:163845968"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="GeneID:5825776"
                     /translation="MTLPRCLTIAGSDSGGGAGIQADLKAFAALGAYGMSVLTAVTAQ
                     NTVGVQGVVELPAAFVGQQIDSVVTDIGVDAVKTGMLANADIIAVVAEKARAYQWPYL
                     VVDPVMVAKSGHPLLHPEAQQALITLLLPLATIVTPNLPEARALTGLNITTIAEMEQA
                     AQMIHAMGPRWVLVKGGHLEGDSVDVLFDGAQYQYFTAPRIETRHTHGTGCTFASAIA
                     AGLAKGLSVPDAVAQAKEYITTALRHAPGLGQGHGPVHHFAAWYGVAE"
     misc_feature    complement(471974..472654)
                     /locus_tag="Caur_0373"
                     /note="4-amino-5-hydroxymethyl-2-methyl-pyrimidine
                     phosphate kinase (HMPP-kinase) catalyzes two consecutive
                     phosphorylation steps in the thiamine phosphate
                     biosynthesis pathway, leading to the synthesis of vitamin
                     B1. The first step is the phosphorylation of...; Region:
                     HMPP_kinase; cd01169"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(472508..472513,472523..472525,
                     472532..472534,472541..472546,472550..472552,
                     472556..472561,472574..472588,472595..472597,
                     472601..472618,472625..472627,472634..472639,
                     472646..472648))
                     /locus_tag="Caur_0373"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(472076..472078,472469..472471,
                     472577..472579,472640..472642))
                     /locus_tag="Caur_0373"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(472079..472081,472085..472087,
                     472184..472186,472283..472285,472394..472396))
                     /locus_tag="Caur_0373"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238574"
     gene            complement(472705..473355)
                     /locus_tag="Caur_0374"
                     /db_xref="GeneID:5825777"
     CDS             complement(472705..473355)
                     /locus_tag="Caur_0374"
                     /EC_number="2.5.1.3"
                     /note="KEGG: mta:Moth_2162 thiamine-phosphate
                     pyrophosphorylase;
                     TIGRFAM: thiamine-phosphate pyrophosphorylase;
                     PFAM: thiamine monophosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_001634013.1"
                     /db_xref="GI:163845969"
                     /db_xref="InterPro:IPR003733"
                     /db_xref="GeneID:5825777"
                     /translation="MSIAHIVDWRLYVVTDAGLSRGRSHRAVIEAAIVGGATVVQYRE
                     KHASTRQMIEEALELRDLTRRAGVPLIVNDRVDVALAVDADGVHVGQDDMPVALARRL
                     IGNKLLGVSAHNLSEALQAVRDGADYLGVGPIFATTTKPDAAAPIGLDGLRAIRQHVS
                     IPIVAIGGINQANAADVMRAGADGIAVVSAVVAADDVTAAARQLRALVSVTQEKAL"
     misc_feature    complement(472801..473325)
                     /locus_tag="Caur_0374"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(472852..472854,472864..472866,
                     472939..472941,472945..472947,472966..472968,
                     472972..472974,473023..473025,473092..473094,
                     473227..473229,473233..473235,473314..473316,
                     473320..473322))
                     /locus_tag="Caur_0374"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(472852..472854,472936..472941,
                     472945..472947,473023..473025,473077..473079,
                     473134..473139,473221..473223,473227..473229,
                     473233..473235))
                     /locus_tag="Caur_0374"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(472936..472938,473023..473025,
                     473077..473079,473086..473088,473134..473139,
                     473221..473223,473227..473229))
                     /locus_tag="Caur_0374"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            complement(473383..474192)
                     /locus_tag="Caur_0375"
                     /db_xref="GeneID:5825778"
     CDS             complement(473383..474192)
                     /locus_tag="Caur_0375"
                     /EC_number="2.7.1.50"
                     /note="catalyzes the formation of
                     4-methyl-5-(2-phosphoethyl)-thiazole and ADP from
                     4-methyl-5-(2-hydroxyethyl)-thiazole and ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyethylthiazole kinase"
                     /protein_id="YP_001634014.1"
                     /db_xref="GI:163845970"
                     /db_xref="InterPro:IPR000417"
                     /db_xref="GeneID:5825778"
                     /translation="MTLNERIAELRERVRQQRPLIHHITNFVVMNDTANVTLHIGGLP
                     VMAHDRAEVAEMVTAAGALVLNVGTLSPDWIEAMLIAGRRANELGIPIVLDPVGAGAT
                     SLRTASNRRLLEELQIAVVRGNSGEIGALAGMGGVVKGVETVVEVDDPTAAAKALAQQ
                     YRTVVAVTGRQDVVTDGKRVFLVDNGHEWLKTLTGTGCSATTVIAAFAAVEREYPFAA
                     AAALACFGLAAELAAPAARGPASFKVAFYDAIYHLSADQIRAGARVTAVAG"
     misc_feature    complement(473440..474159)
                     /locus_tag="Caur_0375"
                     /note="4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase
                     catalyzes the phosphorylation of the hydroxylgroup of Thz.
                     A reaction that allows cells to recycle Thz into the
                     thiamine biosynthesis pathway, as an alternative to its
                     synthesis from cysteine, tyrosine...; Region: THZ_kinase;
                     cd01170"
                     /db_xref="CDD:238575"
     misc_feature    complement(order(473986..473991,473995..473997,
                     474055..474057,474061..474063,474079..474081,
                     474091..474093,474109..474111,474115..474117))
                     /locus_tag="Caur_0375"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238575"
     misc_feature    complement(order(473440..473442,473449..473454,
                     473458..473466,473470..473475,473611..473622,
                     473878..473883,473980..473991,474025..474030,
                     474037..474042,474046..474057,474079..474081,
                     474088..474093,474097..474114))
                     /locus_tag="Caur_0375"
                     /note="multimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238575"
     misc_feature    complement(order(473599..473601,473605..473607,
                     473623..473625,473677..473679,473683..473685,
                     473689..473691,473812..473814,473821..473823,
                     473827..473829,473908..473910))
                     /locus_tag="Caur_0375"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238575"
     misc_binding    complement(474297..474419)
                     /note="TPP riboswitch (THI element) as predicted by Rfam
                     (RF00059), score 62.60"
                     /bound_moiety="thiamin/thiaminpyrophosphate"
     STS             474738..474870
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            complement(475047..476720)
                     /locus_tag="Caur_0376"
                     /db_xref="GeneID:5825779"
     CDS             complement(475047..476720)
                     /locus_tag="Caur_0376"
                     /EC_number="1.3.99.4"
                     /note="PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein; FAD dependent oxidoreductase;
                     KEGG: afm:AFUA_4G14850 extracellular 3-ketosteroid
                     1-dehydrogenase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxosteroid 1-dehydrogenase"
                     /protein_id="YP_001634015.1"
                     /db_xref="GI:163845971"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:5825779"
                     /translation="MDRSDYQTDVLIVGSGAGALVAALVAKEAGLETLVIEKTDLVGG
                     SSAMSGGGLWIPNNPVSREAGVEDSFEMAWRYLEEVVPAAGPAASPDRRRAFLEYGPQ
                     MVEFLRRLGFRWHAAIGYPDYYPERPGGSKRGRAIEGSIFDGRQLGPWLKRLRPFPGA
                     PPIPIHTNEVASFLVSLRTVRGFLMAMRVFGRFFQRALGKVPMGLGASLVGQLLWLCL
                     QRNIPIWLESSLEELVVDHGRVAGAVVRREGRTLRVAARRGVLLAAGGFEHHGEMRER
                     YLPKPTSTDWAVGASGNTGDAIRAAQALGAAVALMDKAWGGPVVILPQGQVSFLVGER
                     SLPFSIIVDSKGERFMNESASYVDCWRWQYERHRQTPAIPAWLIMESRHRRYYPFGLL
                     PPGITPQSATSSQFLVRAQTLRELAMRIGIDPDGLERTVVRFNRMAQQGKDEDFHRGE
                     SAYDRFYSDPRVKPNPNLGPLERPPFYATAIYPGELGTLGGLLTDEWGQVLHENGEPI
                     PGLYATGNTSASVFGGTYPGPGSTLGPACTFAYIAMQHIVQNMQLVERV"
     misc_feature    complement(475077..476708)
                     /locus_tag="Caur_0376"
                     /note="3-ketosteroid-delta-1-dehydrogenase; Reviewed;
                     Region: PRK12844"
                     /db_xref="CDD:183787"
     misc_feature    complement(475092..>476117)
                     /locus_tag="Caur_0376"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(476743..477564)
                     /locus_tag="Caur_0377"
                     /db_xref="GeneID:5825780"
     CDS             complement(476743..477564)
                     /locus_tag="Caur_0377"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
                     domain protein;
                     KEGG: ttj:TTHA0660 oxidoreductase, short-chain
                     dehydrogenase/reductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_001634016.1"
                     /db_xref="GI:163845972"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:5825780"
                     /translation="MKVKNKVFVVTGGASGLGRELVLRLLDMGANVAAVDINGAALDE
                     LVGQAGQARSKLSTHVVNIADLAAVQALPEKVLSVHGAVDGLINNAGIIQPFVKVNDL
                     EDAAIDRVLKVNFYGTLYMTKSFLPYLIKRPVAHIVNISSMGALVPVPGQTMYGASKA
                     AVKLFTEGLRSELLNTNVRVTIVFPGAMATDIVKNSNVAQSSLPMQAAQAQRSSRMKA
                     LSPKEAARIIIDGIEGDRYRILVGSDARMMDWLSRLNPRWAAELIYRQMQHLLSR"
     misc_feature    complement(476770..477552)
                     /locus_tag="Caur_0377"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06181"
                     /db_xref="CDD:235726"
     misc_feature    complement(476860..477540)
                     /locus_tag="Caur_0377"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(476992..476997,477001..477012,
                     477088..477090,477100..477102,477139..477147,
                     477226..477228,477292..477300,477376..477384,
                     477451..477459,477514..477525,477529..477531))
                     /locus_tag="Caur_0377"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(477088..477090,477100..477102,
                     477139..477141,477223..477225))
                     /locus_tag="Caur_0377"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(477870..478859)
                     /locus_tag="Caur_0378"
                     /db_xref="GeneID:5825781"
     CDS             complement(477870..478859)
                     /locus_tag="Caur_0378"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: afm:AFUA_3G11050 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_001634017.1"
                     /db_xref="GI:163845973"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="GeneID:5825781"
                     /translation="MKSKTKNTKTRAQIEAMVARAFGGMALADDEGAVYELKDGWFNA
                     VYSIRLANGQEVILKIAPPPDAEVMSYEKNIMATEVATMRLVRQNPAIPVPNIYFCDD
                     THEVCDADYFFMEKLAGDTLAHMRARLPAATLATLEYQIGTIIREINSFRGTYFGYEG
                     NPDLRASTWKEAFIRIMDAVLEDAARKRVTFDYSYDEIRDVVWKHAAALEEVTIPCLV
                     HWDAWDANFFVQQGRIVGIIDFERVLWADPLMEAQFRPFFGDGITNSMRGYGKTSFTF
                     AEKQRCYLYSLHLALVMHTECYYRNYDTDEIFNFSKGFIARSMAWLRANYVYG"
     sig_peptide     complement(478773..478859)
                     /locus_tag="Caur_0378"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.978) with cleavage site probability 0.978 at
                     residue 29"
     misc_feature    complement(478107..478754)
                     /locus_tag="Caur_0378"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    complement(478107..478754)
                     /locus_tag="Caur_0378"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cd05120"
                     /db_xref="CDD:240159"
     misc_feature    complement(order(478143..478148,478176..478178,
                     478182..478187,478197..478199,478509..478520,
                     478575..478577,478683..478685,478689..478691,
                     478725..478727,478737..478739))
                     /locus_tag="Caur_0378"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    complement(order(478197..478199,478737..478739))
                     /locus_tag="Caur_0378"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     misc_feature    complement(order(478143..478148,478176..478178,
                     478182..478187,478197..478199,478509..478520,
                     478575..478577,478683..478685,478689..478691,
                     478725..478727))
                     /locus_tag="Caur_0378"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     gene            complement(478967..481228)
                     /locus_tag="Caur_0379"
                     /db_xref="GeneID:5825782"
     CDS             complement(478967..481228)
                     /locus_tag="Caur_0379"
                     /note="PFAM: glycoside hydrolase family 3 domain protein;
                     KEGG: rpc:RPC_1611 glycoside hydrolase, family 3-like"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 3"
                     /protein_id="YP_001634018.1"
                     /db_xref="GI:163845974"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="GeneID:5825782"
                     /translation="MTTNDALVQRANDLLAAMTLEEKAGQISQYFYFRGLTAQNELVE
                     AQVRAGQVGSLLFVADPRETNRLQRIAVEESRLGIPLLFGFDVIHGLRTIFPVPLGMA
                     ASWDPQLYERVQAIAAREARAVGIHWTFAPMVDIARDPRWGRIVEGAGEDPYLGAQMA
                     AAQVRGFQGEAIGAPEHVVAGPKHYVGYGAALGGRDYDEVNISESELRNVYLPPFAAA
                     VAAGAGNVMTSYVGIDGVPGAADRYLLTDVLRGELGFKGFVVSDAAAVMDLVTHGFAR
                     DAQDAAVRALRAGLDMEMWLGMRFVPGTNPIPTVGAFSTLAEAVRSGVIEESLLDEAV
                     RRVLLVKLRLGLFEQPYVNEGAAGAILNDPAHREMARIAAERAAVLLRNEGNILPLDR
                     SAVRQVAVIGPLADDRAATLGPWVFAPDLNATVTVLEGLRRTAGEGVRVEYAPGVPMP
                     TRAIPSPFASLSQALGMPASSETSFDEEAEFARAVALARASDVAVLVLGEAADMNGEA
                     ASRSTLDLPGRQLELLEAVAATGTPVVVVLLSGRPLDLRRVLPCSAAILVAWHPGSEG
                     GNAVARLLWGDATPGGKLPFSWPRSVGQVPIIYSRLNSHQPATSHQRYWEEESTPLYP
                     FGFGLTYGQVEYRNLTLSATQIGLEDTIEATVEVHNTSAREVEEVAQLYLHQRYGRAA
                     RPVRELKGFERVTLKPGERRTLRFAIPPSARRYWSKADSAYVLDESDFDVWVGGDSTA
                     ALHAEFSVRSSTV"
     misc_feature    complement(478991..481216)
                     /locus_tag="Caur_0379"
                     /note="beta-D-glucoside glucohydrolase; Provisional;
                     Region: PRK15098"
                     /db_xref="CDD:185053"
     misc_feature    complement(479909..481177)
                     /locus_tag="Caur_0379"
                     /note="Beta-glucosidase-related glycosidases [Carbohydrate
                     transport and metabolism]; Region: BglX; COG1472"
                     /db_xref="CDD:224389"
     misc_feature    complement(479333..480097)
                     /locus_tag="Caur_0379"
                     /note="Glycosyl hydrolase family 3 C-terminal domain;
                     Region: Glyco_hydro_3_C; pfam01915"
                     /db_xref="CDD:250964"
     misc_feature    complement(479015..479227)
                     /locus_tag="Caur_0379"
                     /note="Fibronectin type III-like domain; Region: Fn3-like;
                     pfam14310"
                     /db_xref="CDD:258486"
     gene            complement(481331..482578)
                     /locus_tag="Caur_0380"
                     /db_xref="GeneID:5825783"
     CDS             complement(481331..482578)
                     /locus_tag="Caur_0380"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: chu:CHU_1068 transport protein, MFS family"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_001634019.1"
                     /db_xref="GI:163845975"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:5825783"
                     /translation="MPTNKTRVSGIGLIVLAFVAFIALGLPDGLLGVGWPSIRDSFAV
                     PLDAIGMLLTTVIAGYMISSFFSGFLLSRLGVGRMLAASCLLTGMALIGYTVVPHWWM
                     MVALGVFAGLGAGAIDAGLNTYVAAHFGETLMQWLHASWGVGVTIGPILMTLGLTTLN
                     TWHFGYQIVGIFQIALAICFVLTLAMWASHARNVPSGDEPAKRLTDYQTPMIETLRQP
                     QVWLSVMLFFLYVGAESSLGIWTYTLLTESRGVDQALAGFFAGSYWFTFTIGRIAAGM
                     ITIRTGATRLVFTGLSGALLGAVLLIWNPSQLMNVVAVALIGLAIAPIFPALMSDTSM
                     RVGDHHAANTIGMQMTATGFGTAVIPGLMGVLAQRVSLEIIPLCLLVVYASLFGLYLL
                     VVRLRRVSVTVVAAKTGPTQAIK"
     misc_feature    complement(481388..482578)
                     /locus_tag="Caur_0380"
                     /note="Fucose permease [Carbohydrate transport and
                     metabolism]; Region: FucP; COG0738"
                     /db_xref="CDD:223809"
     sig_peptide     complement(482501..482578)
                     /locus_tag="Caur_0380"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.987) with cleavage site probability 0.985 at
                     residue 26"
     misc_feature    complement(481397..482539)
                     /locus_tag="Caur_0380"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(481511..481513,481520..481525,
                     481532..481537,481544..481549,481580..481582,
                     481589..481594,481604..481606,481613..481618,
                     481625..481627,481766..481768,481778..481780,
                     481787..481789,481799..481801,481811..481813,
                     481853..481855,481862..481867,481874..481879,
                     481886..481888,482144..482146,482162..482167,
                     482174..482179,482201..482203,482210..482215,
                     482222..482227,482234..482239,482375..482380,
                     482384..482389,482399..482401,482408..482413,
                     482420..482422,482471..482476,482480..482488,
                     482495..482497))
                     /locus_tag="Caur_0380"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(482668..483681)
                     /locus_tag="Caur_0381"
                     /db_xref="GeneID:5825784"
     CDS             complement(482668..483681)
                     /locus_tag="Caur_0381"
                     /EC_number="5.1.1.1"
                     /note="PFAM: regulatory protein LacI; periplasmic binding
                     protein/LacI transcriptional regulator;
                     KEGG: sde:Sde_3960 transcriptional regulator, LacI family"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_001634020.1"
                     /db_xref="GI:163845976"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:5825784"
                     /translation="MSKKSVQTLEDIARLANVSRSTVSRALNNSPLISKQTRERIQAI
                     AREHNFCLNVSGRNLRLRSSRTIAFVAPMCFPPVASAEHLFGLEMLGAIWSGLHELNY
                     DCLIVHSASQDTDWVHRYLHSGRVDGFILMESSFKQTQIEALVQMKVPFIVWGMPVSP
                     FNYCSVTGDNVAGGRLATEYLIRTGRQRIAFLGGLKGTLTVENRFKGYEQALQLAGRA
                     LDPALIVYGDYTYASGAAGMQRLLERAPDLDAVFVNSDLMAIAAINVIQESGRSVPAD
                     IAVVGYDDLSIAGYATLPLTTIRQNIPLAGKLLAQNLIQHIETGLVTNVTVPVELVIR
                     KSA"
     misc_feature    complement(482674..483660)
                     /locus_tag="Caur_0381"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(483502..483651)
                     /locus_tag="Caur_0381"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(483502..483507,483511..483516,
                     483523..483525,483532..483534,483571..483573,
                     483580..483585,483598..483600,483607..483612,
                     483616..483630))
                     /locus_tag="Caur_0381"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(483505..483534)
                     /locus_tag="Caur_0381"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(482674..483498)
                     /locus_tag="Caur_0381"
                     /note="Ligand binding domain of a transcription regulator
                     of cellulose genes, CelR, which is highly homologous to
                     the LacI-GalR family of bacterial transcription
                     regulators; Region: PBP1_CelR; cd06295"
                     /db_xref="CDD:107290"
     misc_feature    complement(order(482878..482883,482890..482892,
                     482902..482904,482986..482988,483307..483315,
                     483322..483324,483331..483333,483358..483360,
                     483364..483378,483397..483402,483406..483411,
                     483418..483426,483484..483486))
                     /locus_tag="Caur_0381"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107290"
     misc_feature    complement(order(482782..482784,482833..482835,
                     482995..482997,483070..483072,483178..483180,
                     483217..483219,483286..483288,483415..483417,
                     483424..483429))
                     /locus_tag="Caur_0381"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107290"
     gene            484035..484862
                     /locus_tag="Caur_0382"
                     /db_xref="GeneID:5825785"
     CDS             484035..484862
                     /locus_tag="Caur_0382"
                     /note="TIGRFAM: translation initiation factor IF-3;
                     PFAM: initiation factor 3;
                     KEGG: rrs:RoseRS_1032 translation initiation factor IF-3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="YP_001634021.1"
                     /db_xref="GI:163845977"
                     /db_xref="InterPro:IPR001288"
                     /db_xref="GeneID:5825785"
                     /translation="MPRLSPVARRRSRAIRDRFRINNRIRAREVRLIDENGTQVGIVP
                     LREALAMAEERGFDLVEVAPNAVPPVCRLLDYGKFRYEQSKKEREARRNQKQSELKQI
                     RLMPKTDDHDVAVKANQARRFLLAGDKVKFNLRFRGREMAHPEIGRQMLDQIAEQLSD
                     IAVIEQKPLMEGRVLSMLLAPTAKVLKAAQQAQKAAAQRTTTAESAKPATSAASTPAT
                     AEPADEEEEELIDDGDVVEEDEDDDDTFVADYDDEDDDFEDDDDDDEDDERNRRRRR"
     misc_feature    484089..484586
                     /locus_tag="Caur_0382"
                     /note="translation initiation factor IF-3; Reviewed;
                     Region: infC; PRK00028"
                     /db_xref="CDD:234582"
     misc_feature    484092..484307
                     /locus_tag="Caur_0382"
                     /note="Translation initiation factor IF-3, N-terminal
                     domain; Region: IF3_N; pfam05198"
                     /db_xref="CDD:191228"
     misc_feature    484320..484583
                     /locus_tag="Caur_0382"
                     /note="Translation initiation factor IF-3, C-terminal
                     domain; Region: IF3_C; pfam00707"
                     /db_xref="CDD:250071"
     gene            484918..485124
                     /locus_tag="Caur_0383"
                     /db_xref="GeneID:5825786"
     CDS             484918..485124
                     /locus_tag="Caur_0383"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634022.1"
                     /db_xref="GI:163845978"
                     /db_xref="GeneID:5825786"
                     /translation="MPKMKMKTHKGAKKRFKVTASGKFLQQRGVRGNKRNRPSRSQRA
                     WGKDQPISPTNRRMLQTALPYGLE"
     misc_feature    484918..485115
                     /locus_tag="Caur_0383"
                     /note="50S ribosomal protein L35; Reviewed; Region: rpmI;
                     PRK00172"
                     /db_xref="CDD:234676"
     gene            485273..485632
                     /gene="rplT"
                     /locus_tag="Caur_0384"
                     /db_xref="GeneID:5825787"
     CDS             485273..485632
                     /gene="rplT"
                     /locus_tag="Caur_0384"
                     /note="binds directly to 23S ribosomal RNA prior to in
                     vitro assembly of the 50S ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="YP_001634023.1"
                     /db_xref="GI:163845979"
                     /db_xref="InterPro:IPR005812"
                     /db_xref="InterPro:IPR005813"
                     /db_xref="GeneID:5825787"
                     /translation="MARVKRGIMVRKRHKKLLEQAKGYRGARSRHYKVAHEAVMHALA
                     DAYRDRRRRKRDFRRLWIMRINAAARLHGTTYSRLINSLKQANIEIDRKMLADLAVRD
                     PQAFARIVEQAQAAVTA"
     misc_feature    485288..485605
                     /gene="rplT"
                     /locus_tag="Caur_0384"
                     /note="Ribosomal protein L20; Region: Ribosomal_L20;
                     cd07026"
                     /db_xref="CDD:197305"
     misc_feature    order(485288..485305,485309..485320,485333..485356,
                     485360..485371,485378..485383,485393..485398,
                     485405..485449,485453..485461,485468..485470,
                     485480..485482,485498..485503,485510..485515,
                     485522..485524,485546..485554)
                     /gene="rplT"
                     /locus_tag="Caur_0384"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:197305"
     misc_feature    order(485378..485380,485390..485392,485399..485404,
                     485408..485413,485420..485422,485537..485548,
                     485555..485557,485573..485578,485594..485599)
                     /gene="rplT"
                     /locus_tag="Caur_0384"
                     /note="L21 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     misc_feature    order(485441..485443,485450..485455,485462..485464,
                     485471..485476,485480..485482,485552..485554,
                     485561..485563,485570..485572)
                     /gene="rplT"
                     /locus_tag="Caur_0384"
                     /note="L13 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     gene            485650..486432
                     /locus_tag="Caur_0385"
                     /db_xref="GeneID:5825788"
     CDS             485650..486432
                     /locus_tag="Caur_0385"
                     /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
                     ribose methyltransferase substrate binding;
                     KEGG: rrs:RoseRS_1035 tRNA/rRNA methyltransferase (SpoU)"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/rRNA methyltransferase SpoU"
                     /protein_id="YP_001634024.1"
                     /db_xref="GI:163845980"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="GeneID:5825788"
                     /translation="MALISSPANHHVKWLRSLAESARHRRRERSFVIEGVRLVTDALT
                     AGAEVRLVLYAPDQLATTTAGTALLNRLRHLPHCFPATPAVIVAAADTEQPQGVVAAV
                     TWPELPPRPGLRLVLDAIQDPGNVGTLLRSAAAAGVGLVMCAPGTVDPFNPKVARAAM
                     GAHFLVPLRVSPWETIRAELQSYTVYAADSAGQQPYYAVDWRQPAALIVGNEAHGLSE
                     PARALAHQTITIPMSGSIESLNAGVAGSIILFEALRQQTVAH"
     misc_feature    485659..486417
                     /locus_tag="Caur_0385"
                     /note="rRNA methylases [Translation, ribosomal structure
                     and biogenesis]; Region: SpoU; COG0566"
                     /db_xref="CDD:223640"
     misc_feature    485746..485955
                     /locus_tag="Caur_0385"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; smart00967"
                     /db_xref="CDD:214943"
     misc_feature    485983..486399
                     /locus_tag="Caur_0385"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            486557..487606
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /db_xref="GeneID:5825789"
     CDS             486557..487606
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a heterotetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_001634025.1"
                     /db_xref="GI:163845981"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004188"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="GeneID:5825789"
                     /translation="MTTLLDELTTLEQEALTALETVADLSALTEWKSRFIGKQGRLSR
                     LSRGLGALPASERPLVGQRVNALREQLEAAFSAAKERLEAQAVAAELAAERIDVTMPG
                     RRPAVGYVHLTNQILRQVQHIFAEMGFQVWESPEVEYDAFNFSLLNFPDDHPARDMQD
                     TFYVEMPAGAPSVLLRTHTSPGQIHAMRRNAPNPLRVLIPGKVYRNEQVTVRSEMMFH
                     QFEFLAVGRNVTMADLKGTLSFFAERMFGPGTRVRLRPSFFPFTEPSAEMDVTCFLCG
                     GKGCRICKYAGWLEIGGCGMVHPNVLRNGGYDPAEFSGFAGGFGPERVAMLKYGIDDI
                     RWFYSGDQRFVEQFG"
     misc_feature    486593..487600
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="phenylalanyl-tRNA synthetase subunit alpha;
                     Validated; Region: pheS; PRK00488"
                     /db_xref="CDD:234780"
     misc_feature    486614..486802
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="Aminoacyl tRNA synthetase class II, N-terminal
                     domain; Region: Phe_tRNA-synt_N; pfam02912"
                     /db_xref="CDD:111764"
     misc_feature    486887..487585
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) alpha chain
                     catalytic core domain. PheRS belongs to class II
                     aminoacyl-tRNA synthetases (aaRS) based upon its structure
                     and the presence of three characteristic sequence motifs.
                     This domain is primarily responsible...; Region:
                     PheRS_alpha_core; cd00496"
                     /db_xref="CDD:238277"
     misc_feature    order(486887..486889,486896..486898,486905..486910,
                     486929..486931,486944..486949,486953..486961,
                     487010..487012,487025..487027,487037..487054,
                     487112..487114,487136..487144,487154..487156,
                     487160..487162,487166..487168,487172..487174,
                     487196..487198,487247..487255,487259..487264,
                     487322..487324,487343..487351,487355..487357,
                     487448..487453,487568..487570,487574..487582)
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238277"
     misc_feature    486941..486961
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="motif 1; other site"
                     /db_xref="CDD:238277"
     misc_feature    order(487025..487033,487088..487090,487094..487096,
                     487103..487105,487169..487171,487175..487177,
                     487190..487198,487205..487207,487211..487213,
                     487217..487219,487331..487333,487337..487342,
                     487424..487441,487505..487516,487523..487525,
                     487556..487558)
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="active site"
                     /db_xref="CDD:238277"
     misc_feature    487166..487177
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="motif 2; other site"
                     /db_xref="CDD:238277"
     misc_feature    487508..487525
                     /gene="pheS"
                     /locus_tag="Caur_0386"
                     /note="motif 3; other site"
                     /db_xref="CDD:238277"
     gene            487610..488482
                     /locus_tag="Caur_0387"
                     /db_xref="GeneID:5825790"
     CDS             487610..488482
                     /locus_tag="Caur_0387"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634026.1"
                     /db_xref="GI:163845982"
                     /db_xref="GeneID:5825790"
                     /translation="MRRDELNRAIHDLYRAEHEALGERGGYELLERARQWNLAPTLAA
                     GGVIVFPHAGVADCGHQIAAAVHACLDSGADRVLVISVLHAWNDEMEQARRRVAAGGS
                     PSAERYWGIQGPGLQRGNEWQLDHALYSFRFFWELETRRRGIRGPQVIERYPYLAGGH
                     PELLPGIEELIELAQDAVIVSTADPFHHGIGYGDPPEQSFAPAEGGLELARQTIEEGM
                     QLLANGDYWGYNQHCVRAKSDARDAGQVFRFLRGPLQGEILDLVASDATQLYQSPPPT
                     WVAAPLVRWTKVTV"
     gene            488479..489411
                     /locus_tag="Caur_0388"
                     /db_xref="GeneID:5827673"
     CDS             488479..489411
                     /locus_tag="Caur_0388"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: rca:Rcas_2761 protein of unknown function DUF6
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634027.1"
                     /db_xref="GI:163845983"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:5827673"
                     /translation="MNRHRLWLYTVLFAGVLIASTASILIRYAQGTGMSSLSIAAGRL
                     GLAALILTPLALHRSSQEIRHLSRRDVIFGAAAGVFLAIHFASWISSLEYTSVASSAA
                     LVSTNPLWVGLASLFLFRERLPWTILVGIALTLIGTIVIGISDSSSSTQSNPLLGNTL
                     ALIGAMTASGYLLIGRDLRRRLSTMAYIWLVYTSAAVVLVIWTLISGQQFLGFPPQAY
                     LFVLGLALGPQLLGHTAFNYALSGLSATYVAVAILGEPIGSSLLAFLLFGETVAFLQF
                     VGIALLLVGIVIASIAEQQAPESTARQTAENQTA"
     misc_feature    488479..489366
                     /locus_tag="Caur_0388"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     sig_peptide     488479..488568
                     /locus_tag="Caur_0388"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.991) with cleavage site probability 0.846 at
                     residue 30"
     misc_feature    488527..488901
                     /locus_tag="Caur_0388"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    488974..489351
                     /locus_tag="Caur_0388"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            489472..490467
                     /locus_tag="Caur_0389"
                     /db_xref="GeneID:5827674"
     CDS             489472..490467
                     /locus_tag="Caur_0389"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     KEGG: sme:SMc00267 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_001634028.1"
                     /db_xref="GI:163845984"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:5827674"
                     /translation="MLIGLSALSFSYRCGLIGRGTPRAVSHPLDIEGVMALASRAGLQ
                     SVEFPLSLLPDLSPGRLSALRERLTLCGLTPVADSDIVDVDTLRAHIPAAAMIGAHVL
                     RVLISPVLEGYRRPFTTDWPAHLADVTDRLRAVIDLAAEHNIILAVENHQDATSADLA
                     AICAAVDSPHIGVCFDAVNCLVVGETPYAALERLGPLIRNVHLADYETYPTTQGWRLV
                     RCALGEGDLDIRRLFHLIEHYAPDVACQIELVSHSARHVRILDDDWWQGYPPCDVREV
                     LPVLRLFAQTMRLRDDDWRTPWERGAGEEQISLYEDQQYATSIAYLRTIGILPRL"
     misc_feature    489547..490254
                     /locus_tag="Caur_0389"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    489574..490152
                     /locus_tag="Caur_0389"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            490615..491100
                     /locus_tag="Caur_0390"
                     /db_xref="GeneID:5827675"
     CDS             490615..491100
                     /locus_tag="Caur_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634029.1"
                     /db_xref="GI:163845985"
                     /db_xref="GeneID:5827675"
                     /translation="MSARRIWWFVVGLLFVAGTLIWPQRSFSQAGIDQFFVDTLADNP
                     VADLNTHCTDALPNANCSLRQAIAKANAVAGSNRITINFDLVTEGSVASAPYIITITT
                     GQRLPPITRANVTISADLLNGAPQVAINANNNDAGLVLSGGGAIIEGLVIYGASNDAG
                     T"
     sig_peptide     490615..490701
                     /locus_tag="Caur_0390"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.923) with cleavage site probability 0.705 at
                     residue 29"
     gene            491087..494368
                     /locus_tag="Caur_0391"
                     /db_xref="GeneID:5827676"
     CDS             491087..494368
                     /locus_tag="Caur_0391"
                     /note="KEGG: rca:Rcas_3733 conserved repeat domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634030.1"
                     /db_xref="GI:163845986"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="GeneID:5827676"
                     /translation="MPARNRGSGIYISSSGNTVRNCSIGLTLDGSVPPDTLRNRNGIV
                     ISGSAAGNNQIGAANQPNTIAGNTVNGIVISNASDNRIQGNRIGVLFTTATVVRPNGG
                     FGVQILSDTTIDPNGRAERNLIGGTENSERNIIGGNGLSGVLISGSRTLTTTIASNLI
                     GVNLEAETGLGNNGDGVRIEDGAQATRIGSTNQTQPLVIGGNSGAGIRIHANGGAAPS
                     NTTIDGYVVVGLSRSGINARPNTQGGIYLTESAGTTTIGSSATTLRIGWNGGPGIWIG
                     PGISDVTITNAFVGALPGGILAANNGGVAINGATNVTMTASTVAANTAYDLQIANASN
                     VSLDGNLIGLHADGRSVAGSVTAGISVTNSTNVTIGNTTGNVIAAANGPGIDISGSSS
                     VSITVRANILGLRRDTTGDAYSVAAAHAGPAIRITDAAQISVAGNVIGGNGSAAGIEL
                     TNVQSATLTQNQIGWINDPGGGTTPLARPAGVGIALTNVTTATLSGNLLRLNTDDGVR
                     LTDSSAVIIDNANAIEENGGDGVQVGGNSRNVRITGNRIRANTGYAVLVTDTAQRVGI
                     TQNQMAANSAGGIHLANTTLYSGTGADPDQSLNRPNHSIDPPFDIQVSQDGIITGRVF
                     TSTAEREEDLVPVSACAGCTIQVYSPNPDLPSADGQGWQQLQVVVNGNTRADINQVSA
                     SGVFNAQMLDAPATYRQLIFAATDQFGNTSPFHIFTPTVDLRLIPLDPVQQSAAPGSS
                     ISYRLQLENHGTLQINRIRLSTSGTLSGWTVATDPAERFSLPPGGTRQITITLTLPTG
                     THPSIQVPITDTTTLSLTAPAMSAITQTLRTEVQALPVLAASPLTGAATVLPSDSYIY
                     RHQITNNGNVTVPIDISATTADLVGLDTYNTTVLTPSVTLAPGASTEIAVRITVPTGA
                     QTTTPSGNPVRATTVITATPRGFGSQAITMTDTTTVGLRYAAELRSSYEQDVRAGREV
                     VFLHTLRNTSNGRATFQLNFAASRGSTLIAFESATSGVTISGNRVTLDNIADSGKINQ
                     IVLRVRVQISELILPGSRETLRIWVSIPDTTEPLSGAEVQDVAVVRDSSGVLVPAIWV
                     PLVMN"
     misc_feature    491270..491728
                     /locus_tag="Caur_0391"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    492353..492841
                     /locus_tag="Caur_0391"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    493289..493483
                     /locus_tag="Caur_0391"
                     /note="NPCBM-associated, NEW3 domain of
                     alpha-galactosidase; Region: NPCBM_assoc; pfam10633"
                     /db_xref="CDD:151150"
     gene            494379..499541
                     /locus_tag="Caur_0392"
                     /db_xref="GeneID:5827677"
     CDS             494379..499541
                     /locus_tag="Caur_0392"
                     /note="TIGRFAM: conserved repeat domain protein;
                     SMART: Parallel beta-helix repeat;
                     KEGG: rca:Rcas_3732 parallel beta-helix repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634031.1"
                     /db_xref="GI:163845987"
                     /db_xref="InterPro:IPR001434"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="GeneID:5827677"
                     /translation="MHRRFRLALLFLILVSLLPFAQPASAASLVVNSLADTNDGACTT
                     APDGCTLREAILTANSNGVPDTITFSVSGTIYVQNSGLPPLSEGGTTIDAGDNHTIIV
                     SGEQLRDASNNVIPAHGIVIASNDNVIRGLVIIRFSRGIGFTGGGSGIYLRNNAQNNL
                     IVNTWIGHLNGSPEPNTGYGILIDGGASNNRIGTGNPTDRNVISGNTVADIGVSNNLN
                     TTPLNGNQIVGNYIGTTVSGDADQDTTSDPGNLGGISIENYAYNTLISGNLIGGYTGA
                     NAAGIVLFSDSTSSGSPSIPRGTRITGNWIGVNPTGTVIANRIGILVSGGGTYGAINT
                     EIGDPLNPIAGRNYIGGNTNGGIVIADTTFASGPTTIAGNYIGVALNASGNPFPVGNG
                     TINQTSGGEGIFVGRNAVSTIIGPGNVIAGARTNGIRIRSGNTVVRGNYIGVDPTGTQ
                     TTTTTINSPTVGYGTGDAGVWIENGSSSVIGGANLSDRNVIAAGNFAVTGSGAAVLIE
                     PCASGCSANGNTVQGNYLGVRADGNGILVGSTIVADSEGLRITNANNNTVRNNLIGGV
                     DRGINVRMNASNNLISGNRIGVRASSSDTPGSGTTTRRDGIQLNSGTNNRIEFNLIAF
                     TGQNNTSAFNAAHGIVVRSSNNQLFGNRLVRNGRLGFGHGIFVADNVTGVLISQNTTQ
                     DNAQDGIGLGSGANGDLAAPSFNAVTPGSPTVTGTTGCGAGCVVEIFTTSASVSDRNR
                     EGPVFLTSTTTGVGGAFSVNVTGCLGYITATVHNPTTGNSSPFSNALDVNATDACSTP
                     TATLTVTGGSSRAVSIGSTSTYTLTLSHTSFVTRTYTLTLDSTRGWTSGPTLVELPPN
                     GNTQLIISVAVPFTATAGDTDTTTVTARSDQTVSNPITLTTTAQAITIIPARPEVSPG
                     QIVERTGNTVTFVHTITNTGQLVGTFSVIRPDGSSGLPVFSGTPPTGWNIQSATLSSS
                     TLSPGATATLTIVANTPASTTLLAGDYPFSFRVRAISQQGSQTFTEQSDPATTDTVRV
                     PVARSFSFTAQPPTSQQLTPAATVNFSYILTNTGNITDTFIITPPTGTTPASSLSFSA
                     TPATAFTLAAGQSRPITVTVTASASEPVGTYNFTVQAGVTGGSNPPANQTASGTVQVI
                     GGGTPVFVGTPLVTPDPVLPGGTATITVTVRNGGNAAAPFDFTQTLPSGWNLISNSST
                     CPSPVPADTTTCTYVVEVAVPATADGGAATVTIQAIARNGGQIPPAPDSTASVNATVT
                     VATIRNLRFDPTPLNASADPGAVITFSHTLTNTGNAPDAFTLNLSGLPTGWTATVVPT
                     TTTTLARNASLTVTVQITVPTGISAGTTVTATIRATSQGNPAVSAEVLDSITVNAVNG
                     AELSPGTTINSLPGATAIFTHTLRNSGSTTITYDLSVRSGDAGWSALSVNPATSPILS
                     PGSSTIVTVTVTIPTGAAAGTSNTITVEARATGDSTLLASAENVVQVGALRDVEITPA
                     RTVIALPNTTTVITHTVRNLGFTADSYTITALQGDGHSAIATPNQVDLGPGESREIAV
                     LLTLPAGLAADTVLSSIRVTATSRSDSSITDSIFDSVRVGLVTGVALSSDRLQGIPDG
                     SNRVIFSGIVLENLGNATDTFDLTVSGLDSKFRASVVPTSVTLNGGAIDVGIVVTVDL
                     PPIQPFALRHDVTLTATSRRDPDQRSSIRLSMIYLTRQAIFGEPVFIPIISR"
     sig_peptide     494379..494459
                     /locus_tag="Caur_0392"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.991 at
                     residue 27"
     misc_feature    494466..494555
                     /locus_tag="Caur_0392"
                     /note="CSLREA domain; Region: CSLREA_Nterm; TIGR04214"
                     /db_xref="CDD:211937"
     misc_feature    494634..495206
                     /locus_tag="Caur_0392"
                     /note="Periplasmic copper-binding protein (NosD); Region:
                     NosD; pfam05048"
                     /db_xref="CDD:252971"
     misc_feature    495906..496418
                     /locus_tag="Caur_0392"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    <496833..>496982
                     /locus_tag="Caur_0392"
                     /note="IG-like fold at C-terminal of FixG, putative
                     oxidoreductase; Region: FixG_C; pfam11614"
                     /db_xref="CDD:256531"
     misc_feature    498216..498446
                     /locus_tag="Caur_0392"
                     /note="NPCBM-associated, NEW3 domain of
                     alpha-galactosidase; Region: NPCBM_assoc; pfam10633"
                     /db_xref="CDD:151150"
     misc_feature    <498564..498818
                     /locus_tag="Caur_0392"
                     /note="IG-like fold at C-terminal of FixG, putative
                     oxidoreductase; Region: FixG_C; pfam11614"
                     /db_xref="CDD:256531"
     misc_feature    <498939..499136
                     /locus_tag="Caur_0392"
                     /note="IG-like fold at C-terminal of FixG, putative
                     oxidoreductase; Region: FixG_C; pfam11614"
                     /db_xref="CDD:256531"
     gene            499571..500005
                     /locus_tag="Caur_0393"
                     /db_xref="GeneID:5827678"
     CDS             499571..500005
                     /locus_tag="Caur_0393"
                     /EC_number="4.2.1.10"
                     /note="catalyzes the formation of 3-dehydroshikimate from
                     3-dehydroquinate in chorismate biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="YP_001634032.1"
                     /db_xref="GI:163845988"
                     /db_xref="InterPro:IPR001874"
                     /db_xref="GeneID:5827678"
                     /translation="MTKTILVLHGPNLNMLGRREPHIYGATTLAEINEALEQRGKAAG
                     VEVICIQSNHEGVLVDAVQTHGWTASGIIINPGALTHYGLSLRDALAMVSAPIIEVHL
                     SNVYQREAFRHTSVVAPIARGQITGLGWRGYLLALEWLLAEL"
     misc_feature    499580..499969
                     /locus_tag="Caur_0393"
                     /note="Dehydroquinase (DHQase), type II. Dehydroquinase
                     (or 3-dehydroquinate dehydratase) catalyzes the reversible
                     dehydration of 3-dehydroquinate to form
                     3-dehydroshikimate. This reaction is part of two metabolic
                     pathways: the biosynthetic shikimate pathway...; Region:
                     DHQase_II; cd00466"
                     /db_xref="CDD:238262"
     misc_feature    order(499604..499606,499610..499612,499727..499741,
                     499748..499750,499757..499759,499802..499804,
                     499823..499825,499832..499837,499844..499846,
                     499904..499906)
                     /locus_tag="Caur_0393"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     misc_feature    order(499625..499627,499640..499642,499793..499795,
                     499799..499804,499811..499813,499832..499834,
                     499871..499879,499904..499906)
                     /locus_tag="Caur_0393"
                     /note="active site"
                     /db_xref="CDD:238262"
     misc_feature    order(499880..499882,499886..499891,499922..499927,
                     499931..499942,499946..499954,499961..499963)
                     /locus_tag="Caur_0393"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     gene            complement(500264..501268)
                     /locus_tag="Caur_0394"
                     /db_xref="GeneID:5827679"
     CDS             complement(500264..501268)
                     /locus_tag="Caur_0394"
                     /note="PFAM: amidohydrolase 2;
                     KEGG: rrs:RoseRS_2838 amidohydrolase 2"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase 2"
                     /protein_id="YP_001634033.1"
                     /db_xref="GI:163845989"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="GeneID:5827679"
                     /translation="MIDDAFVFDGVCHVFNFDKSNAFGKPGEMFIEHLYAFHQVLNAP
                     GEKTLSREEYMREWHVDEIARMIFDESPTDMIIAQPLPLTDLFKDGLSSWERCAEMAR
                     RYPDRAVFWGSVNPLEGKKALDLMEIQVKEYGARGFKLYNVRYDYGQPFPWRMDDPRV
                     AFPIFEKALELGVNIIGVHKGVPLGPQPVEHTQAWDMDGAAANFPEINFIIFHVGLPF
                     IDEICWQLVRYPNLYASIAATVNFVVRSPRVFAETMAKLLFWCGEDKIIYGGETPIWH
                     PRGALKAFWEFELPEDIVQGYGCGQLTKEAKKKILGLNLARLHGFDVEEKKRSLGIAA
                     "
     misc_feature    complement(500303..>500986)
                     /locus_tag="Caur_0394"
                     /note="Predicted metal-dependent hydrolase of the
                     TIM-barrel fold [General function prediction only];
                     Region: COG2159"
                     /db_xref="CDD:225070"
     gene            complement(501265..501702)
                     /locus_tag="Caur_0395"
                     /db_xref="GeneID:5827680"
     CDS             complement(501265..501702)
                     /locus_tag="Caur_0395"
                     /note="PFAM: protein of unknown function DUF59;
                     KEGG: rca:Rcas_0663 protein of unknown function DUF59"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634034.1"
                     /db_xref="GI:163845990"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="GeneID:5827680"
                     /translation="MLRELSSVSCKQEVPMNETTTVGVGHDDVMAVLQRCYDPCCKER
                     QVSVVDMGLVERVNVDGQRVAIDIILTTGWCPFALHLLQMMEEEVKTLPGIEQVQVNI
                     TWDTPWSPERMSAQARERLRLPLEQLLPLREARLRRTQKEEAP"
     misc_feature    complement(501349..501624)
                     /locus_tag="Caur_0395"
                     /note="Domain of unknown function DUF59; Region: DUF59;
                     cl00941"
                     /db_xref="CDD:260711"
     gene            502015..502524
                     /locus_tag="Caur_0396"
                     /db_xref="GeneID:5827681"
     CDS             502015..502524
                     /locus_tag="Caur_0396"
                     /note="TIGRFAM: molybdenum cofactor synthesis domain
                     protein;
                     PFAM: molybdopterin binding domain;
                     KEGG: rca:Rcas_3229 molybdenum cofactor synthesis domain"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor synthesis domain-containing
                     protein"
                     /protein_id="YP_001634035.1"
                     /db_xref="GI:163845991"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="InterPro:IPR008284"
                     /db_xref="GeneID:5827681"
                     /translation="MSHQEHRRLAETQTTAIPCAVLTISDSRSEATDDSGRYICTALT
                     QAGHNVVQYAVVRDEPAQIVEMVRRFAAEGCKVIITNGGTGISRRDSTFEAIDALLEK
                     RLPGFGELFRMLSFAEIGPAAMLSRATAGVFGGTLIFCLPGSPNAVQLGIDRLILPEL
                     AHLVWETVR"
     misc_feature    502063..502512
                     /locus_tag="Caur_0396"
                     /note="MogA_MoaB family. Members of this family are
                     involved in biosynthesis of the molybdenum cofactor (MoCF)
                     an essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea; Region: MogA_MoaB;
                     cd00886"
                     /db_xref="CDD:238451"
     misc_feature    order(502261..502269,502357..502359,502438..502443,
                     502453..502455,502462..502464)
                     /locus_tag="Caur_0396"
                     /note="MPT binding site; other site"
                     /db_xref="CDD:238451"
     misc_feature    order(502267..502269,502273..502278,502282..502284,
                     502294..502296,502318..502326,502339..502341,
                     502348..502353,502384..502386,502393..502395)
                     /locus_tag="Caur_0396"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238451"
     gene            502604..503242
                     /locus_tag="Caur_0397"
                     /db_xref="GeneID:5827682"
     CDS             502604..503242
                     /locus_tag="Caur_0397"
                     /note="KEGG: rca:Rcas_0802 4-vinyl reductase 4VR"
                     /codon_start=1
                     /transl_table=11
                     /product="4-vinyl reductase 4VR"
                     /protein_id="YP_001634036.1"
                     /db_xref="GI:163845992"
                     /db_xref="GeneID:5827682"
                     /translation="MTSVEAFRGLYYPNKIGRLCFLSLEEVMGQNGVKALLRLADLQQ
                     YIDAYPPNDLKREFPFEAISKYSVALGTMYGPRGARGLELRAGRVAFSLGLKEFGPLL
                     GMADLALKLMPITMKLKIVLNATAQTFDRFSDQSSHVEEERGRFVYHITRCSNCITRP
                     EPGPVFYIARGILEEATAWVSGGRRFAVEQLSCMGQGNCSSCAFAIGKDPLE"
     gene            503247..503459
                     /locus_tag="Caur_0398"
                     /db_xref="GeneID:5827683"
     CDS             503247..503459
                     /locus_tag="Caur_0398"
                     /note="PFAM: protein of unknown function DUF37;
                     KEGG: rrs:RoseRS_3917 protein of unknown function DUF37"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634037.1"
                     /db_xref="GI:163845993"
                     /db_xref="InterPro:IPR002696"
                     /db_xref="GeneID:5827683"
                     /translation="MLRWLLLKLIRFYQVAISPWTPPSCIYTPTCSHYGYEAIKKYGA
                     LRGGWMTVKRIARCHPFARGGYDPVP"
     misc_feature    503250..503453
                     /locus_tag="Caur_0398"
                     /note="Haemolytic domain; Region: Haemolytic; pfam01809"
                     /db_xref="CDD:250883"
     gene            503950..504624
                     /locus_tag="Caur_0399"
                     /db_xref="GeneID:5827684"
     CDS             503950..504624
                     /locus_tag="Caur_0399"
                     /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
                     family;
                     PFAM: sigma-70 region 2 domain protein; sigma-70 region 4
                     domain protein; Sigma-70 region 4 type 2;
                     KEGG: rca:Rcas_0024 RNA polymerase, sigma-24 subunit, ECF
                     subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="YP_001634038.1"
                     /db_xref="GI:163845994"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:5827684"
                     /translation="MAEPSRETIVRAQQGDQQALTELIIGQQHYVYSIAMSVLKNADD
                     AADLTQEAFIRLFRALPQYSGESRFTTWLYRLVINLCRDELRRRGRQAPIVPPATDDE
                     ELDALHTVADNDRWVDPAQSLDLNQLRLEVRRALEQLEPHYRLVLTLYYFEDLKYTDI
                     AEILDLPLNTVKSHIRRGKERLAQLLQTNEPPATRAVNQPKRSATDDHVVQITPLRLL
                     PGWGRR"
     misc_feature    503980..504510
                     /locus_tag="Caur_0399"
                     /note="RNA polymerase sigma factor RpoE; Provisional;
                     Region: PRK09652"
                     /db_xref="CDD:236608"
     misc_feature    504016..504222
                     /locus_tag="Caur_0399"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    504334..504495
                     /locus_tag="Caur_0399"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(504367..504369,504397..504399,504415..504420,
                     504448..504450,504454..504459,504463..504471,
                     504475..504480,504484..504486)
                     /locus_tag="Caur_0399"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            504628..505095
                     /locus_tag="Caur_0400"
                     /db_xref="GeneID:5827685"
     CDS             504628..505095
                     /locus_tag="Caur_0400"
                     /note="KEGG: rca:Rcas_0025 putative transmembrane
                     anti-sigma factor"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane anti-sigma factor"
                     /protein_id="YP_001634039.1"
                     /db_xref="GI:163845995"
                     /db_xref="GeneID:5827685"
                     /translation="MSTQLPTPPPDDLLDAALRHELRWEAPPELTNRLLHLVPGAVPM
                     ATAEISPLPRWRLYVAIALMSLLILVSIPSASYLYQLVWFQWGFAQFIAQLEALPARL
                     LQTFYETMPFARELVSIIALIRDQLHWLLVALVLWIILDNWQPERRLVHQESK"
     gene            complement(505523..506128)
                     /locus_tag="Caur_0401"
                     /db_xref="GeneID:5827686"
     CDS             complement(505523..506128)
                     /locus_tag="Caur_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634040.1"
                     /db_xref="GI:163845996"
                     /db_xref="GeneID:5827686"
                     /translation="MLARIALSLLLGFICGTTGLVFMPDLARVIGPLVCTGNLEPDRS
                     EGVLHFRCRTINGDEQRIKLGQMLPYAIISTSLLLIPPVHSAIRRFERRRAVIQQAIE
                     RDLATALPARAEVLRVAIVGSYKRAILVRAVEVELTLWVYPPANRPYEARVIWLVEET
                     GLSHLRRGTMLNTRINPLRPQRVYPAESWASYIWSEPVPTV"
     sig_peptide     complement(506045..506128)
                     /locus_tag="Caur_0401"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.695) with cleavage site probability 0.562 at
                     residue 28"
     gene            complement(506281..510324)
                     /locus_tag="Caur_0402"
                     /db_xref="GeneID:5827687"
     CDS             complement(506281..510324)
                     /locus_tag="Caur_0402"
                     /EC_number="2.7.13.3"
                     /note="PFAM: response regulator receiver; GAF domain
                     protein; ATP-binding region ATPase domain protein;
                     histidine kinase A domain protein; CHASE domain protein;
                     PAS fold-4 domain protein;
                     KEGG: ana:alr3120 two-component hybrid sensor and
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_001634041.1"
                     /db_xref="GI:163845997"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR006189"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="GeneID:5827687"
                     /translation="MAQWSRRALISFGVVYAVLIWVGAQPLLANRGIPLLWVAGGFAA
                     GGVLLAGKRLLPIIFIGAFIAYTVVFRQLGLSSERLLAAALVFGLSAIIQAWLVNWLV
                     RRFGRTLPPSSIRYTLVVCGLLALAVLPAPFLAVMVLVVVQQPLVSSPPIVALQWWLN
                     LVAGVWLVTPWMVLGEYYRQRRPMREPWLWPVSSLLLALMLFSLQLIWRDANRQFTTQ
                     LQADVNEVVSLINDRLTIYEQALLSQSALFLASQRVDQHEFSVFSRTQLARLPALRAV
                     SWIPRIPLQQRTAFEHAMQETGLPDFRIREPDATARPADTRDEYYPITYLEPFARRRA
                     VLGLDLAADPVRRAAIEQARDSGQVVITAPLQSYLASDPAPAVLLFAPVYSGSLPPQS
                     VEERRQRIRGMVAFLIVPGEVIEQALRPVTTPDLEFVLVDATEESLRPLAVFTGGRAV
                     PSPYISDLDIVIRDAVAISDIPRYGRVWSIAFCLGTNYLPFWWSADAISRTVLAIASV
                     AIFFLFVAIRQRHEARQRRLTRTYALLSAINQMIIRERDPQRIFQEVCQVGIGEGGFR
                     LVWIGRHNLVTSRFETIAIHSAKELDQSLVHLLTGEQLAMTLSPVCQGDRVVINDLAT
                     DPRCAAWRSQAVAYGLRAMAGFPLVVPDEPPAVLCFYAGQPAAFDHDEIQLLDELVRD
                     IIFGLLVSQQEAQLRTSEQRNHLIVSALPDLVLRLRPDGQVVDVVAAESMVLPMAPTA
                     MINSTLEQLFPAAIATQYRQALSAAFASGELQTLAYQLIVEAKEYFFEARIKAALPAE
                     EAIAIVRDVTAWRNAELALQVERDLLAQRVAERTAELHRANAELLRAARTKDEFLANM
                     SHELRTPLNSILALSESLLEELYGPLRDQQQKAIRAIEASGRHLLALINDVLDLAKIE
                     ANRIELVKEVVAASDVCEASMALVKEQATKKQIHLSIQLDDPHARFVADPRRLKQILV
                     NLLSNAVKFTPAGGAVSLQVTTDTTQGTIAFTVSDTGIGIAEEDLSRLFQPFVQLDSG
                     LSRQHEGTGLGLVLVRRLVELHGGKVEVESMPGVGSRFTVTLPYQPVTHIAASSSADE
                     LPPVQLALIIEDSATTADQLARYLEELQIQPVICSYGKGAVEQVQALRPDLILLDVQM
                     PDRSGWEILADLRRDPDLRQVPVIIVSVVDEPERGLAAGAAAYLVKPINRLMLRRALS
                     QITVTKTTSSTAPRRPLSRRILLAEDNEVNRVTLSDYLVAQGYEVRVACQGKEALQIA
                     AEWRPDLIIMDIQMPGLDGLEVIQRLRADAAFAATPIIAVTALAMPGDRERCLSAGAN
                     DYFAKPIRLRQLVERIEQFLASSQHAI"
     misc_feature    complement(<509749..510303)
                     /locus_tag="Caur_0402"
                     /note="MASE1; Region: MASE1; cl17823"
                     /db_xref="CDD:266863"
     misc_feature    complement(509002..509577)
                     /locus_tag="Caur_0402"
                     /note="CHASE domain; Region: CHASE; pfam03924"
                     /db_xref="CDD:252251"
     misc_feature    complement(508225..508731)
                     /locus_tag="Caur_0402"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(507091..508095)
                     /locus_tag="Caur_0402"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(507589..507786)
                     /locus_tag="Caur_0402"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(507604..507606,507616..507618,
                     507625..507627,507637..507639,507646..507648,
                     507658..507660,507715..507717,507724..507726,
                     507736..507738,507745..507747,507757..507759,
                     507769..507771))
                     /locus_tag="Caur_0402"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(507751..507753)
                     /locus_tag="Caur_0402"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(507109..507426)
                     /locus_tag="Caur_0402"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(507121..507123,507127..507132,
                     507145..507147,507151..507153,507199..507210,
                     507289..507294,507298..507300,507304..507306,
                     507310..507312,507385..507387,507394..507396,
                     507406..507408))
                     /locus_tag="Caur_0402"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(507394..507396)
                     /locus_tag="Caur_0402"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(507202..507204,507208..507210,
                     507292..507294,507298..507300))
                     /locus_tag="Caur_0402"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(506707..507039)
                     /locus_tag="Caur_0402"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(506746..506751,506758..506760,
                     506806..506808,506872..506874,506896..506898,
                     507025..507030))
                     /locus_tag="Caur_0402"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(506896..506898)
                     /locus_tag="Caur_0402"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(506872..506880,506884..506889))
                     /locus_tag="Caur_0402"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(506743..506751)
                     /locus_tag="Caur_0402"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(506305..506649)
                     /locus_tag="Caur_0402"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(506347..506352,506359..506361,
                     506416..506418,506482..506484,506506..506508,
                     506635..506640))
                     /locus_tag="Caur_0402"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(506506..506508)
                     /locus_tag="Caur_0402"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(506482..506490,506494..506499))
                     /locus_tag="Caur_0402"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(506344..506352)
                     /locus_tag="Caur_0402"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(510394..510882)
                     /locus_tag="Caur_0403"
                     /db_xref="GeneID:5827688"
     CDS             complement(510394..510882)
                     /locus_tag="Caur_0403"
                     /note="PFAM: flavin reductase domain protein FMN-binding;
                     KEGG: ttj:TTHB244 phenol hydroxylase component B"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase domain-containing protein"
                     /protein_id="YP_001634042.1"
                     /db_xref="GI:163845998"
                     /db_xref="InterPro:IPR002563"
                     /db_xref="GeneID:5827688"
                     /translation="MSIDPREYRSTIGLFATGVTVITASDGDHIRGMTANSLTSVSLD
                     PLLLLVCVDRKARMAPVISAASHFAVNILRADQEAIARHFAGRPQPDIEVALEELAGA
                     PVLSASLATLVCSRERILDGGDHLIVLGRVIALRRAAEGDPLLYFAGAYRQLAEMSTT
                     LA"
     misc_feature    complement(510430..510846)
                     /locus_tag="Caur_0403"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; smart00903"
                     /db_xref="CDD:214900"
     gene            511410..511865
                     /locus_tag="Caur_0404"
                     /db_xref="GeneID:5825759"
     CDS             511410..511865
                     /locus_tag="Caur_0404"
                     /note="KEGG: rrs:RoseRS_1508 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634043.1"
                     /db_xref="GI:163845999"
                     /db_xref="GeneID:5825759"
                     /translation="MTITDRMLTGAIANNPGNYHGDGEWRYSITQRTIYFSKAAAPDP
                     RDQEPFFPLPSLNPDGSGRMERAFRQFIRRRWPPSRCTELEKFAERRGWHLAMELKYG
                     GGALEDHEAAEWQYVVNRELQRLAAEVRARIAELEQQATQSEPTPASGG"
     gene            complement(511828..512208)
                     /locus_tag="Caur_0405"
                     /db_xref="GeneID:5825760"
     CDS             complement(511828..512208)
                     /locus_tag="Caur_0405"
                     /note="KEGG: rca:Rcas_3946 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634044.1"
                     /db_xref="GI:163846000"
                     /db_xref="GeneID:5825760"
                     /translation="MNVKALQRGFWLSFWSVVIYMIVRGALIPARLRHPRITSLSGIE
                     PMYAMLSWGYGPGSRPVNVIFDVQFAGGAQGSVTVDGEALEAEVPLIGKAQPGESYTI
                     TATLVYRQLGRAFTRQMQVSAQIE"
     gene            complement(512205..512492)
                     /locus_tag="Caur_0406"
                     /db_xref="GeneID:5825761"
     CDS             complement(512205..512492)
                     /locus_tag="Caur_0406"
                     /note="PFAM: protein of unknown function UPF0044;
                     KEGG: mgm:Mmc1_3700 protein of unknown function UPF0044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634045.1"
                     /db_xref="GI:163846001"
                     /db_xref="InterPro:IPR001890"
                     /db_xref="GeneID:5825761"
                     /translation="MKPAQRAYLRRLAHPLPVTVMIGKNGLTEGILAKIEQELNAHEL
                     IKVRFLDHKDMKQSLTETIVSETGADLVAIIGHTAILFRQHADPTQRKIQV"
     misc_feature    complement(512208..512492)
                     /locus_tag="Caur_0406"
                     /note="Predicted RNA-binding protein containing KH domain,
                     possibly ribosomal protein [Translation, ribosomal
                     structure and biogenesis]; Region: COG1534"
                     /db_xref="CDD:224451"
     gene            complement(512489..513274)
                     /locus_tag="Caur_0407"
                     /db_xref="GeneID:5825762"
     CDS             complement(512489..513274)
                     /locus_tag="Caur_0407"
                     /note="PFAM: glycosyl transferase family 2;
                     KEGG: rca:Rcas_1701 glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001634046.1"
                     /db_xref="GI:163846002"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5825762"
                     /translation="MTTNNEPFLSIVIPAYNEERRLPATLAAIKAFLVNEPYTAEVIV
                     VDDGSEDRTAEVAEAAGATVLRCEHRGKGFAVRTGALAARGDIILLCDADLATPIEEW
                     PRLRAAIERGYPIAIGSREGIGASREGEPWYRHVMGRVFNWIIRLVALRGINDTQCGF
                     KALRRAVARDLFQRVRIYGDDAPIVRGAAVTAYDVELLFLAQRRGYAICEIPVKWRYG
                     TETKVNPLRDSWRNLRDVLRVRINDLCGKYDVTSTPIEEVAPR"
     misc_feature    complement(512531..513250)
                     /locus_tag="Caur_0407"
                     /note="transferase 2, rSAM/selenodomain-associated;
                     Region: glyco_like_mftF; TIGR04283"
                     /db_xref="CDD:234532"
     misc_feature    complement(512609..513244)
                     /locus_tag="Caur_0407"
                     /note="DPG_synthase is involved in protein N-linked
                     glycosylation; Region: DPG_synthase; cd04188"
                     /db_xref="CDD:133031"
     misc_feature    complement(order(512993..512995,513227..513229,
                     513233..513235))
                     /locus_tag="Caur_0407"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133031"
     misc_feature    complement(order(512993..512995,513227..513229,
                     513233..513235))
                     /locus_tag="Caur_0407"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133031"
     misc_feature    complement(order(512993..512995,513227..513229,
                     513233..513235))
                     /locus_tag="Caur_0407"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133031"
     misc_feature    complement(order(512993..512998,513134..513136))
                     /locus_tag="Caur_0407"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133031"
     misc_feature    complement(512993..513001)
                     /locus_tag="Caur_0407"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133031"
     gene            complement(513271..514233)
                     /locus_tag="Caur_0408"
                     /db_xref="GeneID:5825763"
     CDS             complement(513271..514233)
                     /locus_tag="Caur_0408"
                     /note="PFAM: glycosyl transferase family 2;
                     KEGG: rrs:RoseRS_1415 glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_001634047.1"
                     /db_xref="GI:163846003"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:5825763"
                     /translation="MIDVVVPNYNGSALLPTCLDSLRAQTRRDFTVTVVDDASTDDSV
                     ALITTRYPEVRVLRLPQNRGFAAAVNAAFAATREPFFVLLNNDTEADPNWLAALIGAL
                     ERWPQFAFAAAKLRLFDRRNIIHSAGDFYRPNGEPGNRGVWEEDRGQYDAFHEVFGPC
                     AGAAAYRRCALEQLAEDGRVFDEALVMYCEDVDLNLRARRKGLRTIFVPTAVVYHRLS
                     ASGGGVLASYYCGRNFPLVWVKNMPPVVQRRYWPALLVSQLRFALHSLRHFREPAARA
                     RLRGQLAGLRALPHFWSRRAFTPEEEAALVAAFELSQPPAQRFV"
     misc_feature    complement(513376..514233)
                     /locus_tag="Caur_0408"
                     /note="Predicted glycosyltransferases [General function
                     prediction only]; Region: COG1216"
                     /db_xref="CDD:224137"
     misc_feature    complement(513586..514224)
                     /locus_tag="Caur_0408"
                     /note="Subfamily of Glycosyltransferase Family GT2 of
                     unknown function; Region: GT_2_like_c; cd04186"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(513973..513978,514123..514125))
                     /locus_tag="Caur_0408"
                     /note="Probable Catalytic site; other site"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(513655..513657,513661..513663,
                     513973..513975))
                     /locus_tag="Caur_0408"
                     /note="metal-binding site"
                     /db_xref="CDD:133029"
     gene            complement(514230..515084)
                     /locus_tag="Caur_0409"
                     /db_xref="GeneID:5825764"
     CDS             complement(514230..515084)
                     /locus_tag="Caur_0409"
                     /EC_number="1.1.1.133"
                     /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
                     hydroxysteroid dehydrogenase/isomerase;
                     dTDP-4-dehydrorhamnose reductase; Male sterility domain;
                     KEGG: rca:Rcas_1699 dTDP-4-dehydrorhamnose reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="YP_001634048.1"
                     /db_xref="GI:163846004"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="GeneID:5825764"
                     /translation="MRIAITGANGQLGRALIATLADQHTLVPLGHDQLELTDPVTVEQ
                     IAATDADVVIHAAAYTNVDGCARDPGLAYRVNGLGTRYVALGCRRIDAALVYISTNEV
                     FAGDARRPYFEDDPPRAINPYGQSKLAGEQAVRSLVARHFIVRVAWLFGGERNFVRTV
                     LRLAANPPAHGLRMVADEIGSPTYTFDVAAGLARLITTDYYGTYHFVNDGICSRYEFA
                     AEILRRVGLNIPLQPIRLCDFQRDSTPPPYTPLANLAGASLGITFRPWQDALADYLGR
                     LPNEVLPT"
     misc_feature    complement(514272..515081)
                     /locus_tag="Caur_0409"
                     /note="dTDP-6-deoxy-L-lyxo-4-hexulose reductase and
                     related proteins, extended (e) SDRs; Region:
                     dTDP_HR_like_SDR_e; cd05254"
                     /db_xref="CDD:187564"
     misc_feature    complement(514254..515078)
                     /locus_tag="Caur_0409"
                     /note="RmlD substrate binding domain; Region:
                     RmlD_sub_bind; pfam04321"
                     /db_xref="CDD:252525"
     misc_feature    complement(order(514638..514649,514704..514706,
                     514716..514718,514788..514796,514860..514862,
                     514905..514907,514911..514919,514974..514985,
                     514992..514997,515049..515060,515064..515066))
                     /locus_tag="Caur_0409"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187564"
     misc_feature    complement(order(514704..514706,514716..514718,
                     514788..514790,514857..514859))
                     /locus_tag="Caur_0409"
                     /note="active site"
                     /db_xref="CDD:187564"
     misc_feature    complement(order(514545..514547,514563..514565,
                     514605..514607,514641..514643,514716..514718,
                     514788..514790))
                     /locus_tag="Caur_0409"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187564"
     gene            complement(515326..516807)
                     /locus_tag="Caur_0410"
                     /db_xref="GeneID:5825765"
     CDS             complement(515326..516807)
                     /locus_tag="Caur_0410"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: response regulator receiver; ATP-binding region
                     ATPase domain protein; histidine kinase A domain protein;
                     PAS fold domain protein;
                     KEGG: rca:Rcas_3604 putative PAS/PAC sensor protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS sensor protein"
                     /protein_id="YP_001634049.1"
                     /db_xref="GI:163846005"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:5825765"
                     /translation="MEQNTILIVDDDELMRSLLIEIITPFNLRLITAQRGDQALQLAQ
                     QHLPDLILLDVMLPDMNGFEVCQRLRDDPATAQIPIVMITALNDREAKIHGFEAGADE
                     FITKPFDPGELQARINTVLRLNRYRRLLQEQAKVNVERARFEWVIETSDNAYVIIDHD
                     DQIRYANRRARTYLGLTANEQPVRPFRELVTQRYRLVPPEAWEQWPIGAPELLYLVHP
                     ETSRSPEQWLQVEAARIHPSDDQIVVTLCDVTQQITLQRDMWTFHTAISHKLRTPLVS
                     YLGGLNLLYDNIEHMDRTMARNIAAIALSAAKRLQQVIDDIFLYVRSPGDIHYDNCTV
                     FDLPAMVSTLNQELEIPAISLSIDPVLDARRLRISRRSLEMVLRELCENARKFHPQQR
                     PMVTIRVDADLAQNQVRLVVCDDGVHLPPAHLQKIRQPYYQAERNFTGQVEGMGLGLA
                     QVARIILAVGGSYQMRNRSDRPGICVELRIPFVEEDSSDRVIG"
     misc_feature    complement(516448..516789)
                     /locus_tag="Caur_0410"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(516487..516492,516499..516501,
                     516556..516558,516622..516624,516646..516648,
                     516775..516780))
                     /locus_tag="Caur_0410"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(516646..516648)
                     /locus_tag="Caur_0410"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(516622..516630,516634..516639))
                     /locus_tag="Caur_0410"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(516484..516492)
                     /locus_tag="Caur_0410"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(515440..516387)
                     /locus_tag="Caur_0410"
                     /note="phosphate regulon sensor kinase PhoR; Region:
                     phoR_proteo; TIGR02966"
                     /db_xref="CDD:234074"
     misc_feature    complement(516058..516360)
                     /locus_tag="Caur_0410"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(516139..516141,516154..516156,
                     516232..516243,516280..516282,516298..516300,
                     516310..516312))
                     /locus_tag="Caur_0410"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(516112..516114,516118..516120,
                     516202..516207,516214..516216,516238..516240,
                     516250..516252))
                     /locus_tag="Caur_0410"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(515842..516012)
                     /locus_tag="Caur_0410"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(515857..515859,515869..515871,
                     515878..515880,515890..515892,515899..515901,
                     515911..515913,515968..515970,515977..515979,
                     515989..515991,515998..516000,516010..516012))
                     /locus_tag="Caur_0410"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(516004..516006)
                     /locus_tag="Caur_0410"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(515368..515682)
                     /locus_tag="Caur_0410"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(515380..515382,515386..515391,
                     515407..515409,515413..515415,515461..515472,
                     515551..515556,515560..515562,515566..515568,
                     515572..515574,515650..515652,515659..515661,
                     515671..515673))
                     /locus_tag="Caur_0410"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(515659..515661)
                     /locus_tag="Caur_0410"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(515464..515466,515470..515472,
                     515554..515556,515560..515562))
                     /locus_tag="Caur_0410"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(517036..517461)
                     /locus_tag="Caur_0411"
                     /db_xref="GeneID:5825766"
     CDS             complement(517036..517461)
                     /locus_tag="Caur_0411"
                     /note="KEGG: rrs:RoseRS_2524 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634050.1"
                     /db_xref="GI:163846006"
                     /db_xref="GeneID:5825766"
                     /translation="MYIRWVVRKHKNAEIANTNFYDAYLVESYRDERGQPRQRTVAYL
                     GNIRQINNEFPTIERELFLLRADRILDTLPELTESDRQEIREALRRKIPPLNRDEVIR
                     AFTANLTWYRQWWEQNGCPLTDDELLSIIRATRGGMEAV"
     gene            complement(518662..535179)
                     /locus_tag="Caur_0412"
                     /db_xref="GeneID:5825767"
     CDS             complement(518662..535179)
                     /locus_tag="Caur_0412"
                     /note="KEGG: ddi:DDBDRAFT_0184530 colossin A;
                     TIGRFAM: conserved repeat domain protein;
                     PFAM: protein of unknown function DUF11; Thrombospondin
                     type 3 repeat; Cna B domain protein;
                     SMART: Fibronectin type III domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001634051.1"
                     /db_xref="GI:163846007"
                     /db_xref="InterPro:IPR001434"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR003367"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR008454"
                     /db_xref="GeneID:5825767"
                     /translation="MLRQNIVAARRTLLSLLLILTVVLAGLRPDVALANATTDVTLST
                     NFPVVNSGDWSVINVDYSCSSVLNTPCENATVTVVLPPTLAGGVGDVQALGAGTSPSY
                     NPATRTVTWTFNAPLAAGDSGRLELRVRFPAGSTPDGTTATLRAEMRSTTAPPDLSNP
                     LTITARAEPNAVATKTFVSGGAPDVPTTYQLQVCIPNNGSGALNLTNVQITDTLPTGV
                     TFVSASDGGTFNGATNTVTWPPTSLTVPGSLCATRTVTVIFPSATFTVGTEVRNVMDV
                     TAQAGSVTITLTDDDVRRIQPPTPGYGFTKNGPTTALVGDTVTYTFNTINTGTTPLND
                     VVVTDPVPPELQVTRITAAGGNIAGVRVELEYTTNLNPTFTAVPGSPFTTTSCVNIAP
                     NTGGGCTTLTLGAGEQITAIRWRYLDPLPFGFSATGHNFSAVVTASPINGVVVNQATS
                     TFTYNGFTATRTDEARTRIIEPGARAEVAKSVSPAVAYAGDTVIYTITLANTAVGSPA
                     AALINPMLADLLVPALIYVPGSATVVSRPAGAPDPVLEVIEDFNGTGRTLLRWRWDSY
                     SLPPNASFTLRFEARIDPATQAGTINNTASLASFANPAGEIFIDRCSQQNPDSNDFDG
                     DGNITELLCSSSITSLSLAAAANASSAKWVLGQLDTEWTRDPDTGLTTPGGMADYRLI
                     ITNTNSVPLTNLVLIDILPWVGDVGVVRFNDPRDSQWQPYLAGPIVVPDGATVYYSTT
                     NNPCRNPDLGLTDANGDPIDAPGCVDPQWSTVLPSDITTVRSVRIDFGSRVLYPQDSI
                     VITWPMRAPLGGTPGEIAWNTFGYRAFDINGNPLLAAEPPRVGIERGPVIPPSYGNYV
                     WLDANLNGVQDTGEVGVNGARIDFYQDSDGVAGPSTGDRWVGFTISGPDNDGNPGYYL
                     FSDPTDIPPGDYYIRVTPPAGYSLTTPDQGGDDSRDSDINLTTRYSAVTTLISGENDD
                     TWDVGLINDTAVGNYVWIDRNGNGVQDEPSGDGVNGITVRLYTASGTLVDTTVTADDL
                     LGNPGYYLFSGLSAGNYYVEFVLPAGLNFTTADSGSNDQLDSDANPTTGRTDVFTLVT
                     NQFDRSRDAGLLVPAGTLALGNRVWHDRDNDGRYEPLNGEAGINGVRLSLFRDVNSNG
                     QPDAGEYVGSSTTATVSGEAGYYQFTNLVAGDYIVVIDDDNFAPGGALFGMRSSSGND
                     PAPDPDTNVDHDDNGALFGATVRSQPITLTINGEPTDDGDGTNGNQTLDFGFVNGAAL
                     GDRVWFDTNSNGIQDAGEPGVAGVTVELLDGSGNPIDSDPTTSGVQPTITVTDGVGRY
                     GFSGLAAGTYQVRFSNLPAGYSFTTADQGANNDLDSDVNNAGLTPVITLAANQTDLSW
                     DAGLVATPASLGDRVWNDLDYDGIQDAGEPGVSGVQVQLYRPGYDNVAGTTDDELVAT
                     TTTDSNGNYGFTNLPPGRYFVAFGSPPAGFAVSPTDQGSDDTVDSDADLTTRRTAIIE
                     LTPGENDPNWDMGLFVFASIGDRVWSDTNNNGIQDTGEPGVGGVQVRLYRPGSSVPVA
                     TTTTNSSGFYSFTNLIPADYYVEFSLPGGYRASPQNQGSDDTLDSDADPITRQTATTT
                     LDPGENDPTWDFGIVPTASIGDRVWLDLNANGIQDASETTGVPGVQVVLYDSAGNPLN
                     TTVTDVDGFYRFENLLAGDYYLRFVVPASFIISPQDQGGNDNADSDADPTTFLTVATT
                     LSAGENDLRWDLGLYQLASIGDRVWHDINGNGRQDGGEPGVANVPVELYQPGNDGQAG
                     TADDVLVASATTDGIGEYLFSNLQPGRYFVAFGAASGYSLLSPRDAVVATDETDSDVD
                     ANRRTPIVELLSSTSNRTLDMGVLNPASLGNRVWFDADVDGVQDPGESGVSGVTVRLF
                     ALDGTLVATQTTDANGEYLFTNLSPGEYYVVFSNLPANRSFTRVDQGGDDTADSDANP
                     LDGRTGIVRLNSGDANLTVDAGIFETITVGDRVWLDRDADGVQDIDETTGIPGVRVEL
                     LRDSDGTVLDYTFTDSNGLYQFTNLFPGTYRIRFSEIPTGYLRSPQDQGSDDQLDSDA
                     NSSFETAPFTPVSGNNPQYDLGLYQPAEIGNFVWEDRNGNGRQDAGEPVLANVTVTLN
                     GTTGAGDPVSLTTQTDSNGIYLFANLVPGTYTVSVSAPAGYVFTAANQGDDTGDSDTN
                     ASGVMATTTLESGESDLSWDAGLYRPASIGNFVWRDTNGNGVQDSGESGIDGVTVTLT
                     GTTGSGSPVSLTITTGGGGIYSFTNLAPGSYQITVTAPTGERFTYRDITATEVAGATD
                     NNDSDADNAGAMIATTLDSGESDLSWDAGLVIPASLGDFVWEDLDGDGVQETGEPGFA
                     NVTVELIGAGRDRTFGTADDTLATTTTNGSSGYGFTDLQPGLYRVRFTRPNGYGFTVG
                     DATAATDATDSDVPTGTAATATTTTIDLESGENDPTWDAGLYQLLSLGNRVWEDTDNN
                     GQINGSETGINGVTVRLYRDLNGDGDVSDSGETTPVATTTTANGGYYLFSGLVQGNYL
                     VEVVLPAGYVSSTGTNGSATGAYEPAPDADTNTTDSDDNGTRSGGVVRSTIVRLAPNS
                     EPTAESDPLPGSITDPARNENSNLTVDFGLFRPASIGNLVWFDRDADGVQDGGDETGI
                     GGVTVRLYDASNTLIATTTTAADGSYGFDYLIPGNYYLVFDLPTDYVRSPQDQGGNDT
                     ADSDPDRTSGQTIVTNLVAGESDLSWDAGLYQRVNLGNQVWNDVNNNGLLDSGESGID
                     GVVVDLYYDADRNGIIDGSEETPIATTTSAGGGFYNFTDLDPGNYLVEIPASNFAGGT
                     ALGPSGNQPAFRSSTGTNGSATGPYEAAPDPDNNVDNDDNGTTDGSGAVRSALITLRS
                     QDEPTGDGDGNNGNLTVDFGFFRPLTLGNLVWHDVNNNGQRDSGEAGIDGVTVQLYRD
                     TNANGSYDAGTDTLVATTTTGGGGDYRFTDLVPGDYLVVIPASNFGTGGALRFYRSSD
                     NGNATDTANDPDGDIDNDDNGIGPNVGVVTGAATDLVRSTAVTLGLDGEPTGEDGDSN
                     TNLTVDFGFYSLTIGNRVWIDLNNNGVFDAGDINGGYANGRTVNLLYDANNDGVISGS
                     ETTAVATITTSNGGRYLFGGLRDGGNYAVEVVSDASNVSSTGVNGSASGPYEPGLDPD
                     SSTVDNDDNGTATGNNERSPVFTVRVGLMPTGEPDAVMPAGVTNPAADANSNLTIDFG
                     LFDDARIGDQVWLDVNGNGIRETGETTYIAGVTITIYNATTGQPLDGDPNTPGIQPIT
                     RTSVAAATSYLFDRLIAGTYYLAFSDIPAQYAISPLGQGGDNTVDSDVDPSSLRTANI
                     VLTNNNDLSWDLGLYPRLTLGSLVWYDSNDNGLVDGGESGISGVQVDLYRDSNNNGQP
                     DAGEFVASTTTDATGNYSFTGLEQGNYIVVIPDSNFAIGQPLYRHRSSTGSNGAATGP
                     YEPAGDPDNNSDNDDNGTDTSNGVVSGVISLNPSVEPTTDGDGANGNLTLDFGFFEPL
                     TLGNLVWHDVNNNGQRDSGEAGIDGVRIELYLDSNGNNQVDAGEFVAFTTTASGGLYT
                     FSDLIEGNYIVRIPASQFGAGQPLAGFVSSTGTNGSATGSYEPAPDPDSNIDNDDNGT
                     TSGSGNVDSAPVTLARSTEPTTDGDGDNGNLTVDFGFFRHARLGDRVWHDQDADGIQD
                     TGESGIGGVSVQLFSAGPDNAIGGGDDALVATTSTDGSGVYGFSHLLPGNYYLIFAQP
                     TGYSDVSPQDQGSDNAADSDVDPVTRQTPLITLAAGDNDPSWDMGVFNRVSIGNFVWE
                     DTDGDGVQDSGEPGVANVTVLLNGTTGAGTVVNLTTTTDSNGFYRFNNLAPGTYTVTV
                     QLPTGYAFTAANQGSDDGLDSDADPTTGAMSATVLTSGEVDLTWDAGLYRPASVGDRV
                     WLDSNGNGLQDTGESGIQSVAVAIYSVGPDGVIGGGDDVFVAATSTDSSGNYSFSGLR
                     PGSYYLLFNLPAGYNISPQDQGSDNTIDSDVNPISRQTTVITLASGDNDPTWDMGLYQ
                     PASVGNVVWHDVNGNGVQDTGESGIGNVTVTLYRADGSMVGSTTTAADGSYSFTNLPP
                     GEYYLVFSNLPSGYVFTAADQGGDDAADSDASQSTGQTATFTLVSGQVDERWDAGAYQ
                     PASIGNFVWEDTDGDGVQDGTESGVANVTVRLNGTTGAGAAVTLTAITDSDGFYRFDN
                     LAPGTYTVMVQASAGYAVTATDQGGDDARDSDADPNTGVMSATELESGEVDLTWDAGL
                     YRPASIGDRVWRDTNGNGIQDSGEPGVANVTVQLSGTTGAGAVVAQTTTTDGDGLYRF
                     TNLAPGTYTITVTAPAGDGFTAADQGGDDSRDSDANSSGVMSATTLVSGEEDVSWDAG
                     LFGAASIGNFVWEDINGNGVQDAGEPGIEGVEVQLTGTTGIGTVVNLTTTTDSDGFYR
                     FDNLAPGTYTVAVQSPGGYVFTTDNQGSDDARDSDANPATGEMSATVLESGEVDLIWD
                     AGLYRPASIGNFVWEDTDGDGVQDTGESGIGNVTVTLYRADGSPVGSTTTAADGSYSF
                     TNLPPGEYYLVFSNLPSGYVFTAADQGGDDAADSDASQSTGQTTTFTLVSGQVDERWD
                     AGVYQLTSVGDLVWLDRNGNGVQDVGESGIENVTVTLYRADGSTVGSTTTAADGSYSF
                     TNLPPGEYRLRFTDIPSGLTFSPADSSGDDTTDSDVTATNGETDVFALLSGQSDTNRD
                     AGVYPLLSLGNLVWEDTNNNGVVDSGESGVGGVQVRLYRDSNSNGTWDASDQEVASTV
                     TDGNGVYRFTNLPQGDYIVVLPGRQFEADSPWFNYRSSTGARSLSGGPYEPGVAANGD
                     LDNDDNGTRQSDVDSSFNIVSSLITLRPDGEPDTAVDGDDRNSNLTVDFGIFRPATVG
                     DLVWNDLNGNGIYESTEPGVANVLVTLYDVGDDGIAGTSDDVMVATQRTDDDGFYLFE
                     NVPPGDYYLVFSDLSGGARFTYPDRGGDDASDSDADPGNGATTTFTLQSGSENLDWDT
                     GLILPASIGNLVWEDRNGNGVQDGGESGIAGVTVRLTGTDSDGNSVDVSVVTDIDGVY
                     RFENLLPGNYTITVAPPAGYVFTAADQGSNDALDSDADPNTGAMNATVLESGEVDLSW
                     DAGLYRPASIGNFVWEDTDGDGVQDGTESGVANVTVLLNGTTGAGTVVNLTATTDSNG
                     FYRFDDLAPGTYTVTVQVPAGYVVTVANQGSNNALDSDADPDTGAMNATVLESGEVDL
                     TWDAGIFLPATLGNRVWHDINANGIADSGETGVSGITVSLYRADGTLVQTVVTDSNGA
                     YLFTNLPPGDYYLTFSLPNGWVFSPSGQGGDSGRDSDVDPDTQRTQVFTLGYGQTDLS
                     WWAGIHQPAPPTAITLLSFTAERQANGVLLRWVTGSERDTLGFLLLRSSTGNRADATP
                     ILSTPIPAQGSAGSGASYQWFDRTAQPNVSYHYWLVEVEVDGDRHEFMLSSPAVQFTY
                     RVLVPIIQR"
     sig_peptide     complement(535102..535179)
                     /locus_tag="Caur_0412"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.957) with cleavage site probability 0.468 at
                     residue 26"
     misc_feature    complement(534136..534354)
                     /locus_tag="Caur_0412"
                     /note="Domain of unknown function DUF11; Region: DUF11;
                     pfam01345"
                     /db_xref="CDD:250549"
     misc_feature    complement(533575..533742)
                     /locus_tag="Caur_0412"
                     /note="Domain of unknown function DUF11; Region: DUF11;
                     cl17728"
                     /db_xref="CDD:266796"
     misc_feature    complement(531949..532164)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(531106..531333)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(530722..530952)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(530380..530577)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(530026..530226)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(529315..529506)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(528961..529155)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(528613..528810)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(527026..527220)
                     /locus_tag="Caur_0412"
                     /note="Cna protein B-type domain; Region: Cna_B;
                     pfam05738"
                     /db_xref="CDD:253360"
     misc_feature    complement(<524866..525009)
                     /locus_tag="Caur_0412"