GenomeNet

Database: RefSeq
Entry: NC_010381
LinkDB: NC_010381
Original site: NC_010381 
LOCUS       NC_010381             177642 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Lysinibacillus sphaericus C3-41 plasmid pBsph, complete sequence.
ACCESSION   NC_010381
VERSION     NC_010381.1  GI:169825414
DBLINK      Project: 58945
            BioProject: PRJNA58945
KEYWORDS    RefSeq.
SOURCE      Lysinibacillus sphaericus C3-41
  ORGANISM  Lysinibacillus sphaericus C3-41
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae;
            Lysinibacillus.
REFERENCE   1  (bases 1 to 177642)
  AUTHORS   Hu,X., Fan,W., Han,B., Liu,H., Zheng,D., Li,Q., Dong,W., Yan,J.,
            Gao,M., Berry,C. and Yuan,Z.
  TITLE     Complete genome sequence of the mosquitocidal bacterium Bacillus
            sphaericus C3-41 and comparison with those of closely related
            Bacillus species
  JOURNAL   J. Bacteriol. 190 (8), 2892-2902 (2008)
   PUBMED   18296527
REFERENCE   2  (bases 1 to 177642)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JAN-2008) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 177642)
  AUTHORS   Yuan,Z., Hu,X., Zheng,D., Yan,J. and Cai,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2007) State Key Laboratory of Virology, Wuhan
            Institute of Virology, Chinese Academy of Sciences, Wuchang
            Xiaohongshan Zhongqu 44, Wuhan, Hubei 430071, P.R.China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000818.
            Bacillus sphaericus C3-41 is available from Wuhan Institute of
            Virology, Chinese Academy of Sciences. Email address: yzm@wh.iov.cn
            DNA used for sequencing was isolated from B. sphaericus C3-41
            following standard protocols.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..177642
                     /organism="Lysinibacillus sphaericus C3-41"
                     /mol_type="genomic DNA"
                     /strain="C3-41"
                     /db_xref="taxon:444177"
                     /plasmid="pBsph"
     gene            439..1674
                     /locus_tag="Bsph_p001"
                     /db_xref="GeneID:6020534"
     CDS             439..1674
                     /locus_tag="Bsph_p001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695590.1"
                     /db_xref="GI:169825415"
                     /db_xref="GeneID:6020534"
                     /translation="MFLERITERQEEILVYLFKVRGATVKQITQGVFSTTEDLSDSHL
                     YRKMFDTVNRLEKKQLITSFASKYSKALIYFLTEKGLNMVYDFLFVPLNHTGKGFNDD
                     YGYFKHSVHMPPKLSVNHFLQQTNFYNIVLALKKKVPGAFDYRDNLYAAKQYDYMAGT
                     TNITGAYKPDGELLVEDQRFFIEVDTGSEYSSEFQTKFNNLFNYLQSLANNGEEIPTA
                     IVFVANKVQRRRFNGLVNPSEQRRYFTIKEAFEKACGNFTKRVDLVYLQLKQVERYFL
                     QFTREEKRPEFNKIANQLNRIKKFNYYKGERDDEFYFQDPDNPNLTYFVMRIEAFSNL
                     RWKRLLQVMEKQEEGGRNMRAIVFYEHFFSPPLHLGDRSSLPAKTKELYDKIYHLKLS
                     DNGLQWYNPYHESINAPFQ"
     misc_feature    478..1098
                     /locus_tag="Bsph_p001"
                     /note="Replication-relaxation; Region: Replic_Relax;
                     pfam13814"
                     /db_xref="CDD:222397"
     gene            1818..4811
                     /locus_tag="Bsph_p002"
                     /db_xref="GeneID:6020524"
     CDS             1818..4811
                     /locus_tag="Bsph_p002"
                     /codon_start=1
                     /transl_table=11
                     /product="TraG/TraD family conjugal transfer protein"
                     /protein_id="YP_001695591.1"
                     /db_xref="GI:169825416"
                     /db_xref="GeneID:6020524"
                     /translation="MKQLKKKEGKIENRFARLNRIAKIEEFIRIKFHLGAVTSLSFIN
                     VFILVPIALCMWLGAILGNPSMMLMQDWSWGITIFFWILPLLTWYYSTITIPYQKDHK
                     YILDFNDTVRGRWISAIANVGALHVMTWAVFAKYVVEYYLGYLASIRLDAAYKPFLLT
                     TDLDSFILILFVLPALISGLMIFIQVRDFMVHKDMLSESFMTWKAPIIRRFTHKKLLG
                     TADIIIGYQFKTMIPIVLKEAQRFLHEAVIGATGSGKTSTALLLRIAQDLINIATGRR
                     KMGLVFLEPKGDGVDDVLKMCKKLKIPDEKIKVIDATKAFTIKFNPFIGPSAPAAATF
                     EGTINALSGDQDDFYKGQQNEAASTLTKLAKIAFGEKTNIFHIQRMFSDPRYLANIVE
                     SIREQITTNREKQFREQKDLIMLLDSLGTSVEHIEQTEHELMFKLKNLSNSSAINENQ
                     KKLNEIQELKKRNNLLRAQQIEIDNTEQIIFYFENEVLLYKVDQRTQQPILYPKNHIY
                     ANQQMVESKKDKFVTGAKKYLNDIALNDLLKNLFIGAEGEEVFDADEFLREGGVLLVN
                     TSLAELDELSLMFGQFFIRQFQSAIFRRPQEGRIPIFFYIDEFPLYVNEAFERILTLG
                     RSYNVGAVIAMQSIGQLEGVKAGYQDIILGNASSKTVFGRGPNKDNEYFSLEFGEKEI
                     NEESLNESASPMTSEDQKWGYRLNTAKKKVARFSTTAIRELPFKHMIVQIVDETNSIA
                     PPLKAVGRFVNEARFIKPYLNLKKSDIKSNQEKEVGGLVENAIKGFSKPEIKEGDIVH
                     IPIESMPKLEDEVKPFDKSEDELLEILKYVEEVEEFIEQKTIAQQENSWEQILYSSED
                     NKEDVSSVATNENKVELEPIHIESTDEIKVSKITKEGEQNIENLMKELHEAVEGSTGN
                     KQVYNPLDSEELVVNDYLPPPEENEELPPLEHAYLAALPTEVNHINKQINEPQTKKTV
                     ADSNSIEKPAVQPYVTMGTMIEDDF"
     misc_feature    <1863..>2051
                     /locus_tag="Bsph_p002"
                     /note="Tetrahydromethanopterin S-methyltransferase,
                     subunit E; Region: MtrE; cl01675"
                     /db_xref="CDD:242646"
     misc_feature    <3420..4052
                     /locus_tag="Bsph_p002"
                     /note="Type IV secretory pathway, VirD4 components
                     [Intracellular trafficking and secretion]; Region: VirD4;
                     COG3505"
                     /db_xref="CDD:226036"
     misc_feature    3618..3989
                     /locus_tag="Bsph_p002"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; pfam12696"
                     /db_xref="CDD:221719"
     gene            4837..5592
                     /locus_tag="Bsph_p003"
                     /db_xref="GeneID:6020519"
     CDS             4837..5592
                     /locus_tag="Bsph_p003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695592.1"
                     /db_xref="GI:169825417"
                     /db_xref="GeneID:6020519"
                     /translation="MTVSYLKYEEPQGLTFNLSRFKLERLGVVCFVNNENALDLLNNL
                     CKVYLVPNVFMLNAGLGNTGRFNPLLGNHNTASDTLCELLQHPVGLNIDLLNTTRLIE
                     AYMLLLKMNFNNGVTFKHVRQVIIDRDYCRFITQSLSNKGISNEIISKLLNIVAITET
                     VEIRDYLDRSLKSLDNLTPLKGHLFEHNFSQHTFNTYGFLQDGGALIVNTGAQKEASD
                     ILERSIVFHLKNLIMEKPMIYKAPTQIYDLYEL"
     gene            5739..6875
                     /locus_tag="Bsph_p004"
                     /db_xref="GeneID:6020542"
     CDS             5739..6875
                     /locus_tag="Bsph_p004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695593.1"
                     /db_xref="GI:169825418"
                     /db_xref="GeneID:6020542"
                     /translation="MLFLLSENNSGGYMMTTTNIFTQHEEQLQLQQALATLREAARMK
                     TRILKGTVYGVETLTLVGHKQQVLAVDFNGIFGYIPASKIDNYDFKGLQAFVGTEFDF
                     VVEELFIPSELETDNDEIEEAPNNATEAIVESNPEITLSEEYEQKTISVDAADTLVSE
                     EPSQLTEQKNSKHSKHDSSTIKQTRFIGNRAAALEIQSNRFWKSLQTKGVSNQIYDAF
                     VSGVDKVNVWLVVEGMRVRMNRMNFSYKFIDDLRNELYIGDMIKVKVLSFEEKEVDGN
                     KVRNLEVSRKVLEKDPKEFLHNIKVKGTYLGVVKNIDIDNGVFVELQTFGITVLTSFP
                     SMDSGIKLQKEKQVNVRVTKINTETGFVHGVIFDPRSGRRPRRD"
     misc_feature    <5940..6059
                     /locus_tag="Bsph_p004"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:245202"
     misc_feature    order(5943..5945,5970..5972,5976..5978)
                     /locus_tag="Bsph_p004"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    6372..6596
                     /locus_tag="Bsph_p004"
                     /note="Ribosomal protein S1-like RNA-binding domain;
                     Region: S1; smart00316"
                     /db_xref="CDD:197648"
     gene            6879..8015
                     /locus_tag="Bsph_p005"
                     /db_xref="GeneID:6020398"
     CDS             6879..8015
                     /locus_tag="Bsph_p005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695594.1"
                     /db_xref="GI:169825419"
                     /db_xref="GeneID:6020398"
                     /translation="MAESLFVVKDLDPNSQRSSSVTLGPPKATSHPFIGGTTPKDVLQ
                     YLPPSGDPFSLYGDPYAELVYIDNEQGFRKASYWLQDRVESNSFTDKEIALINFLSVH
                     RCATRSQIKKALFSPSDNEQKVKKFIETSHKRGIISCFSWQSPCRFENQKKKPRVYGL
                     SPIGCQAAEILFHRQLPREFRFQPVKFPIGTNPKMDYIFQHLVANELYCNMMTVDRVI
                     NWERSRRVLLNDGSEFKTQYATELIKDYNEIRTLWIEVVRVKAGWYEAIIRRFQTIQN
                     ALERAEELSKPERIIVIADDDSRIPILAELAETYLPDIKIRFTTDERLLSSWGPETFI
                     QCVAGEQVLNPSPIPFLLPDYKGMTATEYRNSYSSIEFEDEFED"
     gene            8023..8301
                     /locus_tag="Bsph_p006"
                     /db_xref="GeneID:6020452"
     CDS             8023..8301
                     /locus_tag="Bsph_p006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695595.1"
                     /db_xref="GI:169825420"
                     /db_xref="GeneID:6020452"
                     /translation="MLNLMSLIVKSDSDIEELLRVNETLIVNGQQYMVVTDPNNGTAA
                     FVKVFTNENGEDRISDIYDDDEFQKVQNAYENQGNIKLTIRRQYFDAK"
     gene            8291..8839
                     /locus_tag="Bsph_p007"
                     /db_xref="GeneID:6020497"
     CDS             8291..8839
                     /locus_tag="Bsph_p007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695596.1"
                     /db_xref="GI:169825421"
                     /db_xref="GeneID:6020497"
                     /translation="MLNEIIKPLYANEIIKSLYAGEKIIIVGECGAGKTHLLNQIREA
                     LIADNNPASILAGKFQANSEKDFDEILDEIKHHKNYAGKNFILMDEEDKFWLDDFKFL
                     DKIADKLQSDIGYVATMQAGRGMKKIQEVIADKNVTKYFSKIIVVGYPRRSKGYFIVI
                     DKKDENTFNWSHFERLQSNLYY"
     misc_feature    8360..>8512
                     /locus_tag="Bsph_p007"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl17189"
                     /db_xref="CDD:247743"
     gene            8879..9367
                     /locus_tag="Bsph_p008"
                     /db_xref="GeneID:6020485"
     CDS             8879..9367
                     /locus_tag="Bsph_p008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695597.1"
                     /db_xref="GI:169825422"
                     /db_xref="GeneID:6020485"
                     /translation="MDNREQFLNYQINLANKMLGVTFNGTTLQEKECFFQQYNEPLRN
                     AVAQMFSQMHVARTAIVIRFGDGCTETDWVVAESKEQAVQFYMEVMKGTDIELEDLEI
                     SDIDIQLEYMLYKEDEVPVADQVIFNKSKTNGYLEVPFVYAISYALENGMKLPDIIQS
                     FE"
     gene            9588..10133
                     /locus_tag="Bsph_p009"
                     /db_xref="GeneID:6020481"
     CDS             9588..10133
                     /locus_tag="Bsph_p009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695598.1"
                     /db_xref="GI:169825423"
                     /db_xref="GeneID:6020481"
                     /translation="MKKTAILVDEMNVIQQLRRLGIHGFNPWNAFYQALQRWNGDKKG
                     VKAFYCANVPKEDAEHEKRNNFFEGLINHNIKVSVGTVVYDSNSRRIAKGVDVALALD
                     IVEHARSGVQDIFICTGDADVVPAIIRAQELGSRVHVVVSRAIPAKNITLAADSVVRL
                     EDILETMPPHRIKYFAKERVS"
     misc_feature    9597..10061
                     /locus_tag="Bsph_p009"
                     /note="LabA_like proteins; Region: LabA_like; cd06167"
                     /db_xref="CDD:199895"
     misc_feature    order(9612..9614,9621..9623,9873..9875,9939..9941,
                     9945..9947,9951..9953)
                     /locus_tag="Bsph_p009"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199895"
     misc_feature    <9852..10124
                     /locus_tag="Bsph_p009"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1432"
                     /db_xref="CDD:224349"
     gene            10133..10972
                     /locus_tag="Bsph_p010"
                     /db_xref="GeneID:6020509"
     CDS             10133..10972
                     /locus_tag="Bsph_p010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695599.1"
                     /db_xref="GI:169825424"
                     /db_xref="GeneID:6020509"
                     /translation="METAPQEIFDLTLAKKTENEKELENAYRRIPDEYHDFIVLLEQK
                     IKITDSRYFLAEEFITMGAYQDEKGIYLKIKKPYMTVDGRIRMARDEHSKKEAKLIIS
                     EPQIIQVGNRICMNVTVESEIHGTATGTIEVNINGFGVDKKNPVANAQTSALGRALGF
                     LGYGIIGTAATASLDEATNLYNSLFASPSKEQVDPKKPEIKRVRICGPIEYKNNDLGY
                     VQIQLETEEYVIMQIGKSLFRYENILVTNAVVKVRGWWNGEIFAAAPDQDIILDQNKK
                     IVS"
     gene            11099..11950
                     /locus_tag="Bsph_p011"
                     /db_xref="GeneID:6020507"
     CDS             11099..11950
                     /locus_tag="Bsph_p011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695600.1"
                     /db_xref="GI:169825425"
                     /db_xref="GeneID:6020507"
                     /translation="MNYETKMAKILKENLFVNHRIEAQTGNTALQQITYKAQNTMEHN
                     LVYTLTNNNIFVTGDFGEAVFTFPFTVTLHNLKNCSLELFRSSLNTFSKCSWHFDKET
                     AISALKGYWEEKKVDSIYEDHDKIYEGFMFAIHCSNSVEDYNSELLPVISKTTGDAQL
                     LRVAADFGKCISPNLIAMWVGLLDIVRINEKTAINIEKVEVNTQYFKELLQYAEFSPT
                     FIIGGDEFSDDHTDFKKVERYNDLAIALNEQGISYIKIPVTDLKSLQFGEKEAKGIEE
                     YHARYKK"
     gene            12013..12270
                     /locus_tag="Bsph_p012"
                     /db_xref="GeneID:6020409"
     CDS             12013..12270
                     /locus_tag="Bsph_p012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695601.1"
                     /db_xref="GI:169825426"
                     /db_xref="GeneID:6020409"
                     /translation="MGNGKGPNCDRGELLKGVKKLEEGSLLVINELGNGAGWKFEVLD
                     TEVVSISKEDYHYMLDIHCNDWTEESEEKVTAKMKEVLVLK"
     gene            12546..12926
                     /locus_tag="Bsph_p013"
                     /db_xref="GeneID:6020532"
     CDS             12546..12926
                     /locus_tag="Bsph_p013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695602.1"
                     /db_xref="GI:169825427"
                     /db_xref="GeneID:6020532"
                     /translation="MEDTMRTPILLRLPSDVVKLLNLYMDEEYIQHLNTALDRLLLEY
                     TRKYDGSGPLFQNSYTWPSPNDEDTSYLYKVPDKVLTRIDSMVTEAFDKGYTRLTGAN
                     RSGVIYNLIRVYVPSSYQTSAQIS"
     misc_feature    <12735..>12869
                     /locus_tag="Bsph_p013"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:245815"
     gene            13367..14410
                     /locus_tag="Bsph_p014"
                     /db_xref="GeneID:6020470"
     CDS             13367..14410
                     /locus_tag="Bsph_p014"
                     /note="pBt001-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695603.1"
                     /db_xref="GI:169825428"
                     /db_xref="GeneID:6020470"
                     /translation="MRVIDGIQFFDAEQQFLKLYEYEQEHEQQKKLTASSVVTYLLMR
                     SQCDEAGLIYETEFNLKLVCEKLGLPYSSIHNGYHRLYEIGLLAITRIGERTYIQLPM
                     VAAHVPSKEDNEISSYFRIPNAIFNGTFLNTFIKARDVRGLLGVFDLLNGLFREYSNK
                     RNTSLKRKKETLIKKLKQSKYAFKSWIRRVFSNKESLIEIKIEHEDMYELKFSEAAFT
                     DREQDVVYEKFNAAVRNTLSSLLKSSSIKYATKDLKDMQFACQQELTAPLYRAILVND
                     QAEKFASLVVPDVISNTINKIENSNAKVLGAYFRRTIKSQIQEVMKEEIPLRRLIAST
                     YRDEGLEVPVQFL"
     gene            15146..16525
                     /gene="dnaG2"
                     /locus_tag="Bsph_p015"
                     /db_xref="GeneID:6020451"
     CDS             15146..16525
                     /gene="dnaG2"
                     /locus_tag="Bsph_p015"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="YP_001695604.1"
                     /db_xref="GI:169825429"
                     /db_xref="GeneID:6020451"
                     /translation="MPRISQETIDAVLSVPIIDLANVMGDKLIRKGKQYTIPCPDPNH
                     TEKVSDNAYIEPNKNVFKCFSCMVGGNSAVAYYAIKTYGTYDSKKHFLPSVRAVAELM
                     GIQIKNEDGTISLPGATEPQRRFVKAVELEPKEPKILDVVYRAFLNLCPIRQNHLNEW
                     INKRRYSKNEIQTMMLKSVPTSDEWKSIYQTLHDLGYPLERIPGFAERFIPEFYEECN
                     PELGSGLETLQIQGKDTRGTWLYTPSTFVSGYFIPVRDENGYIVRLRICQDNGNPKYI
                     WFSSEHNLQTETKLPYIRRNGTSSGAPHSVSVPFTILNKWQPGTHVSEVISIKEMIIT
                     EGEHKSQISANFFNRYVRGLAGIGNFATLLDEIKELKALGLEKVVIAIDMDTLEKEDD
                     SIKSEKKQKNLFNILKTFATELLKLDVTCCLWTWNLQHGKGLDDLVYNRKLPIEINLR
                     TGERQTVRI"
     misc_feature    15155..15478
                     /gene="dnaG2"
                     /locus_tag="Bsph_p015"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     gene            16537..16827
                     /locus_tag="Bsph_p016"
                     /db_xref="GeneID:6020391"
     CDS             16537..16827
                     /locus_tag="Bsph_p016"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand DNA-binding protein"
                     /protein_id="YP_001695605.1"
                     /db_xref="GI:169825430"
                     /db_xref="GeneID:6020391"
                     /translation="MQSILLTGRLTTDPLLTYTPEIAKCTFFLAVASNHNGYKKTDFI
                     PCVAWRQQAELLGNFARKGQKIEVRGYIRSRTFTSEGQKVSYLEFEIVDAEY"
     misc_feature    16537..>16785
                     /locus_tag="Bsph_p016"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    16546..16809
                     /locus_tag="Bsph_p016"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    order(16546..16557,16627..16635,16660..16662,16666..16668,
                     16729..16731,16756..16758,16786..16788,16795..16797)
                     /locus_tag="Bsph_p016"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(16561..16569,16585..16587,16612..16614,16633..16638,
                     16654..16659,16663..16665,16669..16671,16675..16677,
                     16681..16683,16720..16725,16747..16749,16753..16755,
                     16759..16764,16798..16800,16804..16806)
                     /locus_tag="Bsph_p016"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(16729..16731,16735..16737,16741..16743)
                     /locus_tag="Bsph_p016"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            16856..17455
                     /locus_tag="Bsph_p017"
                     /db_xref="GeneID:6020390"
     CDS             16856..17455
                     /locus_tag="Bsph_p017"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein (SSB)
                     (helix-destabilizing protein)"
                     /protein_id="YP_001695606.1"
                     /db_xref="GI:169825431"
                     /db_xref="GeneID:6020390"
                     /translation="MINRVVLVGRLTKDPELRYTPNGIASTRFTIAVNRTFSNQQGER
                     EADFISCVAWRKQAENLANYMRKGNLIGVEGRIQTGSYEGQDGKRVYTTDVVADSVQF
                     LEPRNGNGGAPPAPQNNGGQTYGNNQPSYSGGQPQQQFGGSMPGQGSYGGGSYPNNQP
                     NQTYGPPGGTSQPNYTRVDEDPFANSKGPIEVSEDDLPF"
     misc_feature    16856..>17173
                     /locus_tag="Bsph_p017"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    16868..17164
                     /locus_tag="Bsph_p017"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    order(16868..16879,16952..16960,16994..16996,17000..17002,
                     17063..17065,17090..17092,17123..17125,17132..17134)
                     /locus_tag="Bsph_p017"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(16883..16891,16907..16909,16937..16939,16958..16963,
                     16988..16993,16997..16999,17003..17005,17009..17011,
                     17015..17017,17054..17059,17081..17083,17087..17089,
                     17093..17098,17135..17137,17141..17143)
                     /locus_tag="Bsph_p017"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(17063..17065,17069..17071,17075..17077,17156..17158)
                     /locus_tag="Bsph_p017"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            17654..18751
                     /locus_tag="Bsph_p018"
                     /db_xref="GeneID:6020399"
     CDS             17654..18751
                     /locus_tag="Bsph_p018"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_001695607.1"
                     /db_xref="GI:169825432"
                     /db_xref="GeneID:6020399"
                     /translation="MQMQLNSKTIVNGINKVGRFKSKEKTKPALQFILLNVNTDNLEF
                     IASDNEVYYKHVEPVAEGITKTGSFLIPFKLEDALRKVSGTVSLTLEGTTLKFEAKGI
                     KASIPVAVYNDFPKEPTGEAGPAIQFTKEQLLEIVNQCGYASATSDTRPVLKGLNMSG
                     QNGEFQVVSTDSYRLVKKVRKQAIELPALTIPTKTLKSVLESLEDEVDFAMAPFGTQL
                     IIKTDAQEIFIRLITSTYPDTSKLAVIGDDYIKVKVNTKEITDALETVMLFAEEKSKG
                     KNVLLESKGDQLRISVKGENGEIEHFINAEGEEFTKTAMNAKYLITAVNAHKKSTTDL
                     LFKKGKSEAPVFIMCDDETLVQLILPIRIKQ"
     misc_feature    17654..18742
                     /locus_tag="Bsph_p018"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    17654..18739
                     /locus_tag="Bsph_p018"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cl17512"
                     /db_xref="CDD:248066"
     misc_feature    order(17723..17725,17873..17875,17891..17893,18233..18235)
                     /locus_tag="Bsph_p018"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(17882..17884,17954..17956,17960..17962,18455..18457,
                     18551..18556)
                     /locus_tag="Bsph_p018"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(18161..18163,18167..18178,18599..18601,18728..18739)
                     /locus_tag="Bsph_p018"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(18161..18163,18167..18172,18383..18385,18491..18493,
                     18530..18535,18608..18610,18728..18739)
                     /locus_tag="Bsph_p018"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            18919..19269
                     /locus_tag="Bsph_p019"
                     /db_xref="GeneID:6020525"
     CDS             18919..19269
                     /locus_tag="Bsph_p019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695608.1"
                     /db_xref="GI:169825433"
                     /db_xref="GeneID:6020525"
                     /translation="MEEYVMKTNDIVINKVKKWLEAEDKSYKWLAEQLGVSKPLVGFM
                     LNGERTLKPERIEQLAKIMGITTKELVQSDAIKKDQLTVNLRGELSNRRSKRELDSLL
                     FAINDYLGLKEQVK"
     misc_feature    18958..19128
                     /locus_tag="Bsph_p019"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(18967..18969,18979..18981,19054..19056)
                     /locus_tag="Bsph_p019"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(18976..18978,19051..19053)
                     /locus_tag="Bsph_p019"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(18997..19002,19033..19035,19042..19044,19054..19059)
                     /locus_tag="Bsph_p019"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            19270..20031
                     /locus_tag="Bsph_p020"
                     /db_xref="GeneID:6020448"
     CDS             19270..20031
                     /locus_tag="Bsph_p020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695609.1"
                     /db_xref="GI:169825434"
                     /db_xref="GeneID:6020448"
                     /translation="MERKKSPEEIYAEDIAEAFALSYLQEKFGHDFFIGSQIENIIAE
                     NENVNIIYQYVEDVKYFGAAVSHESGEKFIAINSYHPLRIRYFTVAHELWHLTRGIMI
                     QDKNFNHERAADRFAAAVMLPRTLTKDLWERYKKESGIEKTVISIADLAQVPYQSVIR
                     RAKEIGIKFPSSLLKKTEEEWQVERIKLGFPSSNLDKAVKDTRFFAYEDVVVKGVEHY
                     GLDTLTAASKLAKFAPQKAEQYQKILYVGDAEDES"
     misc_feature    <19483..19758
                     /locus_tag="Bsph_p020"
                     /note="Domain of unknown function (DUF955); Region:
                     DUF955; pfam06114"
                     /db_xref="CDD:147984"
     gene            20021..20662
                     /locus_tag="Bsph_p021"
                     /db_xref="GeneID:6020403"
     CDS             20021..20662
                     /locus_tag="Bsph_p021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695610.1"
                     /db_xref="GI:169825435"
                     /db_xref="GeneID:6020403"
                     /translation="MSRKGKVFIDTNILFYASQYHIKDVFQWIESLYEEIYIHQMVLD
                     ELISSTARSKVESKLKEGQWILFDPDDEETLSDEQFAIYEGYLSDVKQAFVDLDEKKK
                     SEGRRLKNTNDLGEMHSLAAAMLIGASIIFSNDYDVLEVIHDAQLCITLDETEESVLI
                     DHDSLLDFCCYLVDSKLESKGPVKKFLKLFQGDKVIEFDTRINEKESTSKISE"
     misc_feature    20039..>20158
                     /locus_tag="Bsph_p021"
                     /note="PIN (PilT N terminus) domain: Superfamily; Region:
                     PIN_SF; cl14812"
                     /db_xref="CDD:246722"
     gene            20716..21822
                     /locus_tag="Bsph_p022"
                     /db_xref="GeneID:6020484"
     CDS             20716..21822
                     /locus_tag="Bsph_p022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695611.1"
                     /db_xref="GI:169825436"
                     /db_xref="GeneID:6020484"
                     /translation="MLLHSEFLDVFFYFFYTNTWGDYMQLELFDKNDFKQHKKYLDGL
                     MKSKEDIIKIAQKAGRTRLYKVLSFGGGTQSSHLLEAHFRNEIDYDFIVFSDTGAEPE
                     FIHEQVSWWRRRQKELSNNTPFIITTHNSMERGLEEMLMRYLQTDYQRFQLPLYFNKV
                     DEETGEIRKGGLMKRQCTGDFKIVPAQQAVRNEIKKQLGLRPKQQIPKDIGIIMDIGF
                     SYDEMNRVGGYISHQSKYIYLAYPLIEQGLTTQDSIEFLINNDFPSRRSRCYFCPFNC
                     SGERARDIGMDWEEIIETEPISFLKACFFDEELRKCQASGKKNMQSIPYFHFSRKALK
                     EVYSDSFKLLNNKFGLKILEWRKEWELFIDSKYN"
     misc_feature    20911..>21294
                     /locus_tag="Bsph_p022"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases, ATP sulphurylases Universal
                     Stress Response protein and electron transfer flavoprotein
                     (ETF). The domain forms a apha/beta/apha fold which  binds
                     to Adenosine nucleotide; Region: AANH_like; cl00292"
                     /db_xref="CDD:241758"
     misc_feature    order(20917..20922,20929..20940,20995..20997,21001..21003)
                     /locus_tag="Bsph_p022"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     gene            22105..23103
                     /locus_tag="Bsph_p023"
                     /db_xref="GeneID:6020498"
     CDS             22105..23103
                     /locus_tag="Bsph_p023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695612.1"
                     /db_xref="GI:169825437"
                     /db_xref="GeneID:6020498"
                     /translation="MAKSIHASINEFSKNCVDLDPTKLGTARSSRNWLVDKIENFEKT
                     DNEFPEIYKKENNVQMGSFARRTKIRPLDDIDFIVVFDGKGSKYVTNSYGEITINVPE
                     TATNLSRLTNDENSLNSIKLLNKLKSSLQNVPQYSAADIKRNFEAITLKLTSYDWNFD
                     IVPAFITAPDSSQRTYYLIPDGQGKWKKTDPRIDARRATEINQKRDGKVLRIIRLIKY
                     WQKRHSVPNIGSYLLENLLLNYFNNNEVSASDQVTLRDVFSYLRNSIYHSCNDPKEIQ
                     GNLNLLNLDVKDRFSEAAANASICAQNAINFMAKDDHKAAHAEWKKVFGSEFPDYE"
     misc_feature    22171..22683
                     /locus_tag="Bsph_p023"
                     /note="Nucleotidyltransferase (NT) domain of
                     2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I
                     CCA-adding enzyme; Region: NT_2-5OAS_ClassI-CCAase;
                     cd05400"
                     /db_xref="CDD:143390"
     misc_feature    order(22264..22266,22285..22290,22297..22299,22303..22311,
                     22324..22326,22330..22332,22531..22536,22543..22545,
                     22582..22584,22660..22662,22672..22674,22681..22683)
                     /locus_tag="Bsph_p023"
                     /note="active site"
                     /db_xref="CDD:143390"
     misc_feature    order(22285..22290,22324..22326,22330..22332,22534..22536,
                     22660..22662,22672..22674,22681..22683)
                     /locus_tag="Bsph_p023"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143390"
     misc_feature    order(22324..22326,22330..22332,22582..22584)
                     /locus_tag="Bsph_p023"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143390"
     gene            23096..23977
                     /locus_tag="Bsph_p024"
                     /db_xref="GeneID:6020561"
     CDS             23096..23977
                     /locus_tag="Bsph_p024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695613.1"
                     /db_xref="GI:169825438"
                     /db_xref="GeneID:6020561"
                     /translation="MNEITINKNQNKPESLRLLAAMRLLYGRAKILRTLRVCITVLLP
                     IISILSLNYFPSFKEGLAFLAGVWLVLNRIFFLEIEKRMVKDAAKIQEEFDVNIYQIS
                     WNSLLVGEKIPVEGIKRLNQKSKEKEENLKDWYPGLKSPDHFLNVLLAQRTNIAWDID
                     LRKFYKNILYGVTTLYIIILIAICFQINLPTQTLIISFLVPSFPLILHLFETANGHKQ
                     RHESLEKVLPKVTGDIDNYSTNEQGMIANTIRGYQDIVFLKRCDVNMIPNKIYWLKRN
                     LYDKIAKETNEEKSDNQ"
     gene            24239..24829
                     /locus_tag="Bsph_p025"
                     /db_xref="GeneID:6020469"
     CDS             24239..24829
                     /locus_tag="Bsph_p025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695614.1"
                     /db_xref="GI:169825439"
                     /db_xref="GeneID:6020469"
                     /translation="MLIEIGSHQQLKTSEKRNNNMTSTITTTTVCVGCNKLDGYISII
                     YVDKETKEYKAECAHCKNVFTTTFEPTTQQNFGNKIDEELEQEQIKALLEGSKYLFLP
                     DADDKDVILAFRVMLENGEEPTNKEAFNSMYHCVISNSVHEFETNDLHELLDRPDDLY
                     YDYGVGSDCETIEWLDINIDVRYLYLINNTFYYYVG"
     gene            25036..25242
                     /locus_tag="Bsph_p026"
                     /db_xref="GeneID:6020540"
     CDS             25036..25242
                     /locus_tag="Bsph_p026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695615.1"
                     /db_xref="GI:169825440"
                     /db_xref="GeneID:6020540"
                     /translation="MEKASFDTFLNTEERAKAYIENMSTEDKELANNFFLELLENDEI
                     EHRNFNEWLFDYLHDCIYESGAEG"
     gene            25616..26668
                     /locus_tag="Bsph_p027"
                     /db_xref="GeneID:6020393"
     CDS             25616..26668
                     /locus_tag="Bsph_p027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695616.1"
                     /db_xref="GI:169825441"
                     /db_xref="GeneID:6020393"
                     /translation="MQLNFDCEMGLESTPPDFRTSINLLPLSDYDHIIISESGGKDSM
                     ACLFYLMELGVPINKLELWHQSVDGGGANHIEFMDWPVTESYINEVGKLFGIKTCYQW
                     REGGFFNELMRKDSLTGDVYYTTEDGEIIHLPTKSGKLNTRLKWPALSPDLRIRWCSP
                     YVKIDVFRRVLNNHPLYKDKKILVVTGERREESANRAKYAEAEIHACNSKKRLVHAWR
                     PIIDWSEQQVWDMYEKRRFLPHPAYLLGWNRTSCFGCIFSTADLWAMMREIAPGRFNK
                     LVEVEKQLNHTVDTNRLTLVQKADMGSIERLPKDSRLSQWVSAALNKNFTKADLIMDK
                     WELPAGAFRGNVGGPV"
     misc_feature    25709..26356
                     /locus_tag="Bsph_p027"
                     /note="This domain is found in phosphoadenosine
                     phosphosulphate (PAPS) reductase enzymes or PAPS
                     sulphotransferase. PAPS reductase is part of the adenine
                     nucleotide alpha hydrolases superfamily also including N
                     type ATP PPases and ATP sulphurylases. A highly...;
                     Region: PAPS_reductase; cd01713"
                     /db_xref="CDD:238846"
     misc_feature    order(26102..26104,26201..26203,26246..26248,26258..26260)
                     /locus_tag="Bsph_p027"
                     /note="Active Sites [active]"
                     /db_xref="CDD:238846"
     gene            26683..27279
                     /locus_tag="Bsph_p028"
                     /db_xref="GeneID:6020392"
     CDS             26683..27279
                     /locus_tag="Bsph_p028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695617.1"
                     /db_xref="GI:169825442"
                     /db_xref="GeneID:6020392"
                     /translation="MFMILLQTPMNVFESYCGKAKVTGEVKVETEKGQVLYTSKHTFT
                     DLLTGRIILKGGYYYFVDDNELAFMEKEEQEFERQRQMKIEEEIERLEAERLIQEAKL
                     KAFKEAYSLPFEYTTKIKIVLSGLSINSNGCGSKKNTVFHVFVKNDFNDGRFKRTAES
                     FLCSPNDNGKWTTLDDYEHNDQLITCKKCLSIMERWKK"
     gene            27374..28801
                     /locus_tag="Bsph_p029"
                     /db_xref="GeneID:6020531"
     CDS             27374..28801
                     /locus_tag="Bsph_p029"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase PspPI"
                     /protein_id="YP_001695618.1"
                     /db_xref="GI:169825443"
                     /db_xref="GeneID:6020531"
                     /translation="MFKKTKRIKKSHRGITFSDSEMFPIHSKYKYFIDKKNKKVIICL
                     SDHDEALKERLQVSIDTLPSYEGTVSRKKRSGDNFIPLVDIRNSEAIQQFDDFEQLQV
                     SISDDLIMIEGITASGEQYIYAANKKQVFKHLDIVAEDKKAHIKVASFFAGSGIGDQG
                     LKEAGFDIVFALENDINAADTYRANHGDHITVQDIEDFDGSTLNGIEFAFGSPPCVDY
                     TPANQKTNKWHNPEPTLIDEYLRVLKEMPDLKVWVLENSKLFLTAGNGDVIRDICNEL
                     PDYDISYGILDAVDYNSPQRRERTFIIGSKIGKIELPTPITTPDNYKTVQEAFAGLSD
                     NLPNQKDVTTPKATTKARMGFVPQGGNWRDIPKNLLPKRFGKNTHSSIYRRLELDKPS
                     FAITNVRKSNILHPLYDRVLSIREASRLFDLPDNFIFKGPLSAMQQQVANGITVNVAK
                     AVGQKILYAFKKVMYDLTPKGFYLI"
     misc_feature    27800..28744
                     /locus_tag="Bsph_p029"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dcm; COG0270"
                     /db_xref="CDD:223348"
     misc_feature    27806..28744
                     /locus_tag="Bsph_p029"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    order(27824..27841,27887..27898,27950..27961,28007..28009,
                     28013..28015)
                     /locus_tag="Bsph_p029"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    order(28007..28009,28016..28021,28028..28039,28046..28048,
                     28067..28069,28136..28138,28142..28147,28262..28264,
                     28268..28270,28475..28477,28481..28483,28502..28507,
                     28511..28516,28697..28699)
                     /locus_tag="Bsph_p029"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    order(28007..28009,28016..28018,28028..28030,28136..28138,
                     28142..28144,28262..28264,28268..28270,28697..28699)
                     /locus_tag="Bsph_p029"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            28825..29382
                     /locus_tag="Bsph_p030"
                     /db_xref="GeneID:6020438"
     CDS             28825..29382
                     /locus_tag="Bsph_p030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695619.1"
                     /db_xref="GI:169825444"
                     /db_xref="GeneID:6020438"
                     /translation="MRDILIVTQDNVLEIAGSLLLNAKHTVNNSNSFGFHNKESQEIA
                     YKMLDDLYEKLKKLGYNPSGLFYHIQLQIDYTYGYAPITEWAELKNELMDHFEFNLLV
                     DGKYYAYGKSLMAKYNIKYKNENPIMKQTHFSDCDLKYICSNFEDESLKTLAFVTGKK
                     ERDILIEIERLKKWWLFDYYKNYCY"
     gene            29444..29674
                     /locus_tag="Bsph_p031"
                     /db_xref="GeneID:6020408"
     CDS             29444..29674
                     /locus_tag="Bsph_p031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695620.1"
                     /db_xref="GI:169825445"
                     /db_xref="GeneID:6020408"
                     /translation="MNVQKMWMLHDTLFLNENDALKVEEKEVREKVKAVYVGLDEGVD
                     YDLTQVRSDFFGSWIFKTEKEAQGEVDEFNRS"
     gene            29805..29948
                     /locus_tag="Bsph_p032"
                     /db_xref="GeneID:6020401"
     CDS             29805..29948
                     /locus_tag="Bsph_p032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695621.1"
                     /db_xref="GI:169825446"
                     /db_xref="GeneID:6020401"
                     /translation="MKVHIQDKHIVEDLIFEVHNQIASDTKIKKIYEQYLMTVDIRDV
                     SLK"
     gene            30398..30814
                     /locus_tag="Bsph_p033"
                     /db_xref="GeneID:6020483"
     CDS             30398..30814
                     /locus_tag="Bsph_p033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695622.1"
                     /db_xref="GI:169825447"
                     /db_xref="GeneID:6020483"
                     /translation="MAFKSILEKDTTINANNTRMELLSQSNKDISQLDPFLLEDFSLA
                     IEQKYHLDIMSNHDGKNDRYRLIDALIDIDALVNNMVLPLKLEVEMDGNTKILDFNIS
                     QIEYSKSAGMENPKYYIYCDNSDNIGFRFWFIQKKS"
     gene            31172..31699
                     /locus_tag="Bsph_p034"
                     /db_xref="GeneID:6020472"
     CDS             31172..31699
                     /locus_tag="Bsph_p034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695623.1"
                     /db_xref="GI:169825448"
                     /db_xref="GeneID:6020472"
                     /translation="MNNKWSKLAIRSGVLVMLVSAVGGGVYLAEQKSEITEKKQVEVK
                     DNPTDLYLQNVYGTYLKDVVPRWNELTDKRNMDYLKTKQLIGDWKDMLLSQEQTYVSL
                     NQLLMQQVNTLEDFFKLTQQDETSEQRKSLRKLSADFTEGHQKVKETVLSILEEYKAD
                     YEVFSDGSIEYVFPQ"
     gene            31755..32114
                     /locus_tag="Bsph_p035"
                     /db_xref="GeneID:6020441"
     CDS             31755..32114
                     /locus_tag="Bsph_p035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695624.1"
                     /db_xref="GI:169825449"
                     /db_xref="GeneID:6020441"
                     /translation="MIKPEFLHIRTTELFKDDIKAQNIFQKWSERFNEQKKEYNLNIF
                     NLAEVILWQPEDDNLSNLIFLLEQGRKTNQVVVLMGDEEQFEKLKNTNMKLYETILGN
                     TIDLEKEDVAVCIEITE"
     gene            complement(32301..33584)
                     /locus_tag="Bsph_p036"
                     /db_xref="GeneID:6020547"
     CDS             complement(32301..33584)
                     /locus_tag="Bsph_p036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695625.1"
                     /db_xref="GI:169825450"
                     /db_xref="GeneID:6020547"
                     /translation="MPSLKIKKPRYGREKANCFHPRNEVCSFKILYRMVKVIIKNKYI
                     YIIALFFKKSIDRNGLIYDIIIHILVITYYPIQAERIYRIFQRSNGMKAYAFFYWCAF
                     FVFSNNHEGANKMKKLLIGMIGLLPLLYVSDVTTETNMATSYLLFLKDYWPLLLVGLI
                     TLKYAKKAYDSRFNELENMRYRHYRSEVKRYYGTPYVPAIMTQYLTNPPGAISPNQWD
                     YINNRFYQMVVNDFRDNVYVFRDFNSFEPGKKNTVIDIVGWAKILRLSAIFVVSFGWF
                     AYWIINNSFFNNWPFFTLPLLVVAWIKIIIKLQAIMHYLPSKFDSTLEDNSNTRIYWR
                     DAFPDRPFGHTVLRAYFYEKEKRMRYVASLNNQPMGPSLDTWTHYAFPELPYPHIELP
                     EWEKDYDQFYEQKAQQLNLEDSSQKQNVILFKKVT"
     misc_feature    complement(32718..>32894)
                     /locus_tag="Bsph_p036"
                     /note="cathepsin C-like protein; Provisional; Region:
                     PTZ00049"
                     /db_xref="CDD:240244"
     gene            33587..34489
                     /locus_tag="Bsph_p037"
                     /db_xref="GeneID:6020402"
     CDS             33587..34489
                     /locus_tag="Bsph_p037"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_001695626.1"
                     /db_xref="GI:169825451"
                     /db_xref="GeneID:6020402"
                     /translation="MGQITLFDIQEKSEKANGNTFENWLLVDGDNILNRTFHATKYEY
                     KTAPDGRHTNGVSAFLKMVFGYQRKFSANIVVFFDQGKGFRKELYPEYKDGRKEKPEE
                     LIQQFPTLKEVLLAADIPSFESDYFEADDLIASSISKLQGHKYILSNDKDLLQLVSDD
                     VTVIRKGNKNVDSLITPETFTNEYPGMTPLQIVDIKALAGDSSDNIKGVPGIGEKGAF
                     NLVQFYGTVENMIVSTECPKELKRYFTKLMAAKEDAIFSKMLTTLRKDASITIQARPL
                     NEHGLREQCDILSLVIIKAYMNLY"
     misc_feature    33659..34399
                     /locus_tag="Bsph_p037"
                     /note="5'-3' exonuclease; Region: 53EXOc; smart00475"
                     /db_xref="CDD:214682"
     misc_feature    33659..34141
                     /locus_tag="Bsph_p037"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    order(33668..33670,33821..33823,33968..33970,33974..33979,
                     34034..34036,34040..34042)
                     /locus_tag="Bsph_p037"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    order(33668..33670,33974..33976,34034..34036)
                     /locus_tag="Bsph_p037"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    33836..33874
                     /locus_tag="Bsph_p037"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    order(33968..33970,33977..33979)
                     /locus_tag="Bsph_p037"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    order(34034..34036,34040..34042)
                     /locus_tag="Bsph_p037"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    34151..34375
                     /locus_tag="Bsph_p037"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    order(34181..34204,34208..34237,34241..34252)
                     /locus_tag="Bsph_p037"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    order(34187..34189,34196..34198)
                     /locus_tag="Bsph_p037"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     gene            34543..34866
                     /locus_tag="Bsph_p038"
                     /db_xref="GeneID:6020572"
     CDS             34543..34866
                     /locus_tag="Bsph_p038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695627.1"
                     /db_xref="GI:169825452"
                     /db_xref="GeneID:6020572"
                     /translation="MNIDKLWASFEENKGSYKGMEILKLIYFNNNGLRIKDIREEFDS
                     WSIKLLELLHEEMTCIPTFEMETELNINFGETAPIFNFFEASTECGIGDDVLKMVKPK
                     KKRFF"
     gene            34878..35363
                     /locus_tag="Bsph_p039"
                     /db_xref="GeneID:6020419"
     CDS             34878..35363
                     /locus_tag="Bsph_p039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695628.1"
                     /db_xref="GI:169825453"
                     /db_xref="GeneID:6020419"
                     /translation="MYLKEKQIGEGDRLEFNLLFSRLIAIKLIERELKIDCSEELIEV
                     NVSYYMQYDDFFNELHWFLKTAGIGDFDYFDDDVYGLTFSLLNNLSDDEQFFFQDWKE
                     NLIEEIKENEFIDFFEGEIEWISFDTLQFPLGYIFTPMHEVYSFFIDKQLELQSLCKK
                     Q"
     gene            35408..36607
                     /locus_tag="Bsph_p040"
                     /db_xref="GeneID:6020416"
     CDS             35408..36607
                     /locus_tag="Bsph_p040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695629.1"
                     /db_xref="GI:169825454"
                     /db_xref="GeneID:6020416"
                     /translation="MNKIIATFQNREPITVERVQDGLTIGRYNLTPAAFIESMAKELP
                     FENLFALVVEQVIEDNAFNDYFDEIYIHRKEKKYTDFLNAMLNNAPSNWLDEPRLHDF
                     VINALSQFKVTKEDETVILNLFRSVKRIITQENQSVFVELALQVFSNLINSKEKEDSL
                     KKFLSLLYSNLNVNKKEELDDWFVMNIDSIPSDIKAEVIVKVLEDKNFLRDVYRLLNS
                     DKKAFNTWLNEMVDNMPLTWRVDGFKRTVKPEDVYLKTIQIPKNCVNIDVSVSKLVYS
                     IEIPKKRMRVKFGDIAYEDVGHPKLLAKIEVVDEKFQSMSLFAIKDGEDILYKYPYSN
                     VYDSGKVCWHVMDRNTIISLKEIEMLPMMFLSTPNNSHLNSKTLNLYLKYQGKDFDDS
                     ELEPFTY"
     misc_feature    <36245..36574
                     /locus_tag="Bsph_p040"
                     /note="Prokaryotic E2 family D; Region: Prok-E2_D;
                     cl14019"
                     /db_xref="CDD:246605"
     gene            36856..41313
                     /locus_tag="Bsph_p041"
                     /db_xref="GeneID:6020422"
     CDS             36856..41313
                     /locus_tag="Bsph_p041"
                     /EC_number="3.2.1.1"
                     /note="Includes: Alpha-amylase (EC 3.2.1.1)
                     (1,4-alpha-D-glucan glucanohydrolase); Pullulanase (EC
                     3.2.1.41) (1,4-alpha-D-glucan glucanohydrolase)
                     (Alpha-dextrin endo-1,6-alpha-glucosidase)"
                     /codon_start=1
                     /transl_table=11
                     /product="amylopullulanase precursor
                     (Alpha-amylase/pullulanase) (pullulanase type II)"
                     /protein_id="YP_001695630.1"
                     /db_xref="GI:169825455"
                     /db_xref="GeneID:6020422"
                     /translation="MKTRKQEKLFWGSVAAGALIAGMTTGVGIQDAKALETTEQSIIY
                     YEDIYNINLSRDFDSDYKFESSVSSITNIRYDKDKKIFYFTVNGGNSDFGYITPSDRI
                     NNTYGQFGFSLYFDTVTLIGRNQHYESYHNKVRQKVDFYSKSGEVFFNGNEIGIRMNY
                     EPTSLKIRGNLDADWGSIYLNSMNLLDQPLRLKNEKPSIQLEPTLSVVIDELKDKAVT
                     LSIDFPNDAVTKEYRIDGGIWTQYTAPVQLIKNGTIEARATDLAGNESISQLLSVDIQ
                     AIKLKWLLDNYTAASVDDFKWAGIPGVTSENIEQLKGIVTDYISTFNGGEITVPTVSV
                     YETWLTYIDILTKVQTSIENAKNFVNPRELTLAIKDIKDTINSLPDWVGAKTSFNDEI
                     SLLDRYSIALDAVIDSETSLQQEDKDAAQSLVDVIGNAQIQEQLSDRLNVVQNFIEAT
                     TSVEYAESTRLEEDILEAQAKVKELPENTVKTELQNRLDTLLHLIGVEIAVNTSESTL
                     LQEDKDKAQTLVDTLQDGHYKDTLQSRLDLVQDIINASNAVKQAEITSSDENIATAQD
                     AIDLLPDGEKKLELQDRLDKVKGFIDLISEIDKTLKEAEDTLITEQLGNVQDMITSLP
                     TSTIKDSLQDRLNNLLEYRESEKVVSKAEELKVQSYKDRAQESVDLLKPWKGKDHLQE
                     RLDKLQDVIDQKEGNLIDKILNDPDNVTSQELADFTDNDVVDEKLRDYIENIIEEAEN
                     GSITKDDVVQIVRLITFLEQSKRSMAEEHISKYEAELLSTTVSVKSKFPNASVLRSIP
                     GYLNDALDLPTFAQELADLLKRPFEEVLAELDGLLGSDKVATLAYTVKYVTEDGKVVS
                     EQSKEAPAGNVTVQAQTPEGYELVSEGKQTFELTEDTKGTAILFKVKPTIEVTKGSYT
                     IEYVTLENEVVHTETIQVDFGTIEVVAKVPEGYELLKTEESSQKIVLSKDVPFETLRF
                     VVVKDEASTEMPSTGEEVKESSEIEGPAKEVPSTEELPVEGKNKELGNVETQPTTVDI
                     STETVTSQTIGAETALVRSLLVASLDNTYFTATSQNLGVSHNQYLYDVSQSVLLVKAF
                     VGNPTEENRLDAKNFILGNLYAGEFKTVLLKIIALAGEEIPADGEDITIIHPSKPSVK
                     PDPPVVTPPTPPVVSPPVVIPPISGGETTAEIEKIHPVEKIDDGYKWGVTNPQKPSYV
                     FQTDDIRIELNLDSIQDVKDLEVYWLNKNKGYYDLVIKANGKIIDRLKKSVNLKFKYQ
                     HAYLLQVKEGINKAIPHVYNDSAFSFKANGSSSFYFSQTLITFRDIYNNQNKKVIEEL
                     ASRNVVNGTAPGYYNPNGSLTRAEFSAMLVRGLGLETTEVYDGVFKDVKEKDWFAKDV
                     HTLYATGIIKGVTPTKFNPNSPLTRQQAAVMLNRVLEYLEVEKRESEKLDFIDAAKIS
                     EDAKQAVATMKALGIFSGKPGNKFDPQANLTRAEMAKVLEMTLKIADLF"
     misc_feature    <37504..37653
                     /locus_tag="Bsph_p041"
                     /note="Chitobiase/beta-hexosaminidase C-terminal domain;
                     Region: CHB_HEX_C; pfam03174"
                     /db_xref="CDD:217405"
     misc_feature    40765..40890
                     /locus_tag="Bsph_p041"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    40948..41076
                     /locus_tag="Bsph_p041"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    41140..41271
                     /locus_tag="Bsph_p041"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     gene            41699..42772
                     /locus_tag="Bsph_p042"
                     /db_xref="GeneID:6020420"
     CDS             41699..42772
                     /locus_tag="Bsph_p042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695631.1"
                     /db_xref="GI:169825456"
                     /db_xref="GeneID:6020420"
                     /translation="MVNITNVSIFDVGVKDTEPKKETEKEVKSVSKVGKGAKPKEEKV
                     EIKINNEWTVHFATESFNATDFVEEIPEEGITLEELRKGIERVFPKFSAARTKFDLDK
                     ENKRIFPDAFAGSKGAGAFTPSFFLSREAAIKSNSHIKYLLGKENSVFRVITSAIGTF
                     ITRVNDETITDNVLSNMPYYKESNLEQIEESFTFNLPKIPFYYLQKICSFFMSFINKG
                     DNYEVACKIFWDTEKREYIIDVPKQTVTKVTIQFEYSGAFTGRNSLRYIPVLELHSHN
                     VMRAFFSKTDDLDEQEYGLYGVVGRLNRKEIQFAFRVKCDDSYLHVLMNHIFEIENAH
                     MNLPIDFPDEWLEKVTTKKGFYL"
     misc_feature    <42503..42634
                     /locus_tag="Bsph_p042"
                     /note="PRTRC system protein A; Region: PRTRC_A; TIGR03735"
                     /db_xref="CDD:163447"
     gene            42730..43629
                     /locus_tag="Bsph_p043"
                     /db_xref="GeneID:6020414"
     CDS             42730..43629
                     /locus_tag="Bsph_p043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695632.1"
                     /db_xref="GI:169825457"
                     /db_xref="GeneID:6020414"
                     /translation="MVRKGDYKEGILLMKIVDTPNFDVVIIGAGANGSHFFRNLLQDI
                     SCYGSRLKNCKFTIVDGDQVEKKNLNNQLFDSDDVGAYKVQALVDRYGEHYQVDCAAV
                     ATYVTTLEDLEKLFRGPKGLQRILVGCVDNNRTRQLMHEYFESSSDLIYVDVGVEGVI
                     LKDELPKEMDDKESIIMSSGFSGQIVIGFRKDNTTVLPSVADVYPTILTDFESAFPTQ
                     ACAEVKDNPQRVETNKMAAQFANIILNNLFHTGELLQEEITFNARLGTSVVSYIDVRK
                     EREYIKLIREENNNEQQQLCIVS"
     misc_feature    42799..43203
                     /locus_tag="Bsph_p043"
                     /note="Superfamily of activating enzymes (E1) of the
                     ubiquitin-like proteins. This family includes classical
                     ubiquitin-activating enzymes E1, ubiquitin-like (ubl)
                     activating enzymes and other mechanistic homologes, like
                     MoeB, Thif1 and others. The common...; Region:
                     E1_enzyme_family; cl17196"
                     /db_xref="CDD:247750"
     misc_feature    order(42811..42813,42817..42819,42823..42825,42907..42909,
                     42913..42915,42940..42942,42976..42978,43114..43116,
                     43132..43134)
                     /locus_tag="Bsph_p043"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238760"
     misc_feature    order(42823..42825,43135..43137,43192..43197)
                     /locus_tag="Bsph_p043"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238760"
     gene            43598..45508
                     /locus_tag="Bsph_p044"
                     /db_xref="GeneID:6020564"
     CDS             43598..45508
                     /locus_tag="Bsph_p044"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="YP_001695633.1"
                     /db_xref="GI:169825458"
                     /db_xref="GeneID:6020564"
                     /translation="MNNSNFVLYRKYRPQGFDNLIGQNHVKNTLENSIKHNKVAHAYL
                     FTGPRGTGKTSAAKIFAKLLNCQSPIDYNPCGECVCCQDSNTDIIEMDAASNNGVDDI
                     RDLREKVNYAPAFGKKKVYIIDEVHMLSTAAFNALLKTLEEPPAHIVFILATTEPHKI
                     PATILSRCQRYDFRRISQDDIVHRMKTIVEAESVEIEEQALRLISQIAAGGMRDALSL
                     LDQAISKVEGKVTLQDIIEITGAVDTRKIGTLIQYINQSNIEGALEHFNTCFESGQEP
                     HFFLEEMMIYLRDILVNRKLGEKATLKKGHNDPQFYEIANSVGPDKIYDYMDLLNKAH
                     SNMKFHNDVQLLMEMTIIEMINNQNQSPSILQQQIDELKQFIMGGNYSLQQVAVTQNA
                     TEKTNEESLANIDIKDIQGMMLNDPIGFIEASEEATKKGDDWTNLVTEETVVIPSEKL
                     TPPSKPLPPHEEHLEPPHVDDDEHLEPPSIEVENLATHNNELNPKETVSNESEKTDSQ
                     PTSFGDFTVENIYLSEREEIILEALASCNESHRKAFESKIEEFSAALKKKSVSTNSLF
                     RDFTIRAVSDTHVLLVHDEPAKVKLLEKDKNKSNVHTVIMEVYQQSFSILVCSAKEWS
                     RIKVAFKYNTKG"
     misc_feature    43616..44662
                     /locus_tag="Bsph_p044"
                     /note="DNA polymerase III, subunit gamma and tau; Region:
                     dnaX_nterm; TIGR02397"
                     /db_xref="CDD:233847"
     misc_feature    43658..44107
                     /locus_tag="Bsph_p044"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    43736..43759
                     /locus_tag="Bsph_p044"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(43739..43762,43967..43969,44060..44062)
                     /locus_tag="Bsph_p044"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    43955..43972
                     /locus_tag="Bsph_p044"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    44096..44098
                     /locus_tag="Bsph_p044"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    44285..44662
                     /locus_tag="Bsph_p044"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:152604"
     gene            45539..46411
                     /locus_tag="Bsph_p045"
                     /db_xref="GeneID:6020553"
     CDS             45539..46411
                     /locus_tag="Bsph_p045"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="YP_001695634.1"
                     /db_xref="GI:169825459"
                     /db_xref="GeneID:6020553"
                     /translation="MKSIFQKLIWTGKLAHAYLLVGSSLEFALWITQCVYCKDQNACG
                     QCANCRRIKHGNHPDVHIIVPDGTKIKVDQIRELQREAALKAVEGQKQVFIIDNANKM
                     NENAANALLKSLEEPLQDTLYLLVSETKNNILPTIISRVQTLKMKEENRLVDEAEKNN
                     LHLKYLNIYEDCNLSINQLEKYKDSIDEWIDVIGSTFSQNTSNALLSVQTSWDNIFND
                     KESKHLATVLMQSYVRSALLIKRGKPSIWKIDVPYSWDQLVQLEKRVNNIQKAIYSNG
                     HFLLAMEDFFIHKI"
     misc_feature    45542..45988
                     /locus_tag="Bsph_p045"
                     /note="DNA polymerase III, delta subunit; Region:
                     DNA_pol3_delta2; pfam13177"
                     /db_xref="CDD:221959"
     misc_feature    45635..>45709
                     /locus_tag="Bsph_p045"
                     /note="CXXC zinc finger domain; Region: zf-CXXC;
                     pfam02008"
                     /db_xref="CDD:202085"
     misc_feature    45749..>46123
                     /locus_tag="Bsph_p045"
                     /note="DNA polymerase III subunit delta'; Validated;
                     Region: PRK08485"
                     /db_xref="CDD:236274"
     gene            46579..47760
                     /locus_tag="Bsph_p046"
                     /db_xref="GeneID:6020562"
     CDS             46579..47760
                     /locus_tag="Bsph_p046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695635.1"
                     /db_xref="GI:169825460"
                     /db_xref="GeneID:6020562"
                     /translation="MFSKIDTNFLGRGTAMFRINSKDLKIVVERVMKSARRAKLKNTV
                     IDVIASGTTIILKFGGSELFVSQKIEANITKELNFSTTVMELNLKVSALPNNELITVE
                     EKDNKIYFKWGRSSLVRVERVDNQCIEMSFEGQGESYEWSYNSIQRITRNMTSFTAIN
                     GTAEAKKIPQLAGIYIQYKKEYTELHASDSKKAISMVETDIKWFDEPAAIPTETWFAM
                     YELLSEDSIINISSNGKSLVKFESESTVIISRIIIGTYPDLSSIYVQPEQTATRWTID
                     RLELLEATRRARHLITTTGSNIELNSDGKKTYLVLKDQLVQQIGAMIVGDIKRFIINP
                     EDLELILSILKTEDIVLCYRSLSSSMTIYGIADEESDEESEDKKGEMNIKCMLSTMVG
                     K"
     misc_feature    <46846..47664
                     /locus_tag="Bsph_p046"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cl17512"
                     /db_xref="CDD:248066"
     misc_feature    order(46849..46851,47215..47217)
                     /locus_tag="Bsph_p046"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(46918..46920,46924..46926,47443..47445,47527..47529)
                     /locus_tag="Bsph_p046"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(47140..47142,47146..47151,47362..47364,47473..47475,
                     47512..47517,47584..47586)
                     /locus_tag="Bsph_p046"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(47140..47142,47146..47154,47158..47160,47575..47577)
                     /locus_tag="Bsph_p046"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     gene            47801..48442
                     /locus_tag="Bsph_p047"
                     /db_xref="GeneID:6020518"
     CDS             47801..48442
                     /locus_tag="Bsph_p047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695636.1"
                     /db_xref="GI:169825461"
                     /db_xref="GeneID:6020518"
                     /translation="MEFIILLIILGSISILGVLPVVFAIRKEKKPSPWVIPTHYISPE
                     QFNMQPPVSQLENVPKISESIVVETQEPVAISVDDFTASDLGEEIENNLEELLTEIKS
                     ENEELKDIRKKIEFFYSEKVAVLVTAVPGAIGKGEQIVYGILTSESKIEFEGNFVEIC
                     GEIPSNKDIGEDVIIKGNLLENGKFYSLHWEYPDMIVHGYSDDFNLSNESLGA"
     gene            48775..49272
                     /locus_tag="Bsph_p048"
                     /db_xref="GeneID:6020539"
     CDS             48775..49272
                     /locus_tag="Bsph_p048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695637.1"
                     /db_xref="GI:169825462"
                     /db_xref="GeneID:6020539"
                     /translation="MKTSTITQSNVVNNEYIAEEIKNLLLCTPKNISNINLKVNNEWR
                     GIERKLQELEMTIRSLPKGQIKLFSRNNQIQKFVLPTYSYSVSSVGEDYFDDNIIELP
                     EKMYRRFVMLISDQISDIPISLEHRTFYISWEFTETEENDWEFNAEVTVENEIHLPRM
                     VSKYG"
     gene            49359..49724
                     /locus_tag="Bsph_p049"
                     /db_xref="GeneID:6020529"
     CDS             49359..49724
                     /locus_tag="Bsph_p049"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695638.1"
                     /db_xref="GI:169825463"
                     /db_xref="GeneID:6020529"
                     /translation="MTLFHGAFFCSLKGGELMSNLMTPFNLFVLNNINKNIYNGNSAT
                     SDKDPLGKLLFDFIKTFGGWGTAIFTLAVMVLAICLMITSPSPRMRTVMWTGLLVCAC
                     AAAIFFSAYFIGPGFKNYF"
     gene            49784..50095
                     /locus_tag="Bsph_p050"
                     /db_xref="GeneID:6020535"
     CDS             49784..50095
                     /locus_tag="Bsph_p050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695639.1"
                     /db_xref="GI:169825464"
                     /db_xref="GeneID:6020535"
                     /translation="MIIVPVDLTGEQKTVMAYFSVRQVLIVLPALAVTFGMLLKLNIP
                     FLSFGWILLIRVLLFLIINAITFSLAFIKLPSRDQYLSHTVLFKIQFWLSQKKYTNIQ
                     L"
     gene            50225..51148
                     /locus_tag="Bsph_p051"
                     /db_xref="GeneID:6020559"
     CDS             50225..51148
                     /locus_tag="Bsph_p051"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695640.1"
                     /db_xref="GI:169825465"
                     /db_xref="GeneID:6020559"
                     /translation="MELVDIVARGSFIMLFATLGLAFIGKRRIDRNEPAFGWKRKQFL
                     AEQKSGSLDADKHKEHTAIESKSNPFKLWKERKLLSIRDLLEVKNIEYGIVERDKNEF
                     CAVLGTDYVNFDLLQRSEQQAILEGYQQLFKSVNFEVQLFVLSERQDFRKEKRRFNEN
                     LLNCNSQTIKYNEGVIKSIEETTVEDFRITNKIYYVISYIYEPSKMAKLTREQKEKAI
                     RNEIFLRLEIVRKALSRAKVTAHFNNTIETLNVFKQSLNRDRSLLHEIEEVATKEKTA
                     LYVTLDAATLPDVEGLIRDNLNDEEVNPVGA"
     misc_feature    50231..>50356
                     /locus_tag="Bsph_p051"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2311"
                     /db_xref="CDD:225193"
     gene            51252..53147
                     /locus_tag="Bsph_p052"
                     /db_xref="GeneID:6020410"
     CDS             51252..53147
                     /locus_tag="Bsph_p052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695641.1"
                     /db_xref="GI:169825466"
                     /db_xref="GeneID:6020410"
                     /translation="MINEGIEFHSDYFIIQIGIGTKKYGRSFYIKPSGYPRKVRIGWL
                     VGLFKAEDINVSVHSKPFDRTDAVRQLKNKLDDYETVVISAQKQDNAGKIEAIGQQVR
                     DAKTLREQIQNNMNSLHFTSISATIYADTLEELNEKSVAVERALAAESIEVVNAYDRQ
                     KEGFLSTQPLGANYLKNSERNLDENALAAMFPHNSSTLNHTGGMPIGVYNNEYIYFNN
                     FDSKLESFSMGIFGISGAGKGVFVKTVIGRGYLDGITKNIILDVEPEYTELTYALGGI
                     VIELRSDDVVSNFSRINPLDVYVEKEVKRRYTPFEYIVEKVNINEKVKEAIEFFKVMK
                     ESTYPKDPNLDPHELDALDKILKKLYAKCGITEDPESLYYHEEGMDEQGNIIFNRVYK
                     KMPTISDVHRDIQALVENGNEMLKNLLSVVSLFLAGRSFGMFDCQTDIRDKDGNPLPP
                     TALDESPIVTFDISKLSKNGIERPLAQHVLMTWVWNRLIVNNPKEKKRVIQDEAWMML
                     KFPSMIEFFKTLSARGRKWNVSLTLVSQRYEMFHRNEEARDIIAQLGTVAFMKQSSSD
                     VEKILEAFHFSDDVGQVIRTAEQGDVVMKAGKEIVYFHVVPTESEWQYINTNMNVTVD
                     ELIAKGG"
     misc_feature    51888..>52142
                     /locus_tag="Bsph_p052"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     pfam01935"
                     /db_xref="CDD:216796"
     misc_feature    51924..52985
                     /locus_tag="Bsph_p052"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:221803"
     gene            53170..55998
                     /locus_tag="Bsph_p053"
                     /db_xref="GeneID:6020445"
     CDS             53170..55998
                     /locus_tag="Bsph_p053"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein, putative"
                     /protein_id="YP_001695642.1"
                     /db_xref="GI:169825467"
                     /db_xref="GeneID:6020445"
                     /translation="MLLFFCFFISPFSANARVDEGAGGGVGNQNTSEADKTTTFNCPG
                     GALISKDVNNAVDKFKDEKANLPEKFIASQLQNFWNIGDINSLSTLIYGNPYCVWADS
                     ILRKESSIVMSSNGIFTQAEKEHVIDPILKMFQASYIYILVLAIMVSSVKTMLNSTRG
                     RAMSDLGDDAKMWVASAGFILFYPKITGILFELNAALVLSLKSLLESKGVNLDSFSLI
                     ASWKDLFIGDVSPLPLSYIMVIFAEWVLAAVLNGVYILRKILIGLLLVLGFVAAFSLL
                     FARTRPFFGAWLKELCSNVFLQSVHAIVLYTMILMSSVGVSVSTNFISPLFDSGPVLL
                     TATTDEYDMTKTGAGTFFKLIMMAAFIPVTGLITRMLKMGDSTSKLGTAMTMLGVGGF
                     MSTYNLTKQAGSVITGGSVFSSMSNSLSGGDSTNQSFNNTVGTNSPSDSNTTSITMNA
                     LGNNSTPWKATKDAISKGVGISTAIGGGMILGPPGAQAGFKLGSKSAELLMQTPRSIG
                     FGVKGISDTLKNAKQYSGPNGVGMKGVMGNLAARRQFFGNMGESVGVMVGQGAFGRQL
                     GQIASGVSRQAIASLPMEQGGMMFKNSNGLPALGTFQNLAHHYPNEKIQFIQNNQGSG
                     FYLNDNGTLRQIGLTGAADPSLENGVSRVIDYKFRAPNSDIQLDNKGSYSPGSQIALN
                     NSALPSYNDALSRMSSTTTASNVGGLPSSMINPIGQPMKAVNGYPLPLRAQNRWEGHV
                     EHIASPATNIGNPMARSSLSTGTTTPFAAMSNVTAPIAASTQSSYGQVASTALNSYQS
                     NLAQYSSHSSSIPSLDLSTSSISGVGNRVVGLPGSTDSVSRTSGAYFVGGLSPTGQIT
                     TDSVNMINNPLTPKFDNPSFRADHVNPDSFVYHISPNADLRNNVDIGADKVNQITQRV
                     KKAPSDVQSGWAQLLKNDYSEERKSNIS"
     gene            55961..57901
                     /locus_tag="Bsph_p054"
                     /db_xref="GeneID:6020454"
     CDS             55961..57901
                     /locus_tag="Bsph_p054"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695643.1"
                     /db_xref="GI:169825468"
                     /db_xref="GeneID:6020454"
                     /translation="MITRKNAKVIFLKKGGNSLKKVIMFCCLFLLVFPSFAYAEEGKE
                     NSCKSKELLSDERRLQIKEFQDKDATIQESYTIDIFEGFWNIVGINSVSSLVFGNPYC
                     LWSGDNSPLVYGIFPEHYKEQIIDPMFNFFTSLFVGLLVLAMMIFAAKRMINPFNKNL
                     FVDEFLQYFMAAVLITLFWSAVDYVFLFNETIVATFRNLLLSQGIDLDGVAIFASQDD
                     FNFTDIVIIFAEWILMVFLNAIYLLRLFLLTVLMGMGGLAIVSLLYPESRHIFSLWLQ
                     DIIGSIFMQSIHALYCTFILLVFSTVSGEFSVFFKLFCLILFLPLTTFLQGIFKLSSG
                     GTLTGIGLNGVNSIAATVSFGKSMKSLNHRTPNMGKLSETKISALAKGNNSKPWQKTT
                     NLLAKTGMYAGGAAGLVLGPGGVILGGMAGSKMLTSTLQTPRNIAGGLKGLKDTFGAA
                     NSKGMSNVMGNIQEKRNFYGNVGESLGTMVGQGKMGRQIGSFASGVSNKRILNSSELG
                     GLSGLSIRDLASRYPESEFIFKQTNEGSGFYKVSDGEDLLISPIGAADTSLADGETRC
                     IDYKSRGSGIEYDSSKGTYNPSERTSSLDRTSDAYIQNSYGTRFADPSFNAQRMNPDD
                     YFKENLNNSVPKPDEHRHPGFV"
     misc_feature    56447..56866
                     /locus_tag="Bsph_p054"
                     /note="TrbL/VirB6 plasmid conjugal transfer protein;
                     Region: TrbL; pfam04610"
                     /db_xref="CDD:218173"
     gene            57914..60097
                     /locus_tag="Bsph_p055"
                     /db_xref="GeneID:6020538"
     CDS             57914..60097
                     /locus_tag="Bsph_p055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695644.1"
                     /db_xref="GI:169825469"
                     /db_xref="GeneID:6020538"
                     /translation="MDNNQDNNSSQSINSGIGKKAGKGAKHLIKNSKKYAKIAKFLIS
                     KAAAVSLKSVLGFIAPILIIIVIVIILILIVIDSVTKSDFFQLGAERTQNEVVFEESV
                     NSVIRVELQKGTNDAYSEMTTGQNPVYQPALSAEWSSALRESLTVSPGFPLSMVQYRN
                     MKARGVSHWYKNFYKLYSSATEHDFDDVEDKNTPEDEKRKVYSKYVKKEWQPVLDETA
                     PEYTYVNSSDYGGEWSHVKGETACVDEEGNETVTEFENSTKIAQRKLPKTAHYWYNLS
                     EIEYTLLDTGWLEPVTTSSGNCKTVSQNRYEVVVIDSSVLPEHTILTQDMIIFLVEKL
                     KEIGKGKKSFFWYPVNYADIEFFIEDLVRTIDPDFPKLDINYKKLKSCMKKNKRDITP
                     CVLEHVGNHINTDFKNFNASQFMGDYMSLYKEAAEACGIDWFVLAAVHGVETNYSKDP
                     VATDPSKGSVVNGELIGAVGHFQFMPLTWVGWGISKDYPTTPKGNLLVDDLSIITSLP
                     NISKYKGYGLDANKDGKADPWDVVDAAYSAACYLGANGYKSGDEASIRKAIQRYNHSN
                     SYVNKVYNLAMNINGGFSEIPVAEGTFTYPAIGRISSPYGYRGKAFHYGVDIASGGKH
                     VPIVAAADGVVSRSEYHYSYGNVVFIKHNLNGKTYETVYAHMRDLPPVKVGENVTKGQ
                     TIGTMGTTGDSTGIHLHFEVHSPYYVKQATHPLNPLTIIPKPPTQ"
     misc_feature    59210..59629
                     /locus_tag="Bsph_p055"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(59240..59242,59336..59338,59534..59536,59597..59599)
                     /locus_tag="Bsph_p055"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    59240..59242
                     /locus_tag="Bsph_p055"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     misc_feature    <59708..60094
                     /locus_tag="Bsph_p055"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    59747..60022
                     /locus_tag="Bsph_p055"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:216566"
     gene            60110..60748
                     /locus_tag="Bsph_p056"
                     /db_xref="GeneID:6020550"
     CDS             60110..60748
                     /locus_tag="Bsph_p056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695645.1"
                     /db_xref="GI:169825470"
                     /db_xref="GeneID:6020550"
                     /translation="MFKEVLQEIKKVFLSKKVVKIFGYSAGLIMVFCLYLWITSPKAN
                     VENIEPLWTNSSSDISAFKDGDIKKLALTDEESYSSVEAAISLFFSYAQHGEVDLFAS
                     SLNHEQFQNDFFQYDVTERHGKIEEALNRISRKGQLESISVVKNGWALEPDTVRLVVD
                     LFYKDLKEPVRIGVLIAGEKEYEAETEETTKVYYVVSSVWEVIRNIEGKVEK"
     gene            60745..61224
                     /locus_tag="Bsph_p057"
                     /db_xref="GeneID:6020474"
     CDS             60745..61224
                     /locus_tag="Bsph_p057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695646.1"
                     /db_xref="GI:169825471"
                     /db_xref="GeneID:6020474"
                     /translation="MNNEPVMLMVKYIQMVLTPVSAIFFIIGLFIFIIMYKNPMRRRT
                     AFLITVMSPIMFMFLLYGVVMICYYTLDGPIQDVNNEGLWFFEGFISSKLSGGYHVFK
                     IIMRPLLILAVLIGMGILHHGSGIPGRKRMGTGILFGFGLIWLLLEIGPSIYTVLSS"
     gene            61416..61700
                     /locus_tag="Bsph_p058"
                     /db_xref="GeneID:6020528"
     CDS             61416..61700
                     /locus_tag="Bsph_p058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695647.1"
                     /db_xref="GI:169825472"
                     /db_xref="GeneID:6020528"
                     /translation="MQYLGGGEVEENLKKMKEKAYFYKGFGFHYLSAITNEDETVKGG
                     SLFLIGKQMITLAVSNGYWTDHNGNPYKFKYRGRALYVGKIAVGFGNSDI"
     gene            61822..62373
                     /locus_tag="Bsph_p059"
                     /db_xref="GeneID:6020499"
     CDS             61822..62373
                     /locus_tag="Bsph_p059"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695648.1"
                     /db_xref="GI:169825473"
                     /db_xref="GeneID:6020499"
                     /translation="MDTKPIINSPIIKHIGELCNTPITIIATESGAGAPVLLQNLIEQ
                     NKWKIKFKKVDLEWFDLSELEDENTVDIDFTIYVFNDILPSATLNEPLNLFLPEPEKD
                     AYIQHCLHEYFNQNYEIFRSIESEIENNKVIILTTKNLAPIFNKAAKDNTLIVCEHPI
                     LTISVEQKIEDKTITLYEKYPIR"
     gene            62440..62826
                     /locus_tag="Bsph_p060"
                     /db_xref="GeneID:6020494"
     CDS             62440..62826
                     /locus_tag="Bsph_p060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695649.1"
                     /db_xref="GI:169825474"
                     /db_xref="GeneID:6020494"
                     /translation="MEDRKIMLNQQDIELIEYMDYQVMNNGMDGWLGNRAYEKVFEFI
                     EILKKRNSVLDQQVASIFSKVTVSGLGYYQHKDSVFIPEIKEMCDEYEKEIEECSKQY
                     QQIGKDFMNSYGLEDYLTKFTKNISS"
     gene            62993..63538
                     /locus_tag="Bsph_p061"
                     /db_xref="GeneID:6020490"
     CDS             62993..63538
                     /locus_tag="Bsph_p061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695650.1"
                     /db_xref="GI:169825475"
                     /db_xref="GeneID:6020490"
                     /translation="MNKKYEEIKFFAGNTIEQAVKELLSYKEEGKLVCGEFNGVVLYS
                     DIVTMESAYQKITGKTKAEFDKSQQEWKEKYDEKKKKHEDEIPNLTKVWMEKGREILS
                     EDRWEHWDKIVPVRLNDLNEDMELGASLDIVRILNSNGTLDEAKEKIESQGHSGMSFG
                     LVCAMVKEFSDRGNEFVEYVK"
     gene            64298..64540
                     /locus_tag="Bsph_p062"
                     /db_xref="GeneID:6020458"
     CDS             64298..64540
                     /locus_tag="Bsph_p062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695651.1"
                     /db_xref="GI:169825476"
                     /db_xref="GeneID:6020458"
                     /translation="MYKKITLANIERNNRCQLTDEQFKDVRKEIEYAIDGLNKGIEEG
                     RDYFLDSYMRGYDCELIGMKRICSSIGISIFVNKEE"
     gene            64591..64959
                     /locus_tag="Bsph_p063"
                     /db_xref="GeneID:6020455"
     CDS             64591..64959
                     /locus_tag="Bsph_p063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695652.1"
                     /db_xref="GI:169825477"
                     /db_xref="GeneID:6020455"
                     /translation="MKSIIPDMLKQYKAGIINDEELGNMLKLLIQKAIIDSSDKNNIE
                     SDLSKYIGTISMPNKAVLSDAIHSLMEMQPNASKVAREANVPRNTVIRIWSGEASVEN
                     IRLGTAEALFGYYLKLKGWC"
     gene            64962..65513
                     /locus_tag="Bsph_p064"
                     /db_xref="GeneID:6020425"
     CDS             64962..65513
                     /locus_tag="Bsph_p064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695653.1"
                     /db_xref="GI:169825478"
                     /db_xref="GeneID:6020425"
                     /translation="MSYDSIKEKIQAPFPPGTVQVKEQNKKAYIPAQVYWNRLDEVAG
                     PMVNWSIKSVDIAESHVIVIGTLHIAEVSRDGIGYNSFKDEHLIKAAISSAESEAFRN
                     ACDKYKMGWVDLAPYRAWSDNPGINIEKVTPTIQGDSYERKCLKCKKILDKQDNIFLE
                     IHSIRQNYCSEHVPQYLIKRNGG"
     gene            65503..65988
                     /locus_tag="Bsph_p065"
                     /db_xref="GeneID:6020478"
     CDS             65503..65988
                     /locus_tag="Bsph_p065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695654.1"
                     /db_xref="GI:169825479"
                     /db_xref="GeneID:6020478"
                     /translation="MEGDNRMKVKYLTCSLCNHFDAVNKKCSVLPFDTTSNEREYAGR
                     CAAENRFVRNINVIPDYFNYFNDDEVPVCFEEDLSNLPKDENGNPLFVITKRGLERAI
                     PADPEMKLTSSRFIGVEKIYTLQGQSELLQEIGYTQLQKLAFIKGTIISPLLEVQLKC
                     V"
     gene            complement(66144..66545)
                     /locus_tag="Bsph_p066"
                     /db_xref="GeneID:6020487"
     CDS             complement(66144..66545)
                     /locus_tag="Bsph_p066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695655.1"
                     /db_xref="GI:169825480"
                     /db_xref="GeneID:6020487"
                     /translation="MGGQITNNTPEVLMVYGPPNNNEYDNGTYIAKSGLISDKNIDVD
                     GFYVPADRKIKQFSGIVVDGPVAVKFINGIHFTVTQEGAIYIVDRPNFGLFKPSEYCR
                     PTNYPKCVNWDIPNWTYPEVLSTCADCINKI"
     gene            66786..67280
                     /locus_tag="Bsph_p067"
                     /db_xref="GeneID:6020551"
     CDS             66786..67280
                     /locus_tag="Bsph_p067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695656.1"
                     /db_xref="GI:169825481"
                     /db_xref="GeneID:6020551"
                     /translation="MTEKELEISNNLSYEDNQFANEMGKLINLNNPQFYFRINLNPVP
                     TQVFQLSVDFNTNFENVVVIYYADNEKIYIPKYVEKNYTKDGAKVSHGIGFGENSKWN
                     GKLIVAGFHKTTEPNPNSPWYLSPVKVIKQEIAPSGHHVIEFGFEDGTGWDFNAIRIT
                     LWWE"
     gene            67735..68109
                     /locus_tag="Bsph_p068"
                     /db_xref="GeneID:6020489"
     CDS             67735..68109
                     /locus_tag="Bsph_p068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695657.1"
                     /db_xref="GI:169825482"
                     /db_xref="GeneID:6020489"
                     /translation="MKKINLGTTDFERFNSLYQVEVECYCEQTVIPMDMNNFEFTNIR
                     SFGEASVFKLINKQSGIPVLFLENAELIYSELTISLVRLLKCTHETEVFEQLTQTVGF
                     MFTEDPIDIIGIYLEKYNGDIK"
     gene            68109..68978
                     /locus_tag="Bsph_p069"
                     /db_xref="GeneID:6020522"
     CDS             68109..68978
                     /locus_tag="Bsph_p069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695658.1"
                     /db_xref="GI:169825483"
                     /db_xref="GeneID:6020522"
                     /translation="MQLRLFDISLFPTNTTEPAVSLTLLEKLEQVEMTTETRISSQDN
                     EHCIQQEKLYKGAFTLLKNTLDAFEAHYELQVNDFNLDYSKRGYIDSHDDIRHIKTRI
                     DSNYEKFVSRMVSYFEKEYTVTLDANCIIEKYTPESIDYSKVVEEIFEQLGGLNFSEK
                     AEQELIANSRSLVRNKSNIKITKSKITIAYLVYWSTGWNGKYRLGYSNNNIEKLFEAL
                     SHFENKETKMLEPFKVHFELLKKGEEEYDILKKYDYSLSKVAGIRFYKNLKVEIFFMS
                     NEDADTFNKSYLL"
     gene            69174..70085
                     /locus_tag="Bsph_p070"
                     /db_xref="GeneID:6020475"
     CDS             69174..70085
                     /locus_tag="Bsph_p070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695659.1"
                     /db_xref="GI:169825484"
                     /db_xref="GeneID:6020475"
                     /translation="MEDQLMLFDIDSFATSQKTVVEEVINEVVVTTNPLGNLMERLNA
                     VEITTDNRISEIELDYCKKIEAVYLDSKQVLEDVLSSLTTVFDRQKNVKINGKDLYYL
                     SEFEDIYYVEKRLTYIYRRFVSDITCFFAQRHNVTISSDDIKKKYSYETITYSLIVDE
                     IFEQLGGLNFKEKAIEEIKTNSRKIVYQKDRIIVSRNKMSIDDLIWWNSYAYDGGKEL
                     DYSDSNLRSLFIALSHFIGNKETMLKELENIYAALRIGDKHYDIFSKYEINIGCLVSF
                     KVFKNRKVELVFSDNTSAEAFKNEYLL"
     misc_feature    <69411..69848
                     /locus_tag="Bsph_p070"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4485"
                     /db_xref="CDD:226888"
     gene            70137..73133
                     /locus_tag="Bsph_p071"
                     /db_xref="GeneID:6020513"
     CDS             70137..73133
                     /locus_tag="Bsph_p071"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helicase"
                     /protein_id="YP_001695660.1"
                     /db_xref="GI:169825485"
                     /db_xref="GeneID:6020513"
                     /translation="MKYKNSNVNIPQEQRKALNEKILYLLDNNLTQQYNISAEDVFNA
                     YTGDGGLHDLSFNKFDSYHAFSEAKKEIENGQFFTPALLAKYLVECLKPTEYELIADL
                     TSGMGSFFNYLPNELNIYGNEIDLKAFKVSRFLYPSANLTNQDIRYYKSEVQFDIVLG
                     NPPFNLQWQVNDNKYVSQLYYCIKAHEVLKAGGLMALIVPKSFLADDFTDGGMIAEID
                     HMFDFIGQTLISKDAFSSLGVTSYETKIMFFQKRSEHLQQRPYKSNEFISVSDASDIH
                     ENIIKPVKHQLEAVRAKIQLENRRSLNSEYEYKKNKLLFDIKRNPKLQKHYANCLAYA
                     ERLHTQEKPNNMDDKEWQQKKVTENRVISYLKQALQKQHRTEETRTMTLVKTKYGLQY
                     KAYTPNDKKQLKALNLSLVPFGVNSYPFSDNKYKKLSEKKIKAYNLQETPFQKICPSK
                     EVAQWLTNLKIIDQVNQEEITLNDIQRDDTAKMLMKPYGYLQWGTGAGKSVSAIAQMK
                     YRLEKKQVRNIFIVAPAIAINNNWDDILANYGFNHIRIQKLKDLDQIKSGQIVILTFG
                     MLTKYERQLKRFIKLQSQKVMLVLDEADGICNPSSKRSQATLNVFRKVRYKLLLSATS
                     TRNNIPESFTAFELLYNNSRHMLSRNPTIIVEERKTKDLQEKENHLLNKAFPAYKKGH
                     THFRRSFSPERASVFGIGKLNQDIYNAEYLSDLINKTMITRTFEEVSGKHIYKLVQDP
                     VKFNPMENELYGIVVNEFHRIAHMFQSTGNSRKDAMLRIIQQLNSLLKACVNPQEFNE
                     YRSHQMPSKAVKMLDMIQKWSNDYIVFGCTHIKTVERYEAYIRNAFPDRPLFVITGDK
                     TSLNRRKAIIKELKQSKRGILICTQQSLSSSMNIDFVNNIVLLEMLWNFASMHQFFAR
                     FIRYTSTEQKEVHFVTVENSIESNMLQLIIAKEKLNNFMKNESIDEEEILEKFGIDFD
                     LVNMLLTKETDSEGKSYIQWGNQLVV"
     misc_feature    70428..70736
                     /locus_tag="Bsph_p071"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:222295"
     misc_feature    71601..72515
                     /locus_tag="Bsph_p071"
                     /note="SNF2 family N-terminal domain; Region: SNF2_N;
                     pfam00176"
                     /db_xref="CDD:215770"
     misc_feature    71619..72005
                     /locus_tag="Bsph_p071"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    71622..71636
                     /locus_tag="Bsph_p071"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    71907..71918
                     /locus_tag="Bsph_p071"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    order(72618..72629,72693..72698,72774..72776,72780..72785)
                     /locus_tag="Bsph_p071"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    72636..72890
                     /locus_tag="Bsph_p071"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    order(72801..72803,72864..72866)
                     /locus_tag="Bsph_p071"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            73372..73563
                     /locus_tag="Bsph_p072"
                     /db_xref="GeneID:6020394"
     CDS             73372..73563
                     /locus_tag="Bsph_p072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695661.1"
                     /db_xref="GI:169825486"
                     /db_xref="GeneID:6020394"
                     /translation="MNKKVTEINRYIGLEPQEFKVVGYSVPNNERDSLQQKCKIKISH
                     DDVALNIQQYLRWTPQLVV"
     gene            73757..74119
                     /locus_tag="Bsph_p073"
                     /db_xref="GeneID:6020495"
     CDS             73757..74119
                     /locus_tag="Bsph_p073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695662.1"
                     /db_xref="GI:169825487"
                     /db_xref="GeneID:6020495"
                     /translation="MNNYWGKIMRKKNTEIEHVVDTFTKEILEDCVKYTSNFEGFEYY
                     IKESHLGMFLLVDNFSTTPFVLTKCTINDNDILPSLEAMYQDSIVATESLEEFKEEVQ
                     THIYLEAKALVEKYLALD"
     gene            74366..74683
                     /locus_tag="Bsph_p074"
                     /db_xref="GeneID:6020389"
     CDS             74366..74683
                     /locus_tag="Bsph_p074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695663.1"
                     /db_xref="GI:169825488"
                     /db_xref="GeneID:6020389"
                     /translation="MRLVIFAILTFFLIMFVNSYSQDPKIIEGTIEKKFYQEKKCIQE
                     LTYDPALNMYLPKENCEGPRWTITINNKEFQVTETLYNKLEVDSFYSLSYHPFKGLSL
                     LKK"
     gene            74836..75141
                     /locus_tag="Bsph_p075"
                     /db_xref="GeneID:6020439"
     CDS             74836..75141
                     /locus_tag="Bsph_p075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695664.1"
                     /db_xref="GI:169825489"
                     /db_xref="GeneID:6020439"
                     /translation="MLCKDLKIVSRRETGMYIKGRKVKLITSKVFAFWSFSTILFALI
                     AKVTFDSNVGDELTIKQWVSFISATFCVIILCLPVVISIVTIINKCVERILRKEKIY"
     gene            75466..75768
                     /locus_tag="Bsph_p076"
                     /db_xref="GeneID:6020426"
     CDS             75466..75768
                     /locus_tag="Bsph_p076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695665.1"
                     /db_xref="GI:169825490"
                     /db_xref="GeneID:6020426"
                     /translation="MMLELNTITKCYFFEDISGDISLNKLDLTANLCPSDVEHYYRLN
                     VKGLFYPVFPQSLLKRQLVGYFIDEEYNEFIYIYKDDKKYIIDETMGDLGWLPLKE"
     gene            75776..75946
                     /locus_tag="Bsph_p077"
                     /db_xref="GeneID:6020502"
     CDS             75776..75946
                     /locus_tag="Bsph_p077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695666.1"
                     /db_xref="GI:169825491"
                     /db_xref="GeneID:6020502"
                     /translation="MYSNYNELFELISEYESPTPLNDTCALILLLILGFVKNYSTVEE
                     LKADFIFLRVRR"
     gene            76168..76320
                     /locus_tag="Bsph_p078"
                     /db_xref="GeneID:6020556"
     CDS             76168..76320
                     /locus_tag="Bsph_p078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695667.1"
                     /db_xref="GI:169825492"
                     /db_xref="GeneID:6020556"
                     /translation="MKAKVSFKIGDIEIVAFGGIPQLPNITQEVKDNMVLNSAISNVK
                     KIWELT"
     gene            76371..76694
                     /locus_tag="Bsph_p079"
                     /db_xref="GeneID:6020449"
     CDS             76371..76694
                     /locus_tag="Bsph_p079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695668.1"
                     /db_xref="GI:169825493"
                     /db_xref="GeneID:6020449"
                     /translation="MLLKCGVFMKKRSFVKDVNTAMVLKDYKEYENNINAVGANAEIL
                     VGTKEFAEILGWTKAKLSTKYSRQRDGQKVKDPLPEPIQLLAATPVWTLEQAMNYKKS
                     LSKEE"
     gene            76776..76997
                     /locus_tag="Bsph_p080"
                     /db_xref="GeneID:6020466"
     CDS             76776..76997
                     /locus_tag="Bsph_p080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695669.1"
                     /db_xref="GI:169825494"
                     /db_xref="GeneID:6020466"
                     /translation="MDITNINVFLTNQEEAYLKLCFVELENFREKGVLVEGEIRKLNN
                     QFFNGNPTTLFTIGELVYREIAIRHFNVC"
     misc_feature    <76782..>76904
                     /locus_tag="Bsph_p080"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:245225"
     gene            76987..77115
                     /locus_tag="Bsph_p081"
                     /db_xref="GeneID:6020503"
     CDS             76987..77115
                     /locus_tag="Bsph_p081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695670.1"
                     /db_xref="GI:169825495"
                     /db_xref="GeneID:6020503"
                     /translation="MFARKKKILFIVLIKIELVNFSRVNVAAKYEDAQYEGFKQPE"
     gene            77155..77373
                     /locus_tag="Bsph_p082"
                     /db_xref="GeneID:6020523"
     CDS             77155..77373
                     /locus_tag="Bsph_p082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695671.1"
                     /db_xref="GI:169825496"
                     /db_xref="GeneID:6020523"
                     /translation="MDKEKVKEMICKAIDNIPDCADIVDCYTEHSFGDSQAFIKVVVK
                     VKEETEENITQFHNIAHKSFDSGMDFTS"
     gene            77467..77688
                     /locus_tag="Bsph_p083"
                     /db_xref="GeneID:6020545"
     CDS             77467..77688
                     /locus_tag="Bsph_p083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695672.1"
                     /db_xref="GI:169825497"
                     /db_xref="GeneID:6020545"
                     /translation="MWMGPTLDYTRVHLKIRCFRDSCDNVLEHEYTSDNWSARIDGKC
                     SKCGHDYSVKVASLSESDIISRTKEEVYR"
     gene            78149..78520
                     /locus_tag="Bsph_p084"
                     /db_xref="GeneID:6020468"
     CDS             78149..78520
                     /locus_tag="Bsph_p084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695673.1"
                     /db_xref="GI:169825498"
                     /db_xref="GeneID:6020468"
                     /translation="MGYIALNKLDNVIYTLDVLQKANDKSIWYYKGLTNETLPYVLVV
                     NYGVFPKTKKLRNEDVHYIFDKKSYGDDLFLKKKISHMFKITKSEDIESIELNYTTNG
                     TAPFYVWKYVKEFMYIDSDID"
     gene            complement(79415..80179)
                     /locus_tag="Bsph_p085"
                     /db_xref="GeneID:6020571"
     CDS             complement(79415..80179)
                     /locus_tag="Bsph_p085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695674.1"
                     /db_xref="GI:169825499"
                     /db_xref="GeneID:6020571"
                     /translation="MLRFKKMLQILCLGIIGIAVSMVSFNSSVSASELESEDSLREVY
                     ENALNNGELGSDVSFDLWKEIYEESKQLEASFLEGTSSEIPSIAARASYSMKAGDIFL
                     TNATVSSGIVGHAGIAINDTYILHIPGPNKTTQLLTLSDWKSKYAGSNGTTWVHRVNS
                     SDLASKAATWALKNYYNSSGSTGSQNIKPSYKITTALSSTDPTYCSKIVYQAYYNADK
                     DVSGTWVYNRSGIVSPYDFRSNVFYQTPPEVAIFTK"
     gene            80343..80624
                     /locus_tag="Bsph_p086"
                     /db_xref="GeneID:6020570"
     CDS             80343..80624
                     /locus_tag="Bsph_p086"
                     /codon_start=1
                     /transl_table=11
                     /product="putative secreted protein"
                     /protein_id="YP_001695675.1"
                     /db_xref="GI:169825500"
                     /db_xref="GeneID:6020570"
                     /translation="MYFSKVPGKLEEAESAFENYIEAQGVSENNIKSKEFNKNYKFGG
                     YDITVTYKDEPSSYVYEYFYNAKTKKINLIVLDDGRSINEGIKYPPIKE"
     misc_feature    <80346..80531
                     /locus_tag="Bsph_p086"
                     /note="Protein of unknown function (DUF3139); Region:
                     DUF3139; pfam11337"
                     /db_xref="CDD:221085"
     gene            81095..82201
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /db_xref="GeneID:6020569"
     CDS             81095..82201
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /note="site-specific tyrosine recombinase which cuts and
                     rejoins DNA molecules; binds cooperatively to specific DNA
                     consensus sites; essential to convert chromosome dimers to
                     monomers during cell division and functions during plasmid
                     segregation; cell division protein FtsK may regulate the
                     XerS"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase XerS"
                     /protein_id="YP_001695676.1"
                     /db_xref="GI:169825501"
                     /db_xref="GeneID:6020569"
                     /translation="MPAITPKVLQAEKHIEDATPLFPVYVQEYIRDKKSKYSPLTLSG
                     YLYNIEKFLNWLLEEGIVDAKNIRDIHYESLSTLAKLDVELFVDKMASEILSGEDDNE
                     PKRRSKTSVARAVQALKSLFRYLTVETEDKVTQEPYFNRNVMLKISVDLELESKSRRS
                     KRIEKKTYKSDEIDELLHFIDEEYAATLSSRKLTYFEMNKIRDLAILAVLFGSGIRGN
                     ELVGLKIKDVYMKDCYLDVIRKGDKADSVAIRPSALTYLEEYLKQRSKLYSVKTNYPF
                     VFVAKSPDGTVKQMSNQTLIRLVKKYTLAYGKEITPHKARYTFSKQYQAQGGTLIGLR
                     DQLGHQNIETTSLYTTESMKEQKDVVTRMDKPSN"
     misc_feature    81110..82186
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /note="site-specific tyrosine recombinase XerS; Reviewed;
                     Region: xerS; PRK05084"
                     /db_xref="CDD:235339"
     misc_feature    81176..82174
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:241691"
     misc_feature    order(81740..81745,81812..81814,82025..82033,82136..82138)
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(81740..81742,81812..81814,82031..82033,82040..82042,
                     82109..82111,82136..82138)
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(81740..81742,82031..82033,82040..82042,82109..82111,
                     82136..82138)
                     /gene="xerS"
                     /locus_tag="Bsph_p087"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            83113..83700
                     /locus_tag="Bsph_p088"
                     /db_xref="GeneID:6020568"
     CDS             83113..83700
                     /locus_tag="Bsph_p088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695677.1"
                     /db_xref="GI:169825502"
                     /db_xref="GeneID:6020568"
                     /translation="MVTSLIKREIAEQFNIYKDELGIEEKVPLKFRGLGNGGGYFWGQ
                     VKLENGTVKQWSSYPERTKFLLIHELVHAKYKETKNPFLSTLIITPSLVLLYLMRELR
                     ANTIAYQTLGCKDSILEDYFYNYYPTQSNGYFNLSGGYVSGKTNVTLIKANPIWNRNA
                     IEEAIEFFTSEFSYLKRTSKRKIEQVKNCFIEQLY"
     gene            complement(83853..84083)
                     /locus_tag="Bsph_p089"
                     /db_xref="GeneID:6020567"
     CDS             complement(83853..84083)
                     /locus_tag="Bsph_p089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695678.1"
                     /db_xref="GI:169825503"
                     /db_xref="GeneID:6020567"
                     /translation="MTKQYIASIKNTTTGSWLKSTNSHNNTTSSGIIHSYDHTLLKEE
                     RLIFKDKNVAENTLKTLQVNYPDIFILVNETI"
     gene            complement(84175..84600)
                     /locus_tag="Bsph_p090"
                     /db_xref="GeneID:6020566"
     CDS             complement(84175..84600)
                     /locus_tag="Bsph_p090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695679.1"
                     /db_xref="GI:169825504"
                     /db_xref="GeneID:6020566"
                     /translation="MAIIQIIKKLISWLFIFILLYLSIDGMYIISTAISEVPDKKTAI
                     ESIRAIVASLLALTIALMFIFFYPIRMFRSYKEGFLIIFMYLLLLSFAFVGNLEITFY
                     TGLTYLVLNLVLDITLTIVQKNHDKKLEPKNNNTVKVPN"
     misc_feature    complement(<84319..84600)
                     /locus_tag="Bsph_p090"
                     /note="Cell cycle protein; Region: FTSW_RODA_SPOVE;
                     cl00511"
                     /db_xref="CDD:241915"
     gene            complement(84694..85563)
                     /locus_tag="Bsph_p091"
                     /db_xref="GeneID:6020565"
     CDS             complement(84694..85563)
                     /locus_tag="Bsph_p091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695680.1"
                     /db_xref="GI:169825505"
                     /db_xref="GeneID:6020565"
                     /translation="MVTTISNEKGRMNMNAARLQDGTIIIAKDYYSENHGSEIYCMDI
                     ACGAPVHFVQEGKKVSFFKTSGKGESVHKELCAFAAKMTFERSLFKVTQFQQELKSQV
                     EPIMVRLNTNKLDPDYVSRSVEREGSNKEVDARELKISNESPKPPQTVSSLKSLKKLF
                     QTADPDLLASIFISYNGHKLPITDLISDQYIAAKKLWQGTSLNVNYFVHGEVTSIVRL
                     DKVWYFNMGDDRFPFTLVVFEKYFEHFTYTDEDLLNRTILVMGRLKKNDYNKDKFVTE
                     MVIKADAYIEFLD"
     gene            complement(86058..87344)
                     /locus_tag="Bsph_p092"
                     /db_xref="GeneID:6020563"
     CDS             complement(86058..87344)
                     /locus_tag="Bsph_p092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695681.1"
                     /db_xref="GI:169825506"
                     /db_xref="GeneID:6020563"
                     /translation="MGDANLVITTKNCETRYLPYKTFHIQDNPTVRDMLNEIYSNKEN
                     IQLSCSCNPYNTSMVLSKSKSGRFFVKSKPHSKSLHFKCEFAYTQDGSKESTHFPSIY
                     SPELFISDRDNNYLIEFDLSLNLEPLKRNTLALKLSNLGLELLARAWDYLMDNYMKKK
                     SHYYPDLNSIKFSLINLFVGKKDYHKGNTITPPLTSVKLDKNINLEDILYLGLHSTAA
                     IYAINKRYGVYAVVLTSLYNSEISEHDEEYYLLTLSINNRIKGKVRQYHRKFIMKKTL
                     FKSSIEKYSIEQFSHLDNFLNERKVPYYLIGLAKSDSYANLPELVEIALIPVNYNGVI
                     VRNIEELRFTNLLCVRRRIFKKPISRTIHYNNIAPSFILYDSIKPTICEVIVDTTNSL
                     EKIEYFNNQTDFLFYAWFANKYTKITENIPDVYINE"
     gene            complement(87429..87695)
                     /locus_tag="Bsph_p093"
                     /db_xref="GeneID:6020560"
     CDS             complement(87429..87695)
                     /locus_tag="Bsph_p093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695682.1"
                     /db_xref="GI:169825507"
                     /db_xref="GeneID:6020560"
                     /translation="MRLHKVLVDKKQYVLIKEYESKYGDNIRSLDFMIPMKIQGAWGL
                     YKVHYCYASFYNRYYAELELKEKADGKFEALLLAIKNASKGGMI"
     gene            complement(87836..88447)
                     /locus_tag="Bsph_p094"
                     /db_xref="GeneID:6020558"
     CDS             complement(87836..88447)
                     /locus_tag="Bsph_p094"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695683.1"
                     /db_xref="GI:169825508"
                     /db_xref="GeneID:6020558"
                     /translation="MHSFKWGITIAIILLLSGCQYNAPDYGEAAKNNTDTEDENGIET
                     TTTEIISWNGVVTSIDEDLKIHLETTTPEFPHKEIALAAIELPIVRDHVLSREVQQIL
                     TDLLVAETVRIEVDLKDPKNTDIPHAYIYIDDMRVQDLLVRSGLAFLDGDNTMYTSHL
                     MTLQEEAIDQLKGIWANKSSSLSDSILTGIKENMVDIIESSKN"
     misc_feature    complement(87917..>88237)
                     /locus_tag="Bsph_p094"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cl00140"
                     /db_xref="CDD:241633"
     misc_feature    complement(order(88079..88081,88085..88090,88229..88231))
                     /locus_tag="Bsph_p094"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            complement(88633..88809)
                     /locus_tag="Bsph_p095"
                     /db_xref="GeneID:6020557"
     CDS             complement(88633..88809)
                     /locus_tag="Bsph_p095"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695684.1"
                     /db_xref="GI:169825509"
                     /db_xref="GeneID:6020557"
                     /translation="MKIHSTAIENFRTHQKVQKAKGPHESEVKGKSEASFPTYVAIGL
                     MISFYIGASLIYSL"
     gene            complement(89043..89372)
                     /locus_tag="Bsph_p096"
                     /db_xref="GeneID:6020555"
     CDS             complement(89043..89372)
                     /locus_tag="Bsph_p096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695685.1"
                     /db_xref="GI:169825510"
                     /db_xref="GeneID:6020555"
                     /translation="MFDKFPYTRKVIQDLEYENYLDQTEWLFCDDETALLTLAKLVKT
                     SEQLTSSNIPDRLAAKERVNEDYLEVGRSVQVLARNEARHQLSLSNDDVANLFSSVEI
                     GGARFMN"
     gene            complement(89378..89704)
                     /locus_tag="Bsph_p097"
                     /db_xref="GeneID:6020554"
     CDS             complement(89378..89704)
                     /locus_tag="Bsph_p097"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695686.1"
                     /db_xref="GI:169825511"
                     /db_xref="GeneID:6020554"
                     /translation="MKNKQPEIIYRYIRKKTRDILDGEDLILILVDVRKIHTVRRFNK
                     ESTKVISGGLYQNEFTVDDQPDYIKDLPFGRYAIEISEEEFEYLSLLSQNDVQSFIRY
                     IKRTSR"
     gene            complement(90419..90646)
                     /locus_tag="Bsph_p098"
                     /db_xref="GeneID:6020552"
     CDS             complement(90419..90646)
                     /locus_tag="Bsph_p098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695687.1"
                     /db_xref="GI:169825512"
                     /db_xref="GeneID:6020552"
                     /translation="MNNLNVAFGKVLKIYRKDAGLSQEQLALQCDLDRTYIGLLERAE
                     RQPSITTIFKICTALNVKPHEFIKEVEKLIN"
     misc_feature    complement(<90422..90625)
                     /locus_tag="Bsph_p098"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(90449..90622)
                     /locus_tag="Bsph_p098"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(90521..90523,90596..90598,90608..90610))
                     /locus_tag="Bsph_p098"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(90524..90526,90599..90601))
                     /locus_tag="Bsph_p098"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(90518..90523,90533..90535,90542..90544,
                     90575..90580))
                     /locus_tag="Bsph_p098"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(91109..91303)
                     /locus_tag="Bsph_p099"
                     /db_xref="GeneID:6020549"
     CDS             complement(91109..91303)
                     /locus_tag="Bsph_p099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695688.1"
                     /db_xref="GI:169825513"
                     /db_xref="GeneID:6020549"
                     /translation="MKKKTSKKRIYTQKNGIKVIITHIPAEECKCDYYITIADALTIE
                     THLSKNTYNEPTYLNFNELK"
     gene            complement(91402..91770)
                     /locus_tag="Bsph_p100"
                     /db_xref="GeneID:6020548"
     CDS             complement(91402..91770)
                     /locus_tag="Bsph_p100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695689.1"
                     /db_xref="GI:169825514"
                     /db_xref="GeneID:6020548"
                     /translation="MFMKKQNKHMQSEWDKELEEIKKCVKQGNVLSSHILDRLEERGI
                     SIMDLVAAILQGEIVEGYDVAQYPNYRNPNMIRNLIGMDTQGRKLKIGVAIEFNGTQL
                     IVRNLTTVFDVSSKVEYLVG"
     misc_feature    complement(91483..91683)
                     /locus_tag="Bsph_p100"
                     /note="Domain of unknown function (DUF4258); Region:
                     DUF4258; pfam14076"
                     /db_xref="CDD:206246"
     gene            complement(92148..93134)
                     /locus_tag="Bsph_p101"
                     /db_xref="GeneID:6020546"
     CDS             complement(92148..93134)
                     /locus_tag="Bsph_p101"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695690.1"
                     /db_xref="GI:169825515"
                     /db_xref="GeneID:6020546"
                     /translation="MNHMEKEQVKGYSIQEITELLGVVEMTVYQYIKKGLLEEVDQPN
                     LKYTINGQRLFTVESVEALKDKMTVGKDYISLNAYAKQNGINQIVLKKLIAENDIDIP
                     KGTQGLREVFLITPDIKAQLDKLVLENSFTHFKTKSKYYNSKYDIALLQSFVDTEGKA
                     FRIVKNGAKWGVYEETGFTQFECLDGLKPLYSIHKPTVNALSMYVYFKIPNEDKNRYN
                     YVDAIYATFGIENAQLLLTDTQIAVRVKVSSWSMSEDDKHLENLLTLNQYASNGELIY
                     IDNILSVESTDKRVVVILPKDIHSKLSKHAKDQKITDSKAAQQIILDYFENR"
     misc_feature    complement(92937..93101)
                     /locus_tag="Bsph_p101"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:205047"
     gene            complement(93166..93582)
                     /locus_tag="Bsph_p102"
                     /db_xref="GeneID:6020544"
     CDS             complement(93166..93582)
                     /locus_tag="Bsph_p102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695691.1"
                     /db_xref="GI:169825516"
                     /db_xref="GeneID:6020544"
                     /translation="MVVLEQIQLFTEEQFDQSPESNFKKGSSTKSIPLFEEKLLNKRI
                     TPLLKAAKIGSAELRVCIRGVYTHWMVVEVSTLTASVTMTIMNNGDADYIHWQSGPCT
                     IEYENQYFNKRYNPNTFFYLEKRLEQSLIDFLSYKT"
     gene            complement(93647..94006)
                     /locus_tag="Bsph_p103"
                     /db_xref="GeneID:6020541"
     CDS             complement(93647..94006)
                     /locus_tag="Bsph_p103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695692.1"
                     /db_xref="GI:169825517"
                     /db_xref="GeneID:6020541"
                     /translation="MEDKKMGNKSTVIILLTGFTMVIGLGFYVIKEYYRILDPEEHTV
                     TNFKLIENTTYSYLEFESNNETMKINIDNIRNIILSDENYSYYSYLRPHYTIHFTEED
                     YERFFSENDKGKGNSAE"
     gene            complement(95110..96276)
                     /locus_tag="Bsph_p104"
                     /db_xref="GeneID:6020536"
     CDS             complement(95110..96276)
                     /locus_tag="Bsph_p104"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-methyltransferase"
                     /protein_id="YP_001695693.1"
                     /db_xref="GI:169825518"
                     /db_xref="GeneID:6020536"
                     /translation="MKHLEAEHCSKPNNELINTYNKLQEELTTYQLHDISDQHLRKHY
                     HLKLMGEKLDINSSIFIPNRFMCDFCSTVYDSKEELDHKDEGFWCEACDGFTYFNHTR
                     PNHDRFILILEDPSEPALKQEYKTDIKLSSHLSPLRYPGGKSKLVNYLYSHLSESKRK
                     TLYSPFVGGGSYELALLHSEIISQLKINDLDYGVFSLWWTMLHMPSELIYRIQNDIPS
                     RNQYFAAQRNIKNKFKGQDMIEAAWDTLLVNRLAFSGIPKAHPLGGKNGTQSKLLARW
                     SPKTLIKRIQAISEMADKITITCQDAYGFVEEAYWDTDGTIFVDPPYVSKGEALYNHY
                     YTATDHKNLAFLLNHLYQGMPGADIIVTYDYNRLITDSYEYQTESHVIGRKYSI"
     misc_feature    complement(95113..95874)
                     /locus_tag="Bsph_p104"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dam; COG0338"
                     /db_xref="CDD:223415"
     gene            complement(96287..96664)
                     /locus_tag="Bsph_p105"
                     /db_xref="GeneID:6020533"
     CDS             complement(96287..96664)
                     /locus_tag="Bsph_p105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695694.1"
                     /db_xref="GI:169825519"
                     /db_xref="GeneID:6020533"
                     /translation="MNILDYIVDFVKSQSTEFLLGCYFEIDEWKRSGTITNGYLLELQ
                     SRFNLNSNQLFGIGALLHEQLIQKTAILFNFCVQWLIHERLLCTLNNKDESAFYYPND
                     SAFTFYLNREEQCICSSSRNKYS"
     gene            complement(96842..97522)
                     /locus_tag="Bsph_p106"
                     /db_xref="GeneID:6020530"
     CDS             complement(96842..97522)
                     /locus_tag="Bsph_p106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695695.1"
                     /db_xref="GI:169825520"
                     /db_xref="GeneID:6020530"
                     /translation="MFNSNYRKEEKSPPLSIKNGLQDLERDMIHMLKESYNYITKHPK
                     AKIISGINALFTFALWFILLDFYRYYNNVFGESNLFFNLYEMISLPKENLYIIAGLHL
                     ITTTLTVYFLGNAVTFLLERIRFERHITNKSIDTYLKQERSMIIFLFGFLTGFIFYLV
                     ILKDMQFHQFILRDVIVCIFMLITIFVYRYNKLVLKFSNDMKNQVLNTYLEAIESLIE
                     EKKNEMND"
     gene            complement(97597..97923)
                     /locus_tag="Bsph_p107"
                     /db_xref="GeneID:6020527"
     CDS             complement(97597..97923)
                     /locus_tag="Bsph_p107"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695696.1"
                     /db_xref="GI:169825521"
                     /db_xref="GeneID:6020527"
                     /translation="MMLNLFIKRKKEIVTTITISSKKSPVKIGDNQKSCLISVKIGNE
                     EFFYFTDVNIHYKIKDFPLYAVEYLKNFGKGFWCKVEKQIIKKDTFIKINNHYFNVND
                     LNIKLN"
     gene            complement(97945..98253)
                     /locus_tag="Bsph_p108"
                     /db_xref="GeneID:6020526"
     CDS             complement(97945..98253)
                     /locus_tag="Bsph_p108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695697.1"
                     /db_xref="GI:169825522"
                     /db_xref="GeneID:6020526"
                     /translation="MGSKELIFLEKTKDYGYPLFIFESIVDKKYYSIEVTNWEYDNTI
                     FEDGEKIEVDARTAKELDVIDRGLFSLFFNFAQTTDLEVYINDDWQPLFEMTDYSKSN
                     "
     gene            complement(98436..98609)
                     /locus_tag="Bsph_p109"
                     /db_xref="GeneID:6020521"
     CDS             complement(98436..98609)
                     /locus_tag="Bsph_p109"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695698.1"
                     /db_xref="GI:169825523"
                     /db_xref="GeneID:6020521"
                     /translation="MSEDEKVYKQAMERIDELVEEVIQNCIDVADENHYEREWVLDRF
                     RAKFNSAKRKERD"
     gene            complement(98672..99724)
                     /locus_tag="Bsph_p110"
                     /db_xref="GeneID:6020520"
     CDS             complement(98672..99724)
                     /locus_tag="Bsph_p110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695699.1"
                     /db_xref="GI:169825524"
                     /db_xref="GeneID:6020520"
                     /translation="MYFNFERKDKLSGDKMELYIQFEFESIKMIAKQTSFTKLERLYG
                     FYFYDLTHPEDDEHFPDAIVKEGAAHFNYWGSIMTDRPIEQVEHLGQYYIADWALNLD
                     DEEAPAPNEDFVNCTQFYTYDFYVSGVENEENIKFHRVDNLLDLIEPYEYSTQELTMD
                     RTWNMPNKNTFEIHSIKDLLKEELTGGLIIDPFANNNSLAHMTNDLNTKYETDFHMDA
                     LEFLKLFADESVDVVLFDPPYSPRQVKEAYESIGLDTQGGRLTRASYWSNLKKEITRI
                     LRVGGKAISCGWNSGGMNNKDVFHINRIRLVAHGGNHNDTIATVSVKTKRIENIYVVE
                     QAKVKNNQDYKQLSLW"
     misc_feature    complement(<99008..99103)
                     /locus_tag="Bsph_p110"
                     /note="DNA methylase; Region: N6_N4_Mtase; cl17433"
                     /db_xref="CDD:247987"
     gene            complement(100278..100403)
                     /locus_tag="Bsph_p111"
                     /db_xref="GeneID:6020517"
     CDS             complement(100278..100403)
                     /locus_tag="Bsph_p111"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695700.1"
                     /db_xref="GI:169825525"
                     /db_xref="GeneID:6020517"
                     /translation="MATEITAMFTAKNILSSFNYLLDMGLIVTNLPQKDVEENKN"
     gene            complement(100504..100635)
                     /locus_tag="Bsph_p112"
                     /db_xref="GeneID:6020516"
     CDS             complement(100504..100635)
                     /locus_tag="Bsph_p112"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695701.1"
                     /db_xref="GI:169825526"
                     /db_xref="GeneID:6020516"
                     /translation="MVDKKVVYTQCMLPFYFEMKKIYKTIRKVLEYKIFLAIMSQIY"
     gene            complement(100641..100967)
                     /gene="abrB"
                     /locus_tag="Bsph_p113"
                     /db_xref="GeneID:6020515"
     CDS             complement(100641..100967)
                     /gene="abrB"
                     /locus_tag="Bsph_p113"
                     /codon_start=1
                     /transl_table=11
                     /product="transition state regulatory protein"
                     /protein_id="YP_001695702.1"
                     /db_xref="GI:169825527"
                     /db_xref="GeneID:6020515"
                     /translation="MQIPLKGGEIMKSTGVVRKVDELGRVVLPIELRKSLGIKEKDPI
                     EIFVDGDKIILKKYVPNMSCAITGEVSSDNLSVLDGKLILSEHGAEHLIKEIQLLLIN
                     KGSLNN"
     misc_feature    complement(100680..100937)
                     /gene="abrB"
                     /locus_tag="Bsph_p113"
                     /note="Regulators of stationary/sporulation gene
                     expression [Transcription]; Region: AbrB; COG2002"
                     /db_xref="CDD:224913"
     misc_feature    complement(100797..100916)
                     /gene="abrB"
                     /locus_tag="Bsph_p113"
                     /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
                     smart00966"
                     /db_xref="CDD:198034"
     gene            complement(101068..101361)
                     /locus_tag="Bsph_p114"
                     /db_xref="GeneID:6020512"
     CDS             complement(101068..101361)
                     /locus_tag="Bsph_p114"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695703.1"
                     /db_xref="GI:169825528"
                     /db_xref="GeneID:6020512"
                     /translation="MKAARWVWSRGKDGDNFKVLPIAITGGVILDIYKVIYGVGNTCG
                     GYNQAKVVASKKEHVQGLLNEQEDESVLITLIEITTEDTSIYKHEQVLSIDIA"
     gene            complement(101388..103193)
                     /locus_tag="Bsph_p115"
                     /db_xref="GeneID:6020511"
     CDS             complement(101388..103193)
                     /locus_tag="Bsph_p115"
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
                     /protein_id="YP_001695704.1"
                     /db_xref="GI:169825529"
                     /db_xref="GeneID:6020511"
                     /translation="MSTTLRHAEYYDMQSIFDDLYERSKNNATKGLNLYEHIISKNNI
                     LLAYRNIKANTGSKTAGTDGITIEQYKIEDVETFVDEIRATLKNYKPQTVRRVEIPKP
                     NGKTRPLGIPTMRDRLIQQMFKQILEPICEARFYNHSYGFRPNRSTHHAMGRCQFLAN
                     IALNQHVVDIDIQGFFDNVSHSKLLKQMYSIGICDKRVLSVVSKMLKAPIKGIGIPTK
                     GTPQGGILSPLLSNIVLNDLDWWISNQWENMKTKFNYKERKNKVLMIKRTTTLKEMYI
                     VRYADDFKIFTKSHKNAIKLYHAVKGYLKNHLNLDISNEKSKITNLRKRASEFLGFSL
                     KVIKKGKRYVANTHVMDDKVKTILQKARKLIHEIKKNPTAKMAMNYNAYVLGIKNYYK
                     IATHVNTDFSEIAYRLSRTLYNRLKSIGNYGIPIKPSETYKRFNKNNFKTFEIENIHL
                     FPIADIKTVNSTNFSQDLCNYTKEGRLKLHKQLKNDVAIEINRLLKTISYNDNLEYAD
                     NRISRYSMQSGKCAITGDFLVAEEVHCHHRIPRYMGGSDEFKNLVIVHSNVHKLIHAT
                     ETETIERYKSLLQLDGKQLEKLNQFRKKCNLVALV"
     misc_feature    complement(102192..102911)
                     /locus_tag="Bsph_p115"
                     /note="RT_G2_intron: Reverse transcriptases (RTs) with
                     group II intron origin. RT transcribes DNA using RNA as
                     template. Proteins in this subfamily are found in
                     bacterial and mitochondrial group II introns. Their most
                     probable ancestor was a retrotransposable...; Region:
                     RT_G2_intron; cd01651"
                     /db_xref="CDD:238828"
     misc_feature    complement(102192..102899)
                     /locus_tag="Bsph_p115"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:215698"
     misc_feature    complement(order(102201..102206,102348..102353,
                     102357..102359,102525..102530,102666..102683))
                     /locus_tag="Bsph_p115"
                     /note="putative active site [active]"
                     /db_xref="CDD:238828"
     misc_feature    complement(order(102351..102353,102528..102530,
                     102666..102683))
                     /locus_tag="Bsph_p115"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238828"
     misc_feature    complement(102525..102527)
                     /locus_tag="Bsph_p115"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238828"
     misc_feature    complement(101502..101639)
                     /locus_tag="Bsph_p115"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(101502..101504,101514..101516,
                     101523..101528,101538..101543,101574..101576,
                     101580..101588,101592..101594))
                     /locus_tag="Bsph_p115"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            complement(103952..104116)
                     /locus_tag="Bsph_p116"
                     /db_xref="GeneID:6020510"
     CDS             complement(103952..104116)
                     /locus_tag="Bsph_p116"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695705.1"
                     /db_xref="GI:169825530"
                     /db_xref="GeneID:6020510"
                     /translation="MTLGKASEIKFALIASNGRQQLQEWLEENRDVEVLDIKFDFDNY
                     PKFLVIYRDN"
     gene            complement(105341..106198)
                     /locus_tag="Bsph_p117"
                     /db_xref="GeneID:6020506"
     CDS             complement(105341..106198)
                     /locus_tag="Bsph_p117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695706.1"
                     /db_xref="GI:169825531"
                     /db_xref="GeneID:6020506"
                     /translation="MTKNEIKAINKKDFAIVFSVKNANPNGDPNNGNRPRQSPFDSIG
                     EISDVAIKRKIRNRFMDYDQDIFVQSEDRTIDGFRSLKDRADSIEGLKGADSETYKKI
                     ACETWIDVRTFGQVFSFKGDKNDSVSVGVRGPVAIQSAFSVHPIEITSTKITKSVNLV
                     TSNKKTSDTMGEKHRVNYGLYVCYGSINSQLAQDTKFSDKDAALLKEILSSIFENDLS
                     AARPSGSMEVHNVYWWEHNSPLGQYSSAKVHRSLEIKQTVESPTSYDDFEIKVNELDG
                     LSVEVLPGY"
     misc_feature    complement(105353..106168)
                     /locus_tag="Bsph_p117"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas7; Region: Cas7_I-C; cl01465"
                     /db_xref="CDD:242519"
     gene            complement(106191..108011)
                     /locus_tag="Bsph_p118"
                     /db_xref="GeneID:6020505"
     CDS             complement(106191..108011)
                     /locus_tag="Bsph_p118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695707.1"
                     /db_xref="GI:169825532"
                     /db_xref="GeneID:6020505"
                     /translation="MSLLNALVQTYDNNLEVVGKVNKKRNGTEYTLLPIAHSTQVTHV
                     EVFVSNQGEFLSAAVIEGERNTVIPVTEASSGRTSGLAPHPIHDKLMYVAGDYSDYIS
                     GKSKAREAFKLYLEQLSKWCDSEYGHESLSNLYEYLKKGTLIEDLVKNKTLYLDDNGM
                     LLLKWQKKNEKTPDIYKIVSNVADVAIRFTIEGLEPVMWENTDIRNLHIQKTISDITE
                     LDFCYVTGEYAPISVNQPKKIRNTMDQAKLISSSNANALTFKGRFAEARDSFNISYEA
                     SQKAHNALKWLINRQSINIDGRVFLVWSDGMEQPKNWDELLRAGEQEAKEFYLNLTGV
                     KEGHIDSKNTYLTILDAATPGRLAVTSFEQLTTSSYYKRVYNFYNKYIWYFTHRKNDN
                     GENQEGLAAPTLKEILNVIYPDTTRADILKNTYNTLLICVLYNRPIPREYINRAVARL
                     KNGNEMGTWEWDKNLSITCALINYERGKGEFSVSLDTQNNNRSYLFGRLLAVAEVLER
                     SALGSENRPTNAARYTASFVQAPARTWTILQQKIVPYQNKLNSKLAAYYQAIIDNIIS
                     LMNPNDFSNKTLEETYLLGFYSQRKDLYTKKEKKGDKSND"
     misc_feature    complement(106227..108002)
                     /locus_tag="Bsph_p118"
                     /note="CRISPR/Cas system-associated protein Cas8c; Region:
                     Cas8c_I-C; cl12004"
                     /db_xref="CDD:245832"
     gene            complement(108027..108755)
                     /locus_tag="Bsph_p119"
                     /db_xref="GeneID:6020504"
     CDS             complement(108027..108755)
                     /locus_tag="Bsph_p119"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695708.1"
                     /db_xref="GI:169825533"
                     /db_xref="GeneID:6020504"
                     /translation="MAWTIEFLVYGRNALFTDPFSKTGGEKTTTLIPTYEAMKGVAES
                     IYWKPSIKWHIDSIRVMKAIRTESKGVLPRVYSGGKMLSLYTYLHDVAYQVRATISPN
                     ESRPDLKNDYNMVKHHQMALRSLDKGGRRDIFLGVRECQAYVEPCKFGSEDGEYDSTG
                     TIGFGLMVHGFNYPNNRSKLFEVRFWKPEMLNGIINFPKPSDCIYTRKIREMNVKQGA
                     RFQSVDDALDILIREDGLGFFNNI"
     misc_feature    complement(108162..108746)
                     /locus_tag="Bsph_p119"
                     /note="CRISPR-associated protein (Cas_Cas5); Region:
                     Cas_Cas5d; pfam09704"
                     /db_xref="CDD:220353"
     misc_feature    complement(108162..108743)
                     /locus_tag="Bsph_p119"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas5; Region: Cas5_I; cl12040"
                     /db_xref="CDD:245846"
     gene            complement(109035..109535)
                     /locus_tag="Bsph_p120"
                     /db_xref="GeneID:6020501"
     CDS             complement(109035..109535)
                     /locus_tag="Bsph_p120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695709.1"
                     /db_xref="GI:169825534"
                     /db_xref="GeneID:6020501"
                     /translation="MKNEYVGIKEIAEIGASIEFEKDGQILDLAVYEVFEDHVVVTGG
                     INVQHKDYTITAYDLQERKMRELPRVNLLFTEQEVGKEMMEKFIITQKDNDFAEIGHC
                     FRCKFDGEKVTIHNDMSWWSVTIPLEQFRNEFKEMSKEDYSTYINACNEGEDQVIESV
                     IKKYLG"
     gene            complement(109551..109886)
                     /locus_tag="Bsph_p121"
                     /db_xref="GeneID:6020500"
     CDS             complement(109551..109886)
                     /locus_tag="Bsph_p121"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695710.1"
                     /db_xref="GI:169825535"
                     /db_xref="GeneID:6020500"
                     /translation="MNKWNNFETLEHHKGKIWVSKLFKLENRGNICYLQNGEFLMLAY
                     VSPSMLENKLLDTVIKDIIIANGTPYMLSEDTITCSVCGNSYDEGDVNIVDYPDDVCV
                     TCEKNYTGS"
     gene            complement(109927..110667)
                     /locus_tag="Bsph_p122"
                     /db_xref="GeneID:6020496"
     CDS             complement(109927..110667)
                     /locus_tag="Bsph_p122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695711.1"
                     /db_xref="GI:169825536"
                     /db_xref="GeneID:6020496"
                     /translation="MKSTHEIIAEAAKQLKLGVFNRVAVREESWALDKEKYYNRHLDD
                     NEYIEIITFYNNKRNKTGNFIESLHVYFRWSLDDINVCAYTTSENQSVYQGTKIRNLK
                     NPTKIGEVTTTFKDIAAVLKQFVLDAQKVLNIYLNKKIDPQFEATVKLLVETYSDKSN
                     NLECMTVHFAIHSPSVSINLETGWGGDDFFFTVSKDRKKASMKIKLDAFELAPGDRTT
                     YIETVDINEGDFLTAYKKFFYDYHLITQ"
     gene            complement(110703..111593)
                     /locus_tag="Bsph_p123"
                     /db_xref="GeneID:6020493"
     CDS             complement(110703..111593)
                     /locus_tag="Bsph_p123"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase"
                     /protein_id="YP_001695712.1"
                     /db_xref="GI:169825537"
                     /db_xref="GeneID:6020493"
                     /translation="MVIQNLSGVKKLITAKSYFSGAGGLDLGIIEAGIDVIESFEIDK
                     KACNTLRNNFKHIINETDITKITVLDQQDADVYIGTFPCTKYSNIADIHGTRTGDDLF
                     LHFFRHVALAQPEAYVIENVPGMKKFQVVMECLTKLPNYYVRVECPVNANMWLPQERK
                     RLIVIGTKRPFNNLDYPESTPIKMRDIIDVGTEVYTPKYVQKRLEGHYRDKPIITDLD
                     GIAPTCVAHYSKDRSTRLINDGVKIRPYSVREWARLQGFPDWFKFDGTDNDAYKMIGN
                     AVPVNMGLWVGKQLKKYFAG"
     misc_feature    complement(110706..111545)
                     /locus_tag="Bsph_p123"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dcm; COG0270"
                     /db_xref="CDD:223348"
     misc_feature    complement(110718..111539)
                     /locus_tag="Bsph_p123"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(111348..111350,111354..111356,
                     111402..111413,111465..111476,111522..111539))
                     /locus_tag="Bsph_p123"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(110766..110768,110916..110921,
                     110925..110930,111021..111023,111027..111029,
                     111111..111113,111117..111119,111225..111230,
                     111234..111236,111306..111308,111324..111335,
                     111342..111347,111354..111356))
                     /locus_tag="Bsph_p123"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(110766..110768,111111..111113,
                     111117..111119,111228..111230,111234..111236,
                     111333..111335,111345..111347,111354..111356))
                     /locus_tag="Bsph_p123"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            complement(111776..112036)
                     /locus_tag="Bsph_p124"
                     /db_xref="GeneID:6020492"
     CDS             complement(111776..112036)
                     /locus_tag="Bsph_p124"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695713.1"
                     /db_xref="GI:169825538"
                     /db_xref="GeneID:6020492"
                     /translation="MLVLLILNDNKTIESIFEGYDEWLLIGNEPQRKDVDEYTERYDL
                     AGNRTCLYCSSRLPEDHPLTVCDSCYPDEDQTIESDLEGYDE"
     gene            complement(112087..112344)
                     /locus_tag="Bsph_p125"
                     /db_xref="GeneID:6020491"
     CDS             complement(112087..112344)
                     /locus_tag="Bsph_p125"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695714.1"
                     /db_xref="GI:169825539"
                     /db_xref="GeneID:6020491"
                     /translation="MNLKTAANWKWSLHQYLQVGDIVDDEIYSHFVNVLPPATFKQSL
                     VQMGEPYCHVEGQPTYPTLQKTEHGWKYMGNCFRGEVVNKD"
     gene            complement(112513..113445)
                     /locus_tag="Bsph_p126"
                     /db_xref="GeneID:6020488"
     CDS             complement(112513..113445)
                     /locus_tag="Bsph_p126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695715.1"
                     /db_xref="GI:169825540"
                     /db_xref="GeneID:6020488"
                     /translation="MIHLLFGTEDFLIAEKKKEICRVEGVSISSFDMRETSLTSALED
                     AQMSDLFGGKKIVFLNDSYFLTGDTSKKITHDTDALLDYLESPNPDSTVVLVVNNEKL
                     DKRKKVVKELLQKATTTFEAKPLYNAEKWLVERCKVYGKTLTRQAAVIMQQQLGKDLF
                     LLDTELTKLVLAVDNPTISEKDLEGVLSRTLEGDVFKIVDHVIYKRSEALEILDDLFR
                     LGHDSIQILLILAGQFRLIHQVKAIHELGESPKNILKGIHPYRLSMAEEQCQLYSIED
                     LQQRLKDCAELDLQMKRGYCDKVIGLETLILKWL"
     misc_feature    complement(112519..113442)
                     /locus_tag="Bsph_p126"
                     /note="DNA polymerase III subunit delta; Reviewed; Region:
                     holA; PRK05574"
                     /db_xref="CDD:235511"
     misc_feature    complement(112933..113439)
                     /locus_tag="Bsph_p126"
                     /note="DNA polymerase III, delta subunit; Region:
                     DNA_pol3_delta; pfam06144"
                     /db_xref="CDD:218910"
     gene            complement(114009..114197)
                     /locus_tag="Bsph_p127"
                     /db_xref="GeneID:6020486"
     CDS             complement(114009..114197)
                     /locus_tag="Bsph_p127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695716.1"
                     /db_xref="GI:169825541"
                     /db_xref="GeneID:6020486"
                     /translation="MTENQRFELAVLLEKYSLINGMLVNGSTEQKKQAKKELQLLQNE
                     VSPFLTPELIHAAQLELS"
     gene            complement(114213..114665)
                     /locus_tag="Bsph_p128"
                     /db_xref="GeneID:6020482"
     CDS             complement(114213..114665)
                     /locus_tag="Bsph_p128"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695717.1"
                     /db_xref="GI:169825542"
                     /db_xref="GeneID:6020482"
                     /translation="MEMMDMANMIQIAETLKYQAEIFNVTYEEAWHKYLHPGIRDKHP
                     LAEILPHIKKLEQETTSNILIRSKKNQRKLEASHDTYRFECIPDKNGYKLKIYKDEKH
                     FYSHGLLVPSPKAATTVIRRVTKLPKLELDWIDNISRRKIRVKPAYLN"
     gene            complement(114722..115453)
                     /locus_tag="Bsph_p129"
                     /db_xref="GeneID:6020480"
     CDS             complement(114722..115453)
                     /locus_tag="Bsph_p129"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695718.1"
                     /db_xref="GI:169825543"
                     /db_xref="GeneID:6020480"
                     /translation="MKDLNKAVGFTLKDMVSMFWFSATKERAMFVEEIHGAFMDAFPG
                     RNVSYDYVARIAKSLEKQDLLTVKRDQNKKFYRVTEAGIERLKRYSGLYKERTLEVYQ
                     VVQRIEYHLTRSGDGPIPITHELPQEYRTFLAKLFSIKDLTRYLFLYYGQTKSQFYAA
                     EIEHLSKEMFGWSPSNPYVHKIAAELEADGAIKGDWAEPVKRTVRFLKLTEDGKVFFK
                     QIEQDLTDQIKNIKKFLALLILFFE"
     gene            115721..116569
                     /locus_tag="Bsph_p130"
                     /db_xref="GeneID:6020479"
     CDS             115721..116569
                     /locus_tag="Bsph_p130"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA ligase-like protein"
                     /protein_id="YP_001695719.1"
                     /db_xref="GI:169825544"
                     /db_xref="GeneID:6020479"
                     /translation="MLVATGIEIINTEDWLYQVKWDGWRVLIHKAGDRIEAFTREGNN
                     ITAKFPELEEVGHSITVDTAIIDTEGVVLRQGISVFEDFSYRGILTNKEKIKEATITH
                     PVTFVAFDILTTDKKLMHHPLFERKEHLSSIITPSNSLQVTPSVDGDGSNIFEITKDK
                     GMEGIIGKKRDSIYQLNHRSKNWLKYKHFKIIETVILAYRENPFSILVGTELESGRYK
                     RLATVEFGFKPEEKMAFRHIAKSVITTVDRDLIWLEPRLYCKVQYLEKTNSGLLRTVS
                     FKGFIF"
     misc_feature    115721..116563
                     /locus_tag="Bsph_p130"
                     /note="ATP-dependent DNA ligase; Reviewed; Region: ligB;
                     PRK07636"
                     /db_xref="CDD:236070"
     misc_feature    115721..116287
                     /locus_tag="Bsph_p130"
                     /note="Adenylation domain of Mycobacterium tuberculosis
                     LigD and LigC-like ATP-dependent DNA ligases; Region:
                     Adenylation_DNA_ligase_LigD_LigC; cd07906"
                     /db_xref="CDD:185715"
     misc_feature    order(115772..115783,115787..115795,115838..115840,
                     115925..115927,115958..115960,116045..116047,
                     116207..116209,116216..116218,116222..116224,
                     116267..116269,116273..116275)
                     /locus_tag="Bsph_p130"
                     /note="active site"
                     /db_xref="CDD:185715"
     misc_feature    order(115778..115780,115787..115795,115835..115843,
                     115847..115849,115853..115855,115958..115963,
                     115970..115978,116207..116209,116273..116275,
                     116279..116281)
                     /locus_tag="Bsph_p130"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:185715"
     misc_feature    116297..116560
                     /locus_tag="Bsph_p130"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain of ATP-dependent DNA ligase LigD is a
                     DNA-binding module that is part of the catalytic core
                     unit; Region: OBF_DNA_ligase_LigD; cd07971"
                     /db_xref="CDD:153440"
     misc_feature    order(116330..116332,116375..116377,116381..116386,
                     116396..116407,116531..116533,116537..116542,
                     116546..116548)
                     /locus_tag="Bsph_p130"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:153440"
     gene            116722..117939
                     /locus_tag="Bsph_p131"
                     /db_xref="GeneID:6020477"
     CDS             116722..117939
                     /locus_tag="Bsph_p131"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer region-like protein"
                     /protein_id="YP_001695720.1"
                     /db_xref="GI:169825545"
                     /db_xref="GeneID:6020477"
                     /translation="MSKNKSLFVVGLAAVVMTPTLTVCMDVDAATIKFKDVPSSHWAF
                     KAITEVAKKGLVTGYTDGTYKPSAQVTRAEFATFLSRVFDSKERQTSNFKDVENSHWA
                     SDAIQEGLAVGFIKASDFSNNKFEPNKPMTRGEMSRWLANGLAHVNADYGKAIEEMAN
                     SSLTIIPIPEFYRGGVSKTDLPYIGVALGTGLLSGYEDFTFKANGNTTRAEVATILIR
                     FMDVMKKATTDFTGLSELREVANTGTNILTITNYRVRFGEYKDVLGKPHTYLNNTGVG
                     TIERAIFVDTAGPKAKGIFKDMFFNEVDNQIVLNRNIYSLFYEYTLTPSKDVSFFSIG
                     NGSDMQFAGVQKVDRQKSMLFGITTPKDSDEKIFKKGEKYKYWAENRASNKAGNLLNG
                     RTDDDSKFGYAIP"
     misc_feature    116818..116949
                     /locus_tag="Bsph_p131"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    116995..117129
                     /locus_tag="Bsph_p131"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    <117265..117360
                     /locus_tag="Bsph_p131"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     gene            complement(118057..118509)
                     /locus_tag="Bsph_p132"
                     /db_xref="GeneID:6020476"
     CDS             complement(118057..118509)
                     /locus_tag="Bsph_p132"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695721.1"
                     /db_xref="GI:169825546"
                     /db_xref="GeneID:6020476"
                     /translation="MVLQMEKLKLTYIGTDEWSRPVFESEEGRIFKDLNCGDGQLDLC
                     TAGSFDGEPDTPIHYIEKYKNVEFIILGMEEQPSAEEKFNYMMLSRLQSDCDYYLGHG
                     DRNGKNLWAGNVSEQIVKMKELYNSFNDDKKPEWITLDDILEYENKMT"
     gene            complement(118625..119239)
                     /gene="radC"
                     /locus_tag="Bsph_p133"
                     /db_xref="GeneID:6020473"
     CDS             complement(118625..119239)
                     /gene="radC"
                     /locus_tag="Bsph_p133"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein radC-like protein"
                     /protein_id="YP_001695722.1"
                     /db_xref="GI:169825547"
                     /db_xref="GeneID:6020473"
                     /translation="MEEIYERIEANNGEITEVPALIQAIIGRKKDISTNLKVLDLFDM
                     TIVELQDIGLSRKEALRIRAVKGLLKIMNSERQGKVKSISNASEAAEYVMDEMKNLKQ
                     EHFVCLFLDTRSRVIKKETIFIGSLNSSIASPREIMRLALKYSAAGIICLHNHCSGDS
                     EPSMQDLEVTRRLFEAGDLMGVELIDHIVIGNNEFTSIRENNLL"
     misc_feature    complement(118643..118981)
                     /gene="radC"
                     /locus_tag="Bsph_p133"
                     /note="Mov34/MPN/PAD-1 family; Region: MPN_DUF2466;
                     cd08071"
                     /db_xref="CDD:163702"
     misc_feature    complement(order(118742..118744,118751..118753,
                     118775..118777,118781..118783,118931..118933))
                     /gene="radC"
                     /locus_tag="Bsph_p133"
                     /note="MPN+ (JAMM) motif; other site"
                     /db_xref="CDD:163702"
     misc_feature    complement(order(118742..118744,118775..118777,
                     118781..118783))
                     /gene="radC"
                     /locus_tag="Bsph_p133"
                     /note="Zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:163702"
     gene            complement(119428..119682)
                     /locus_tag="Bsph_p134"
                     /db_xref="GeneID:6020471"
     CDS             complement(119428..119682)
                     /locus_tag="Bsph_p134"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695723.1"
                     /db_xref="GI:169825548"
                     /db_xref="GeneID:6020471"
                     /translation="MKGVCKEAPVNSNLVIDEEYYLTPHGSQGYLVSRFPSPLSHFGA
                     YQKKYFKVIENEVENTLESKEDDKNQDYVQHLEQLDLFSF"
     gene            complement(119710..120315)
                     /locus_tag="Bsph_p135"
                     /db_xref="GeneID:6020467"
     CDS             complement(119710..120315)
                     /locus_tag="Bsph_p135"
                     /EC_number="3.1.31.1"
                     /codon_start=1
                     /transl_table=11
                     /product="thermonuclease precursor"
                     /protein_id="YP_001695724.1"
                     /db_xref="GI:169825549"
                     /db_xref="GeneID:6020467"
                     /translation="MLLVLTLTACSSYDNLLEEPLQAKQETAAVSIEINPKINDKVNA
                     TSNLDEIAVKYVSAYDADTYTFQLINSNDRSKIKSLSKNNKNTIKVRALLVDASEIKG
                     KDGKPEPFAIEARDAARELLEQADSISLFYDIGARTDHYDRNLMYVKVDGILLSIPLL
                     EKGLLQIAYVKPPNTKYLSEYEKAQEIAKAKNIGLWSLNYK"
     misc_feature    complement(119725..120210)
                     /locus_tag="Bsph_p135"
                     /note="Micrococcal nuclease (thermonuclease) homologs [DNA
                     replication, recombination, and repair]; Region: COG1525"
                     /db_xref="CDD:224442"
     misc_feature    complement(119725..120048)
                     /locus_tag="Bsph_p135"
                     /note="Staphylococcal nuclease homologue; Region: SNase;
                     pfam00565"
                     /db_xref="CDD:201310"
     misc_feature    complement(order(119887..119889,119893..119898,
                     120019..120021,120028..120030,120046..120048))
                     /locus_tag="Bsph_p135"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            complement(120348..120590)
                     /locus_tag="Bsph_p136"
                     /db_xref="GeneID:6020465"
     CDS             complement(120348..120590)
                     /locus_tag="Bsph_p136"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695725.1"
                     /db_xref="GI:169825550"
                     /db_xref="GeneID:6020465"
                     /translation="MVKQIIVMNGGLIQNIISEGDIDVTIVDYDTEGADVGELMKVNE
                     DDAYVFSPQVEVNIDEVNEILTIIEKARAVSEVASE"
     misc_feature    complement(120435..>120584)
                     /locus_tag="Bsph_p136"
                     /note="Periplasmic glycine betaine/choline-binding
                     (lipo)protein of an ABC-type transport system
                     (osmoprotectant binding protein) [Cell envelope
                     biogenesis, outer membrane]; Region: OpuBC; COG1732"
                     /db_xref="CDD:224646"
     gene            complement(120696..120962)
                     /locus_tag="Bsph_p137"
                     /db_xref="GeneID:6020464"
     CDS             complement(120696..120962)
                     /locus_tag="Bsph_p137"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695726.1"
                     /db_xref="GI:169825551"
                     /db_xref="GeneID:6020464"
                     /translation="MQTNTDNHVTIIEDIIKKIENYKNASDTLATALYQLAALKSPEY
                     FKVSDFVQRLETCCLTYDEHRIINELSSYLEDFSMSLKQIEKNK"
     gene            complement(120983..121666)
                     /locus_tag="Bsph_p138"
                     /db_xref="GeneID:6020463"
     CDS             complement(120983..121666)
                     /locus_tag="Bsph_p138"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695727.1"
                     /db_xref="GI:169825552"
                     /db_xref="GeneID:6020463"
                     /translation="MIVILDCYGSPKYNQNPLKPVGNALKEVIEVTSIEEAIKCAKKY
                     INKHRLRNGNWKGGLVYTNDSETYLGAITFYGGFVSNETDFGRFALSHYHSVIQLNAR
                     HQVTLQNKENENPPTLDRNESIRKAVASNLKDLLLIRKVSQNELSNGTKIAKTTIADY
                     VRGTTLIKLENLEKIARFLNIEPAYIDPTLGGAKPITKESLIEKINELFDNNELIHVD
                     DARLKTIWY"
     misc_feature    complement(121109..121282)
                     /locus_tag="Bsph_p138"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(121181..121183,121256..121258,
                     121268..121270))
                     /locus_tag="Bsph_p138"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(121184..121186,121259..121261))
                     /locus_tag="Bsph_p138"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(121178..121183,121193..121195,
                     121202..121204,121235..121240))
                     /locus_tag="Bsph_p138"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(121683..121841)
                     /locus_tag="Bsph_p139"
                     /db_xref="GeneID:6020462"
     CDS             complement(121683..121841)
                     /locus_tag="Bsph_p139"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695728.1"
                     /db_xref="GI:169825553"
                     /db_xref="GeneID:6020462"
                     /translation="MIPTQILQNEQHAEAETRVLAFYGNVNSHYLTNYMELQQDQQEQ
                     NENHINQD"
     gene            122893..123480
                     /locus_tag="Bsph_p140"
                     /db_xref="GeneID:6020461"
     CDS             122893..123480
                     /locus_tag="Bsph_p140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695729.1"
                     /db_xref="GI:169825554"
                     /db_xref="GeneID:6020461"
                     /translation="MTTATLTSKGQLTVPKEIREFLKIDTGDTIEFVTDPKTNSVTIS
                     KKGKLCPTCNGSAILESNNLPCFVCNESGYINLDNGIIPYIMMGIPNRKYKINVSITN
                     QKIDDTNRIQFNIMPKIELISEEYSRELLDSIQDTLQIMIIEEFSPKSVSSEELFKMP
                     SDILLEEILDLVTTKTAKEKVNLWFRYERTPFNKN"
     misc_feature    122893..>123036
                     /locus_tag="Bsph_p140"
                     /note="Regulators of stationary/sporulation gene
                     expression [Transcription]; Region: AbrB; COG2002"
                     /db_xref="CDD:224913"
     misc_feature    122902..123036
                     /locus_tag="Bsph_p140"
                     /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
                     smart00966"
                     /db_xref="CDD:198034"
     gene            complement(123551..123697)
                     /locus_tag="Bsph_p141"
                     /db_xref="GeneID:6020460"
     CDS             complement(123551..123697)
                     /locus_tag="Bsph_p141"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695730.1"
                     /db_xref="GI:169825555"
                     /db_xref="GeneID:6020460"
                     /translation="MVIIIETERWLIIMINEKKKRVLEEIRKENEKYSFPKKKKDNIG
                     KNKK"
     gene            123794..124438
                     /locus_tag="Bsph_p142"
                     /db_xref="GeneID:6020459"
     CDS             123794..124438
                     /locus_tag="Bsph_p142"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695731.1"
                     /db_xref="GI:169825556"
                     /db_xref="GeneID:6020459"
                     /translation="MEVSSDMKEKRKKRKDAKVDYKPTVPIPLKTSIERLSAITGIVV
                     KDIADHLVVSALNSVEVISYISKCFQRDLRFNNTLYFGNSENPTVTKRHPAGTTDRVS
                     LRVSQNTDHLIGSIAYALRCTPHTACAALIEQAMLNYDIVNDFIRNYLINGLDEDRLN
                     ELQKVMNYINSMDNTFEYSWADLLSLIAREVNAPITSPNEMVDEFIINNWRDNR"
     gene            complement(124476..124787)
                     /locus_tag="Bsph_p143"
                     /db_xref="GeneID:6020457"
     CDS             complement(124476..124787)
                     /locus_tag="Bsph_p143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695732.1"
                     /db_xref="GI:169825557"
                     /db_xref="GeneID:6020457"
                     /translation="MVPEHLQLLREWKKSVNAEPPRKLSEWELDEIQENISRAAADKM
                     HVKLTVWEEGNYKEYNGVINKIIPYKRELVLITLSSTKFLSFDQIYSAKTESNFDISE
                     I"
     misc_feature    complement(124512..124781)
                     /locus_tag="Bsph_p143"
                     /note="YolD-like protein; Region: YolD; pfam08863"
                     /db_xref="CDD:220046"
     gene            124938..126302
                     /locus_tag="Bsph_p144"
                     /db_xref="GeneID:6020456"
     CDS             124938..126302
                     /locus_tag="Bsph_p144"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="YP_001695733.1"
                     /db_xref="GI:169825558"
                     /db_xref="GeneID:6020456"
                     /translation="MGGKYHYKLRPEALGKDSPPLIVFDINNKPFRPLTEFYQYELGR
                     LSNKTAISYLQSLLPFFNWIQQYGYYQGRKVIWTDVPDSIRAVVRTYLIDNMNCKVQE
                     HYNGTFNFVHLTHKSPSTVRHFLSALKSFYNSMIQKKLYHFQNPFIDFSYKLLNEMES
                     AIELQINNRTRMPDIAGTEEPKNYRRVTNSYYKIVGDTWIPNIIDDNSLPSQILSGGE
                     KIHWKLRDQVIARLLFETGARASEVIEVTIGDYRRRPSVREMNTFSKGSYKKRVKFLY
                     FTDDTAILLRRYIEGERKVYDKNKLGFTELPDEAPLFLTERGTPYTYQAWYPNWCKAC
                     ISAKLKVNPHKTRHWYVTQTLRFIYETSKNEADIQLHIRELISYMNWKSKETITVYEH
                     YFDLKKHLETQEQFFVKMEKETENYLRNKKIVHKENLTSSKLNSIKEPPIKDPLENFL
                     LGLE"
     misc_feature    125034..125981
                     /locus_tag="Bsph_p144"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    125592..126113
                     /locus_tag="Bsph_p144"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(125652..125657,125730..125732,125964..125969,
                     126105..126107)
                     /locus_tag="Bsph_p144"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(125652..125654,125730..125732,125967..125969,
                     125976..125978,126078..126080,126105..126107)
                     /locus_tag="Bsph_p144"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(125652..125654,125967..125969,125976..125978,
                     126078..126080,126105..126107)
                     /locus_tag="Bsph_p144"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(125652..125654,125976..125978,126105..126107)
                     /locus_tag="Bsph_p144"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            126311..128458
                     /locus_tag="Bsph_p145"
                     /db_xref="GeneID:6020453"
     CDS             126311..128458
                     /locus_tag="Bsph_p145"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="YP_001695734.1"
                     /db_xref="GI:169825559"
                     /db_xref="GeneID:6020453"
                     /translation="MNILEQSNSEKKYWHKKFHGKIHEDILNLTNDIDWGFVHEDIID
                     YFEKYCIGYVWTNHLALIMLARSGYSRNSVNTVRGILGVLNVRFQSLFKELSIQTINH
                     WNPDIHLYEYLNKKILPEHTENQRFDLLKSYNSSISSVLNWLNSKFDLCTQEIFKPFL
                     LNRCNITHTISNQKKVLQLSQSHRKNETDAIIPHYPVIRGEAHFRWNKIHRLFTKFKE
                     LTAKVTPTTSLPLEFDYDEEQTRERLFFRIWDRPSFTIAHKDCYSRYSIDLAKNRRKT
                     YSNENNEFFLEFVNVESLDGNKCIEGLWFEDLISESVLNQLPATGSKEQKERKKKFLL
                     SWGYGDSDTDSIPMPFRTSVKGLLAQGDYICHAQNHTDCVLLKIETLYAAATFGLALV
                     DLITTTGMRINEVLQISYTKDCIIVLNQPDNPNKLEKRYILRLIPKGRDQPEDYFIGK
                     ETLNNLFKVFGFLKEHYNNNHIPKVKYRATRRHLFPEEKPYFFQYNYKHFTDDSVTAC
                     MRFLLHGMVFKTPEGDNVVLKAHLLRHAFATHAVQVEKIPLDIVGSWLHQKNIEVTDY
                     YSAPTPSQVAQRADAWLKYTATHINITEAVKRSPEELKLMYEEAKNKVGTLNKVIGGI
                     CTSHSFCPSKFQCVGCAAKVPESDKKNELLKMKEWAQKSGNDWRSMGLLPEVNRMNQV
                     IRDCDKELHEIELMEAYKKDENYKPEVRIKPIK"
     misc_feature    127478..128011
                     /locus_tag="Bsph_p145"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(127511..127516,127622..127624,127898..127903,
                     128009..128011)
                     /locus_tag="Bsph_p145"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(127511..127513,127622..127624,127901..127903,
                     127910..127912,127982..127984,128009..128011)
                     /locus_tag="Bsph_p145"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(127511..127513,127901..127903,127910..127912,
                     127982..127984,128009..128011)
                     /locus_tag="Bsph_p145"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(127511..127513,127910..127912,128009..128011)
                     /locus_tag="Bsph_p145"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            128694..128915
                     /locus_tag="Bsph_p146"
                     /db_xref="GeneID:6020450"
     CDS             128694..128915
                     /locus_tag="Bsph_p146"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695735.1"
                     /db_xref="GI:169825560"
                     /db_xref="GeneID:6020450"
                     /translation="MNRSKQQRKNKKPISTENFENIKPNRNLVALQNRYKNLTKEDLI
                     SRLIGAEEYIVENNQKWLYKQFIDYPIEF"
     gene            130767..131843
                     /locus_tag="Bsph_p147"
                     /db_xref="GeneID:6020447"
     CDS             130767..131843
                     /locus_tag="Bsph_p147"
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="YP_001695736.1"
                     /db_xref="GI:169825561"
                     /db_xref="GeneID:6020447"
                     /translation="MKKVLQPIHVYCLLFLSVSFLAHFVLIPSIFTVVEREAWISALL
                     SLIPIFLLALFISRITSSLNNSSILELKTVQNNKTLYVFIIYIYIVYLMSSTFVSLKF
                     TIIWAEESFNSDYPYFITVILFILLCFYGSLKGLKTIAIQSLIICSLYIFLFVLLNLG
                     NSMNNEYELLLPVNTSNTPSIYWGILYICIGILEMGFILIVLNGYVKEKLKRKGILIF
                     SILFVLFVLIAIVTAVSEFGIYLTQKMLFPINEQWRVLSFGKYFTRLDSLSVLQLLSM
                     AFIRICLFMYIVSSFFKNRKFILIVGYLCLTIGLLIPWSVSDFLSFIKSAYLLSIFLF
                     LFFFMIVFYVVEKKQKGVHHLDRK"
     gene            131830..133230
                     /locus_tag="Bsph_p148"
                     /db_xref="GeneID:6020446"
     CDS             131830..133230
                     /locus_tag="Bsph_p148"
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="YP_001695737.1"
                     /db_xref="GI:169825562"
                     /db_xref="GeneID:6020446"
                     /translation="MTENKDFLYKELGHQSDITISSKFYMFNNEKHEVIFVYCHSLVD
                     SVLFLNSLLPNIRFLAEHGHLHDVEIINRYLEVFEIKEYRTKTDEMNSKIFSGFLYFF
                     HVPSNSLYSTNLAKLPERSIEESNMEVSLRGPRDGFVENIDTNFSLIRMRLKSKNLSS
                     NDFTIGDTSKTKVLLLYIENYIDQNTLKNVQSKLNKIKVDNIASSYHIEELLYDKLPL
                     FPLLDYSGRPDFVVSSLNKGRFVILVDGSPSCLIGPVNLLLILKAAEDDQTNFLFVSL
                     SRILRITSLLTSIFLPGLWIALTVHQLNQLPFPLLVSISASKIGLPVSSSFEILIMLI
                     FFDLFREAGIRLPKAVGQTVAVLGGLIVGDAAIRAGFTSPSTLVIGALTVISSYTLIN
                     QNVLGNVFLIRVATLIIASFFGMYGFILSLLFFLTYISSLESFGHPYLSTFYKVSIPN
                     FIKGFFKMPFRIKIKD"
     misc_feature    131839..133224
                     /locus_tag="Bsph_p148"
                     /note="Bacillus/Clostridium GerA spore germination
                     protein; Region: GerA; pfam03323"
                     /db_xref="CDD:190601"
     gene            133260..134381
                     /locus_tag="Bsph_p149"
                     /db_xref="GeneID:6020444"
     CDS             133260..134381
                     /locus_tag="Bsph_p149"
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein XC precursor"
                     /protein_id="YP_001695738.1"
                     /db_xref="GI:169825563"
                     /db_xref="GeneID:6020444"
                     /translation="MSHYYNCTFKITFIFPLLFILGGCLGTKEIQSEVYITALGIDYS
                     NDVYHLYFQAYGFTNVAGSDPSTEPAPIVVGHGEGETIQGAIDDIEKNSVNPLYYGHI
                     QTFFISKNILDGHLDEFFDFFSRDYYLRYNTLAYGYEEDDIKEILNVHGLFYKPPILT
                     FPYDPNEQLFFNSFISTSTVQDMIKRYYEPVGSIMVPTIKISEDYWMEDNKSKNILKI
                     SGAYFLSRQEFNGWIKEEELSGLDWFNKDFNNMKLLIKDKSVSMFIETIDYHIEIVDN
                     SIPKYIINLDIKASIRENPKNIGKETIENEIKNIILSQFQNTFSKGLEINSDVFNFSE
                     KAYRFKPQSWTVDKLNSITEHSIKKFNIHVFIKDEGAKK"
     misc_feature    133281..134378
                     /locus_tag="Bsph_p149"
                     /note="germination protein, Ger(x)C family; Region:
                     spore_ger_x_C; TIGR02887"
                     /db_xref="CDD:234048"
     misc_feature    133911..134369
                     /locus_tag="Bsph_p149"
                     /note="Spore germination B3/ GerAC like, C-terminal;
                     Region: Spore_GerAC; pfam05504"
                     /db_xref="CDD:218615"
     gene            complement(134614..135072)
                     /locus_tag="Bsph_p150"
                     /db_xref="GeneID:6020443"
     CDS             complement(134614..135072)
                     /locus_tag="Bsph_p150"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS904"
                     /protein_id="YP_001695739.1"
                     /db_xref="GI:169825564"
                     /db_xref="GeneID:6020443"
                     /translation="MAVIVSDLTYVRVGTKRHYVCLFVVLFNREIIGRSAGANKTAEL
                     VYQALVSIRGNLNDIQMFHTDRGKEFDNKLISKALETFGIQRSLSMKGCPYDNAVAEA
                     MFKVFKTEFANGAHLSTLEQLALELDDYVHWFNNIRIHGTLGYLTPVEFK"
     misc_feature    complement(134740..135066)
                     /locus_tag="Bsph_p150"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:216050"
     misc_feature    complement(134629..134826)
                     /locus_tag="Bsph_p150"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:222316"
     gene            complement(135097..135408)
                     /locus_tag="Bsph_p151"
                     /db_xref="GeneID:6020442"
     CDS             complement(135097..135408)
                     /locus_tag="Bsph_p151"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_001695740.1"
                     /db_xref="GI:169825565"
                     /db_xref="GeneID:6020442"
                     /translation="MCDVLDIPKSTYYYHADVCGKRALKTEDNEISKEIARIFKESRN
                     NYGTRKIKEELSKLPDPKHVSRRRIGRLMKGLGLVSNYTVAQYKVHHSTCNEAPIKNE
                     L"
     misc_feature    complement(135169..135330)
                     /locus_tag="Bsph_p151"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:222019"
     gene            complement(135987..136403)
                     /locus_tag="Bsph_p152"
                     /db_xref="GeneID:6020440"
     CDS             complement(135987..136403)
                     /locus_tag="Bsph_p152"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695741.1"
                     /db_xref="GI:169825566"
                     /db_xref="GeneID:6020440"
                     /translation="MKLNMILSVISIFLLLTLSACSQDEKEYNFYGTSNNWVVKYDTE
                     ISEGKEWADFSFEYIGEEDAPAIFGYNLKSKWFELTSKEERFNHQDKNINSGNSECTG
                     PPINNESCAVIIEEDEQMEAKIEWNGKSEVILLNRK"
     gene            complement(136672..136989)
                     /locus_tag="Bsph_p153"
                     /db_xref="GeneID:6020437"
     CDS             complement(136672..136989)
                     /locus_tag="Bsph_p153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695742.1"
                     /db_xref="GI:169825567"
                     /db_xref="GeneID:6020437"
                     /translation="MNELKKVVFRTIEIISLLAIGLLFTVYVLKPIYEGFGINFMGNV
                     WVNWFGVSYILFVMYTLIAALFLFKKSILFKQRLTSVFFWLIFIGANYVVFIPFIKGE
                     NPF"
     misc_feature    complement(<136825..136965)
                     /locus_tag="Bsph_p153"
                     /note="cellulose synthase A; Region: PLN02195"
                     /db_xref="CDD:215124"
     gene            complement(137505..138617)
                     /locus_tag="Bsph_p154"
                     /db_xref="GeneID:6020436"
     CDS             complement(137505..138617)
                     /locus_tag="Bsph_p154"
                     /note="similar to 41.9 kDa insecticidal toxin of strains
                     1593/2362/2317.3"
                     /codon_start=1
                     /transl_table=11
                     /product="insecticidal toxin"
                     /protein_id="YP_001695743.1"
                     /db_xref="GI:169825568"
                     /db_xref="GeneID:6020436"
                     /translation="MRNLDFIDSFIPTEGKYIRVMDFYNSEYPFCIHAPSAPNGDIMT
                     EICSRENNQYFIFFPTDDGRVIIANRHNGSVFTGEATSVVSDIYTGSPLQFFREVKRT
                     MATYYLAIQNPESATDVRALEPHSHELPSRLYYTNNIENNSNILISNKEQIYLTLPSL
                     PENEQYPKTPVLSGIDDIGPNQSEKSIIGSTLIPCIMVSDFISLGERMKTTPYYYVKH
                     TQYWQSMWSALFPPGSKETKTEKSGITDTSQISMTDGINVSIGADFGLRFGNKTFGIK
                     GGFTYDTKTQITNTSQLLIETTYTREYTNTENFPVRYTGYVLASEFTLHRSDGTQVNT
                     IPWVALNDNYTTIARYPHFASEPLLGNTKIITDDQN"
     misc_feature    complement(137562..138146)
                     /locus_tag="Bsph_p154"
                     /note="Insecticidal Crystal Toxin, P42; Region: Toxin_10;
                     pfam05431"
                     /db_xref="CDD:253194"
     gene            complement(138789..140135)
                     /locus_tag="Bsph_p155"
                     /db_xref="GeneID:6020435"
     CDS             complement(138789..140135)
                     /locus_tag="Bsph_p155"
                     /note="similar to larvicidal toxin 51 kDa protein of
                     strains 1593/2362"
                     /codon_start=1
                     /transl_table=11
                     /product="larvicidal toxin 51 kDa protein"
                     /protein_id="YP_001695744.1"
                     /db_xref="GI:169825569"
                     /db_xref="GeneID:6020435"
                     /translation="MCDSKDNSGVSEKCGKKFTNYPLNTTPTSLNYNLPEISKKFYNL
                     KNKYSRNGYGLSKTEFPSSIENCPSNEYSIMYDNKDPRFLIRFLLDDGRYIIADRDDG
                     EVFDEAPTYLDNNNHPIISRHYTGEERQKFEQVGSGDYITGEQFFQFYTQNKTRVLSN
                     CRALDSRTILLSTAKIFPIYPPASETQLTAFVNSSFYAAAIPQLPQTSLLENIPEPTS
                     LDDSGVLPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQI
                     IPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMLFYFRSSGFKEQITRGLNRPL
                     SQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRLAGI
                     QSYPNAPITNPLTLTKHTIIRCENSYDGHIFKTPLIFKNGEVIVKTNEELIPKINQ"
     misc_feature    complement(138945..139532)
                     /locus_tag="Bsph_p155"
                     /note="Insecticidal Crystal Toxin, P42; Region: Toxin_10;
                     pfam05431"
                     /db_xref="CDD:218589"
     gene            complement(140581..141111)
                     /locus_tag="Bsph_p156"
                     /db_xref="GeneID:6020434"
     CDS             complement(140581..141111)
                     /locus_tag="Bsph_p156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695745.1"
                     /db_xref="GI:169825570"
                     /db_xref="GeneID:6020434"
                     /translation="MNTNHDRFEELHTSQEELLHQSAGKESHKIPFCCVISIPYGFEV
                     ISNYQPKIMYHLGCLATVEETCRKTVQVDDCGNAEVDLHVLKAKGCIPFIANIVVKPT
                     CEQKGCSAKPHIKEIAISCQNSVCVDLILNCSVDSSQHIHLNCNNVVVCDLQMTPIKE
                     ACQHVKIKGNFQFLSV"
     misc_feature    complement(140584..141057)
                     /locus_tag="Bsph_p156"
                     /note="CryBP1 protein; Region: CryBP1; pfam07029"
                     /db_xref="CDD:148570"
     gene            complement(141706..142719)
                     /locus_tag="Bsph_p157"
                     /db_xref="GeneID:6020433"
     CDS             complement(141706..142719)
                     /locus_tag="Bsph_p157"
                     /codon_start=1
                     /transl_table=11
                     /product="Mtx2/3 toxin-like protein"
                     /protein_id="YP_001695746.1"
                     /db_xref="GI:169825571"
                     /db_xref="GeneID:6020433"
                     /translation="MEGERDMRSKTLRNALIIGMVFITLGGTTTINPSQTYAESNSMQ
                     EKNIGITNVNQVLEKIGSYYYQRNLSLTWYEAPNSIGVNHDFQLRKNPDSISSEVDLS
                     ISGEEIESLYYDSTIPKFLGENIFENNTNQEQTYNTSKFSETYTESTSTSVSKGFKIN
                     VGRDFTIPLILNEGGKINLEYNSGSTNTNTLSKTYTLEAPSQPVKVPPNKIYKAVVEY
                     SQRTYKGTVKFYGRNTHNPYPINTIKTTGSYTGWMGMQEIKQFTFNDPLYKHYDGLSD
                     SQKKEVENDGVVIIPFLGATFVVVEGKGSFEGVYGAKLNVKTYDVTDQNKVKLVDSRS
                     IDL"
     misc_feature    complement(<142024..>142254)
                     /locus_tag="Bsph_p157"
                     /note="Clostridium epsilon toxin ETX/Bacillus
                     mosquitocidal toxin MTX2; Region: ETX_MTX2; pfam03318"
                     /db_xref="CDD:217490"
     gene            complement(143294..150463)
                     /locus_tag="Bsph_p158"
                     /db_xref="GeneID:6020431"
     CDS             complement(143294..150463)
                     /locus_tag="Bsph_p158"
                     /note="Includes: ATP-dependent proline adenylase (ProA)
                     (Proline activase); ATP-dependent valine adenylase (ValA)
                     (Valine activase); ATP-dependent ornithine adenylase
                     (OrnA) (Ornithine activase); ATP-dependent leucine
                     adenylase (LeuA) (Leucine activase)"
                     /codon_start=1
                     /transl_table=11
                     /product="gramicidin S synthetase 2 (gramicidin S
                     synthetase II)"
                     /protein_id="YP_001695747.1"
                     /db_xref="GI:169825572"
                     /db_xref="GeneID:6020431"
                     /translation="MLFHHIIFDGWSLGLLLCDLELAYSLDTTVETEKNTHEIWMFEN
                     LLHKHLNYIGTVKYLESGEYWRTKLEGTLSRSAFPTSKAKSLIKTYQGGALRYPIRPA
                     LSNLIEQFSKVNQVSSYRVWLSIYIVLLNQMTNQTDLLIGMPINTRSRDEEDLEVFGY
                     FVNTVPLRIAFSPTDTFLEVVQKVSYSVKEAIEHRNYPLNHITQQFINQNENNPSLYS
                     TVFNMIKLPNLRMEDLETGVITHHNRVSIFDMVWRLVQSQSDTITIEVDYNAGMYEEN
                     DIQNFIERFEHLLKILLENSDISMCNLNLLLPQDYDVYQNTVVVKNVPPLTLDQLIDE
                     QADIYPDCIAITMGQQNITYQELRVLSNKVALTLLNQGFQKQNRVSIILNRSIEAVVS
                     MIGVLKAGGTYVPVDPDFPEDRIRFMLQDSESTHIITSQKFSLHNFHQYQKVILYEDM
                     SKQTFLEQVKRTHATEDGAYIIYTSGSTGSPKGVLIPHKGVIHLIKSIKDKYHFQKDQ
                     VHIQFASLIFDASVWEIYSSLLTGGRLHILSEIERKSCKHFIEAIEKQQVNFCLLPTV
                     FFHTLSQAPIYELDRLNSLNYVFVGGESLLPETVRKWQEKVGLKIPIVNAYGPTESTV
                     CVATYPIINKVNETQANIPIGKPLSHTEIYILNEQNQICPPYVPGEIYIGGDGLAQQY
                     VNQPVKTKEAFVTVNLPTSSNARLYKSGDQGRITQDGQVEFLGRKDKQVKIRGYRIEL
                     EEIEEQMLQHPSIEHATVIVYQNKSSDQQLMAFYILQKGDNVNADDLQAYLSEKLPYF
                     MLPSYMQDIEKFPLTPSGKIDSDSLQKQAESVLENRTHRYTPPHTDTELQLQNIWAEV
                     LRMESEQISIDDDFFTIGGHSLLTVQVINRIHARFHVQISLKDLYIYRTIHTCAEYID
                     QFNQIDSEDVIQLIPDQTHYPLSHAQKRLWFLYKRYPEDRTYDIPIQVQIQPGIQIHI
                     LNKALCEIVKRHEIFRTVFREKQGEPGQHIQEELNVKAIHVNITNIKKGKQAGYRLKC
                     IQQIDSKGFDLEKGPLFRSILFTENEDCSWLYLNFHHIVMDEWSLQLFLKELFEIYDE
                     LLLNKIVYHTKPVVRYVEYVAWQSKHLSLGTWELEEQYWKQEFQNSHHPQLSLPYDRL
                     SSNPLNRGAVLSKKIDQIHLTGLKKIAQQEDVSLFILLFTAYTQFLQQICGQNDLVIG
                     TPVSGRQHTAFEDVQGFFVNTVAIRINTTGASTMQELCEIVKEKCFLAFQHQNYPFDK
                     VIEVVNPERKEHDNPIFQTMFSYQQNSSQLFSLHRLDIQPVKQTISKFNLSLTFVESE
                     DGLIMDLEYNTDLFERTTISRFAEQLWQIIQMIQTDFTTSFGQLSMLSDTDKAIYQKL
                     NDTCMALPPYSSIQERFYQQVYRTPKTIAISTEDSSYTYEEVNHYSNQIAHYLIEKGM
                     QPNDVTAIFLDRSFESIVCMLGVLKAGCTYVPIDIKYPSDRVSYIFNDSKAKLILTKE
                     ALKKKIQTYNEQVFLIEDIFASSSIKDILSKNRVDDTAYMIYTSGSTGNPKGTLLRHA
                     GVLNLVEWRSKTFCITEQDVLSQFYSHSFDSSVSEIFSALLTGARLHLLNEEQRISSQ
                     AYFDAVATYNITISDVATAFFKQLANEVSFKHRSPLQSLRVLIMGGEAASAEAIRNWH
                     SEMSDTVQIVNEYGPTETTVSSLYHVVSTKVESTVTHIPIGKPIANTKVYILNENMQL
                     CPIGVIGELYIESIGTAIGYVNQPEITKLSFLSNPFSANNHSILYKTGDLARLSLNGN
                     VEYMGRRDRQVKIRGYRIELGEIEDVLMQEPRIQQSVVLPDAEGKELHAYYTVHKQTE
                     ISIEEVYKHVSTTLPEYMVPKGYVCIPEIPVTQNGKIDAQKLIGKYQIQYQKNKNHQA
                     PVTETQKILANVWAEVLNKKDINIKDDFFSLGGHSLKIMPTLVKLKPYFPKLRIQDFF
                     QYPTIEKMAKKIEKDAIQLQNNIVATVEMHKNENNTNLDKHENNKNWDNLIQVTQQKP
                     RCVLLTGGTGFLGAHILEQLLLLPDTLIYCLVRNQKQESLEIKVQEKMKFYFGESILE
                     KMKHRVKVIEGDLSQESLGLTPNIKKELIQEIDTIIHCGGEVRHYGDREHFIRVNVKS
                     TQFLIDMSKEARARFHYISTISISGHAPHDNEKILFYERDFDKGQQLDNVYVESKFLA
                     EKLVRKAIKEGVSATVYRVGNLVGHTLDGRFQENIEENAFYRLIKAILLLQMAPDIRT
                     CIDLVPIDFGSKAIVQLVCTMETEGETFHIINPVQLEWKQFIEYVIQMGHPIKIVNTE
                     QFMNLFKDNTLSEKQKYALELIVPLLEETAKNSLSIPTCKDTQRFLQEVGVLCELPNA
                     KFVSNLIDYGYRIGFFSISTEYTKI"
     misc_feature    complement(149957..>150457)
                     /locus_tag="Bsph_p158"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:216052"
     misc_feature    complement(148211..150163)
                     /locus_tag="Bsph_p158"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    complement(149621..149887)
                     /locus_tag="Bsph_p158"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:222359"
     misc_feature    complement(147995..149446)
                     /locus_tag="Bsph_p158"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(149018..149023,149027..149044,
                     149051..149053))
                     /locus_tag="Bsph_p158"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(148013..148015,148286..148288,
                     148295..148297,148331..148333,148532..148534,
                     148604..148621,148685..148690,149039..149044))
                     /locus_tag="Bsph_p158"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(147725..147922)
                     /locus_tag="Bsph_p158"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:215989"
     misc_feature    complement(146771..147676)
                     /locus_tag="Bsph_p158"
                     /note="Condensation domain; Region: Condensation;
                     pfam00668"
                     /db_xref="CDD:216052"
     misc_feature    complement(145019..146983)
                     /locus_tag="Bsph_p158"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    complement(146438..146701)
                     /locus_tag="Bsph_p158"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:222359"
     misc_feature    complement(144812..146257)
                     /locus_tag="Bsph_p158"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(145829..145834,145838..145855,
                     145862..145864))
                     /locus_tag="Bsph_p158"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(144830..144832,145094..145096,
                     145103..145105,145139..145141,145340..145342,
                     145412..145429,145493..145498,145850..145855))
                     /locus_tag="Bsph_p158"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(144554..144739)
                     /locus_tag="Bsph_p158"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:215989"
     misc_feature    complement(143327..144409)
                     /locus_tag="Bsph_p158"
                     /note="thioester reductase domain; Region:
                     Thioester-redct; TIGR01746"
                     /db_xref="CDD:233557"
     misc_feature    complement(143540..144409)
                     /locus_tag="Bsph_p158"
                     /note="extended (e) SDRs, subgroup 1; Region: SDR_e1;
                     cd05235"
                     /db_xref="CDD:187546"
     misc_feature    complement(order(143828..143839,143903..143905,
                     143915..143917,144008..144016,144080..144082,
                     144122..144130,144314..144322,144380..144391,
                     144395..144397))
                     /locus_tag="Bsph_p158"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187546"
     misc_feature    complement(order(143903..143905,143915..143917,
                     144008..144010,144077..144079))
                     /locus_tag="Bsph_p158"
                     /note="active site"
                     /db_xref="CDD:187546"
     misc_feature    complement(order(143744..143746,143777..143779,
                     143831..143833,143915..143917,144008..144010))
                     /locus_tag="Bsph_p158"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187546"
     gene            151773..152012
                     /locus_tag="Bsph_p159"
                     /db_xref="GeneID:6020430"
     CDS             151773..152012
                     /locus_tag="Bsph_p159"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695748.1"
                     /db_xref="GI:169825573"
                     /db_xref="GeneID:6020430"
                     /translation="MENGFQKYETLDEVLLNTVNQKSNIQQYSERSSYSTRGRKPISD
                     EKIELIKKLHLKGLSIRSIASIVRVGLGTVQKYRK"
     gene            152048..152710
                     /locus_tag="Bsph_p160"
                     /db_xref="GeneID:6020429"
     CDS             152048..152710
                     /locus_tag="Bsph_p160"
                     /codon_start=1
                     /transl_table=11
                     /product="chitin-binding protein"
                     /protein_id="YP_001695749.1"
                     /db_xref="GI:169825574"
                     /db_xref="GeneID:6020429"
                     /translation="MMNTKFSKLSKKGLSAALLAAGIIGISTAPNTYAHGFVEKPASR
                     AALCTQNYGALNLMCGSIMYEPQSLEAPKGFPQSGPLDGKIASAGGLFGGILDQQTAD
                     RWHKNTITGGPNTFTWKYTAPHSTSKWHYYITKRDWNPNKPLTRADLEPIGTVAHNGT
                     AASTNLTHTINVPTDRNGYHVILAVWDVADTSNAFYNVIDINLINNGIYVDMEAPSQP
                     NG"
     misc_feature    152150..152653
                     /locus_tag="Bsph_p160"
                     /note="Chitin binding domain; Region: Chitin_bind_3;
                     pfam03067"
                     /db_xref="CDD:217350"
     gene            complement(152847..153062)
                     /locus_tag="Bsph_p161"
                     /db_xref="GeneID:6020428"
     CDS             complement(152847..153062)
                     /locus_tag="Bsph_p161"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695750.1"
                     /db_xref="GI:169825575"
                     /db_xref="GeneID:6020428"
                     /translation="MGKLTKIERMRQAASDARYARRHRDLQIAMNEILFILSEGTRYE
                     NDVKEAFDILEEYEIEIRAGRMGNRIF"
     gene            complement(153101..153349)
                     /locus_tag="Bsph_p162"
                     /db_xref="GeneID:6020427"
     CDS             complement(153101..153349)
                     /locus_tag="Bsph_p162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695751.1"
                     /db_xref="GI:169825576"
                     /db_xref="GeneID:6020427"
                     /translation="MLDWLEKSNEELLNEAMEIYKEENNEQDLGNYVCHICFKPNHYF
                     LTTSSPVGDGYGHSINICDCCGRKIGELAEQLSQLKEK"
     gene            154164..154349
                     /locus_tag="Bsph_p163"
                     /db_xref="GeneID:6020424"
     CDS             154164..154349
                     /locus_tag="Bsph_p163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695752.1"
                     /db_xref="GI:169825577"
                     /db_xref="GeneID:6020424"
                     /translation="MHDSHVLHPLVERVSQNVKKALAVAADAVYKTPAIMNFLLENRI
                     TIFKNNEREKNDKRNRV"
     gene            complement(154551..154892)
                     /locus_tag="Bsph_p164"
                     /db_xref="GeneID:6020423"
     CDS             complement(154551..154892)
                     /locus_tag="Bsph_p164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695753.1"
                     /db_xref="GI:169825578"
                     /db_xref="GeneID:6020423"
                     /translation="MINGEARSVLHEFIKLDMAIRSLQQDYSSLEKLKMSKIYINIVE
                     GLLKSIRKDFHDKRRVLIKKNIAVVKWVKIDEYFSDVVIKTAGEDAVLRYANQALKTQ
                     VEELINSRLNK"
     gene            complement(154885..155223)
                     /locus_tag="Bsph_p165"
                     /db_xref="GeneID:6020421"
     CDS             complement(154885..155223)
                     /locus_tag="Bsph_p165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695754.1"
                     /db_xref="GI:169825579"
                     /db_xref="GeneID:6020421"
                     /translation="MIHDRGSMKWTVMMLPEHLDLIRVLRQEQFYDKKRELTEWELEE
                     IEHTIQYAFKMQKLITLMLWNDNNLRDETGLVTGTDTVKKELLIDTDVAIKRIAFDKI
                     QDAKMVDFDD"
     misc_feature    complement(154909..155181)
                     /locus_tag="Bsph_p165"
                     /note="YolD-like protein; Region: YolD; pfam08863"
                     /db_xref="CDD:220046"
     gene            complement(155469..155819)
                     /locus_tag="Bsph_p168"
                     /db_xref="GeneID:6020418"
     CDS             complement(155469..155819)
                     /locus_tag="Bsph_p168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695755.1"
                     /db_xref="GI:169825580"
                     /db_xref="GeneID:6020418"
                     /translation="MIKADERKLLHKYLLLELAIKSLQVDYEKLEQFKMNKVFIPMMD
                     KLLNNLRQDFFNLKRELAQKHIRAVGWQPIDEYFSDIQVATAGNDVVLRYANQALKSQ
                     VEKLLTKYITNGKC"
     gene            complement(155812..155985)
                     /locus_tag="Bsph_p169"
                     /db_xref="GeneID:6020417"
     CDS             complement(155812..155985)
                     /locus_tag="Bsph_p169"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695756.1"
                     /db_xref="GI:169825581"
                     /db_xref="GeneID:6020417"
                     /translation="MGIYDLHDHLGRLSEYKKSVQKRVGLTGWKVEEILITIEQNFNQ
                     QYSFIPLFWYLHD"
     gene            complement(156481..156978)
                     /locus_tag="Bsph_p170"
                     /db_xref="GeneID:6020415"
     CDS             complement(156481..156978)
                     /locus_tag="Bsph_p170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695757.1"
                     /db_xref="GI:169825582"
                     /db_xref="GeneID:6020415"
                     /translation="MRGKGASKMYKSIKEWLFSYTYTKYLVKLNKYKENTIALPISDQ
                     LAIINLIKELGAKKCCLELYQKPKTESWVINMAELDITKTGIIEYKNPSTRLKFELDF
                     KKYEHATISLANSKTIVFELSDSISKKLLYIKLKITLPVSLDELIEESKGLAREERLS
                     KNKVH"
     gene            complement(157040..157219)
                     /locus_tag="Bsph_p171"
                     /db_xref="GeneID:6020413"
     CDS             complement(157040..157219)
                     /locus_tag="Bsph_p171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695758.1"
                     /db_xref="GI:169825583"
                     /db_xref="GeneID:6020413"
                     /translation="MAPVKTLPFRIVIKPRTVKVGEQIKFEENMVRISSIKEIEFLPG
                     GYVAVKGQCREVNVL"
     gene            complement(157349..157588)
                     /locus_tag="Bsph_p172"
                     /db_xref="GeneID:6020412"
     CDS             complement(157349..157588)
                     /locus_tag="Bsph_p172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695759.1"
                     /db_xref="GI:169825584"
                     /db_xref="GeneID:6020412"
                     /translation="MAMKKVSGFILNFTDEEFGGIRNFFVVFILMNWIFQFFINIKIG
                     ESLASAFGHSFFYALPLILTFAVVYVYIKKFIRND"
     gene            complement(157704..160817)
                     /locus_tag="Bsph_p173"
                     /db_xref="GeneID:6020411"
     CDS             complement(157704..160817)
                     /locus_tag="Bsph_p173"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695760.1"
                     /db_xref="GI:169825585"
                     /db_xref="GeneID:6020411"
                     /translation="MKLFKKDTIGIVSFFAIFVFWLNLGGLISVSAERIEVTSDRVPI
                     NPAVHWWQLDDGSFRAKNFNGEINTGFVGDRDESARPARKEIFNRLNLHDYPTPTVFK
                     ASNGKTYPASEVKGIEALNPEWDEKSNGSNYSGVNKTITMGHYLEITVITGNGFYPSD
                     VEVYGYNEDKLPKLNVVYPVKMYVEWKGYIETDEPETPNPGGGSCSIVYSLGPDGGSK
                     TKNLVQPSPSGSISSDSGEFDVVKGIPSSEYLRADAQSEEYLYDQDFTQRTGNTEFNN
                     IPVSKTFTLTWRTRHKDSDGDYYYVDHSDTETVDVSVSGIKRPFSYWEIKKYSIWKLL
                     NSHFTNYALPGGEHTINANTDVTADGSHSEPVESHVFPPDCPDITLPSESIDGGSSRP
                     NVPDIIGEATAAAEAAIGDNEVENDRAEFKGTVIMDNSRTTTNGPTPNDVPDPGMIDM
                     TSRGLLIDPQKTNYFQSPSTGKVNYGPVFSIDGSATALNFPFDVNVVTVHTPVVIYSK
                     ASDDKEHDQRTKPPLRSTPTDPDKDRHAFILDRPFTVTMPTSGQHRNIPGYGNRDYAK
                     YIKQKQVKFPFDVYTKTKQGYYPANTWVNVPVDMETVEFFMPVWVPEGEYTINFRSFA
                     INALGSGDFGGSEHHANVTIPNPSFNVPPAGSLSAAHVATDSIEVDVVGRLYDFRITD
                     VLDYNWFDVFRDERNQHTGNYYWVGKNGIDGDLRGNQSPFVLPVRHGSHPDSYDANGE
                     LKYYKNLGVKKGYQFKFDFKTKGTMYDMKDAIRITPTFYFVDKDGKNRRPVDVYYHMD
                     NKKFVQVGSKDDQEVRNVVLNEPLRNVEEKQLINNSKFYYSRVAGDNVDKESDYYKAF
                     KEYAELGLSEREFIRKYFKDYSKKNVITGTYGWQILNWRLRTAIGPTDAPTNTMIPSS
                     DVVASEQQWHSEYSLPSKLYVVEKGTNVTTYAAQNKMNDNAPIFLKDGYIIVNFNIES
                     IQNGDLDNPHLQYINAPMMNQWKLEGYQSSFTDGYNYVFNLNDGDVIFYQGNQSSDDD
                     FKSTVTH"
     gene            complement(160833..162041)
                     /locus_tag="Bsph_p174"
                     /db_xref="GeneID:6020407"
     CDS             complement(160833..162041)
                     /locus_tag="Bsph_p174"
                     /codon_start=1
                     /transl_table=11
                     /product="surface layer-like protein"
                     /protein_id="YP_001695761.1"
                     /db_xref="GI:169825586"
                     /db_xref="GeneID:6020407"
                     /translation="MAALTATLTTASVVVPVTTEAATTKFKDVPSSHWAFKAITEVAQ
                     KGLVTGYADGTYKPSAQVTRAEFATFLARVFDSKERIPAKFTDVGSSHWANDAIQEGL
                     AVGFIKNSDFTNNKFEPNKAMTRAEMSRWLANGLAHANADYGKAVEEMANSSLTLIPI
                     PEFYKGGVNKQDLPYIGLALGTGLLGGYEDFSFKPSGNTTRAEVATILIRFMDVMKKA
                     PSEFTGLNELREVSKTGTNILTLTRYEQSPMKFGGYEDVLGKQHTYLNNTGIVTIEHA
                     IFVDTTGSKPVGIYKDMFFNPKSEDTIFLNKNIYKLYYEYTFVPSRDISLQSVSNGSH
                     MHYASSLLVNKSKIEQFNLSSPKNTSKNEFIKGEKYRYWAQNGAMNQTGETIDGLADD
                     GSRFYYVIPK"
     misc_feature    complement(161838..161969)
                     /locus_tag="Bsph_p174"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    complement(161658..161792)
                     /locus_tag="Bsph_p174"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     gene            complement(162352..162804)
                     /locus_tag="Bsph_p175"
                     /db_xref="GeneID:6020406"
     CDS             complement(162352..162804)
                     /locus_tag="Bsph_p175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695762.1"
                     /db_xref="GI:169825587"
                     /db_xref="GeneID:6020406"
                     /translation="MRYKKKGMEIKMFYKKLDLITEATKSNTVKEVCYVSRIFKQNVY
                     TDSNGDLEVDDQEIDVNLHLDIPVHTFESFINALLELRKDFDVACAYSKEPLTHENSN
                     KENIVADKSYTFTYWNSVHNNVLHSNNKQANVFIYLNEFERYANLIVY"
     gene            complement(163117..164094)
                     /locus_tag="Bsph_p176"
                     /db_xref="GeneID:6020405"
     CDS             complement(163117..164094)
                     /locus_tag="Bsph_p176"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695763.1"
                     /db_xref="GI:169825588"
                     /db_xref="GeneID:6020405"
                     /translation="MKLGNFVLLFVAIFFVFMISQQIRFDEVKNVNDQKKTFDTYLTT
                     ASQDAITTLSNNANPSFEHYYLSDKYSAVNKEESYNAFVRTLNRNFEIHDKISEDVIA
                     QHIPLFAILEYDGLSINKFQVYKKSGLTYSKRIWMPKIPFTYTDASGNIFRFTLDDYI
                     QVYDQYNDEWFEGFVDEVAKEANVLLLKDKKKLEIIRKRTIVETLQSHFAEVIAEHNK
                     FAMKQGITYTFALPVIDDETWYNSIDDIGIYTFFQGYPYFKIDKMYNHYAFVGARIKK
                     NERIIGSTQDGRKIFYEENCNFSYPKEEVFSTKAEAAKAGYSEKSCLNK"
     gene            complement(164081..164611)
                     /locus_tag="Bsph_p177"
                     /db_xref="GeneID:6020404"
     CDS             complement(164081..164611)
                     /locus_tag="Bsph_p177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695764.1"
                     /db_xref="GI:169825589"
                     /db_xref="GeneID:6020404"
                     /translation="MEKMPVLLLAGIFAVIVMLLFPAQHTFQRQDELVEEKVELETTK
                     LVDSIRTKGYISADMLNRFHSQIGLSNYLFKVEIIHEKKIYVPVYSDPNNPNTYTGDY
                     EIHYENSYTKEINDYIYNKKKRYELSADDFITIRVQNMVRTNASILKDVLTFNFTDDT
                     PEIFVQYGGMILNEAR"
     gene            complement(164626..165003)
                     /locus_tag="Bsph_p178"
                     /db_xref="GeneID:6020400"
     CDS             complement(164626..165003)
                     /locus_tag="Bsph_p178"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695765.1"
                     /db_xref="GI:169825590"
                     /db_xref="GeneID:6020400"
                     /translation="MSEPIKEMFELAVASFLFTSALFQLFYSQDLFFKGTEGLPTTET
                     VYFNSHEVKTPTSYWTGAQIVLFLKEADLEETPVQVGGVLFERENQVEQLWKSINPKD
                     LFTMVPKIENGDKVARIQFTLAN"
     gene            complement(165051..165518)
                     /locus_tag="Bsph_p179"
                     /db_xref="GeneID:6020397"
     CDS             complement(165051..165518)
                     /locus_tag="Bsph_p179"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695766.1"
                     /db_xref="GI:169825591"
                     /db_xref="GeneID:6020397"
                     /translation="MESPVVKAIILAVTIFMIGGVVAYSIWNYNTGTDATKAANNRLG
                     NSITQMEEQTYAMYDNIEIKGSEVINAVKNFKEDGEAGKIGIKIVTGENVAGTWYYNS
                     FNSSKLTAVSTDISKLHDSSSGNIYFVNPNGIFKGTLQRDTNNTIRAIIFNQK"
     gene            complement(165617..167656)
                     /locus_tag="Bsph_p180"
                     /db_xref="GeneID:6020396"
     CDS             complement(165617..167656)
                     /locus_tag="Bsph_p180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695767.1"
                     /db_xref="GI:169825592"
                     /db_xref="GeneID:6020396"
                     /translation="MLIAIISLAVVSVGSAVAFIIYEKNKKKQIGLPKKKISNKNFNK
                     FYQKFYLLSSRFRLTNNILLRVRKKVETLAVYDEYSLRRQVAQTMVTIISVILVIILA
                     LMVIRPGWLISFWIMVGLVFATDLMIDFFIVRIEKKLLPQIKEFLKRLRYFYAQTHMI
                     DEASFESINYTGSEMKVQAQRIHNTLTSVNPEEEQLKYEEVAPNRFLKVISGLMVLVK
                     EKGDVIDPENERGSAFTRGIAAITKELNLEIMYRSKLAYRLRFLAPLTLIPIIFALPI
                     QSAIVYLFPIMSRFYESRIGFLGAIFIYAFSIGMYFVIRKIKDVSDVSYQTKLNKIQW
                     EKRLYEKFKIVRLIVKIFSPNYKTVSYAKKSQLIKDANEPLEVEWLTLRQLVLSVITL
                     IILVSGMLYAHKSESQSALYNIIPSSMMTSNVSDEEYEEFKKTTDFDREMIMKLQSAS
                     EFTADGIMQTIANQMGIDEVENPKVKQAYDRIMEKYTIVENAYFKWWELLIILLIVFG
                     IWYIPEILLQLQKNLRRKDMENEVHQFLTIISILREFNSIGVLTLLVWLERFSVTFKE
                     PLQKCILNFDSGPEEALEELSNDISFEAFQQIVERLKLSISRLSVKEAFEDIELEREF
                     YLEQREEYNTRSISNRGDFAYLASVSPVATLLILHVLVPIIYISTTHLQSMMTGF"
     gene            complement(167650..169509)
                     /locus_tag="Bsph_p181"
                     /db_xref="GeneID:6020395"
     CDS             complement(167650..169509)
                     /locus_tag="Bsph_p181"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_001695768.1"
                     /db_xref="GI:169825593"
                     /db_xref="GeneID:6020395"
                     /translation="MTGEFLNFTLIFLVIAVVITLFVFRIVFAKRVEEKEAYEKEVYS
                     FANLFEFVKQDIEKAITKNINNLGLAHDDMERNRRILNTLRDALRSCNTGDDSSKRYV
                     IEYICDSLSKQYNFTEDNVNYVFTFNSPGQLTARDKFDISLFVLRRKYGKNALSKMID
                     EFKLAEPRKSGGYYIEDEDINQVYKVYGKQITLKDKIQIIAERIYAHYKGYGIIDMVR
                     DMNIDGVSGGVSGMPSRMENIDDDEAFKLSLNKQKNSGLNCAWIMYKGKSIHLRFMAF
                     EHEAELIRVVQVSYRYKFPGQLSESNPFIINEGFDGSRVTVACPPFAESWVFFIRKKF
                     SSKSLELNQIVTHNNAELAMQLLIFLIKGNRTTAFTGAQGSGKTTLLIALIKYIHESL
                     NLRIQETAFELNLRMIYNLRNILSFQETDKITGQMGMDFSKKTDGHVNILGEVATPPV
                     ASSMIQAGHLSLFTLLTHHAKTTDNLIFDVANSLKKEGIYNDDRSAQLAVVQVLEFNV
                     HLTQLYDGTRFVERITQIIPIEPVESDLQSRIAKNKDEKDELLLDLQIEYYKQNTQVK
                     PFITRNIIEFKNGRYEVAEPITAEKQKEMLERMSEEEGQQFKNLMKLWGEQAC"
     misc_feature    complement(<168298..>168618)
                     /locus_tag="Bsph_p181"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:247787"
     misc_feature    complement(<168007..168402)
                     /locus_tag="Bsph_p181"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:247787"
     misc_feature    complement(order(168376..168384,168394..168399))
                     /locus_tag="Bsph_p181"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(168178..168183,168376..168384,
                     168394..168396))
                     /locus_tag="Bsph_p181"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(168181..168195)
                     /locus_tag="Bsph_p181"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(169512..170291)
                     /locus_tag="Bsph_p182"
                     /db_xref="GeneID:6020388"
     CDS             complement(169512..170291)
                     /locus_tag="Bsph_p182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695769.1"
                     /db_xref="GI:169825594"
                     /db_xref="GeneID:6020388"
                     /translation="MGQLIASWSPIQGKSGVTTNTAVLATLAAITKPYASLLINASNN
                     PNVLEKYVKDNKSNDPVISEGISGLKRLLNSNLLTPDSLPDYAENIIYNKLDLILGSE
                     LDEVQVTKLLQSAVSAYEYVWVDIKTGDNSTGELILEQADLVLVHLPQSLYDIENVLP
                     DIKNKLKIANKTFFIIGNYDNNANLTVKNIKRILKVKNSFHCISYSSTLKNAFNNNTL
                     PEFLLKISKQEPFTNNTKFVQGAINIIDDMLLTLSNDRKGW"
     gene            complement(170308..171033)
                     /locus_tag="Bsph_p183"
                     /db_xref="GeneID:6020387"
     CDS             complement(170308..171033)
                     /locus_tag="Bsph_p183"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695770.1"
                     /db_xref="GI:169825595"
                     /db_xref="GeneID:6020387"
                     /translation="MSQNQIQILFFGSKNKSDTLLYLGGMLRNLGKKVLISDMTAVDL
                     YKHSYSLDENLDLLDFDGVDVLLNIPNRSKIDQQLLSSEESLESYDVVLYDVDSLDVL
                     QSNLWSEIDANYYVGDFDLMHQKLDAQMIDYLAKTYTNRLRRVTFETSYQISLDAIEA
                     YITEEIQWTSMNFLFENDEAQEGNRVRMQHENIIPLKGLSNQHRKMLTEVISHMFELP
                     NSDIEIANKRFRWFPNLKQKVTS"
     gene            complement(171039..171989)
                     /locus_tag="Bsph_p184"
                     /db_xref="GeneID:6020386"
     CDS             complement(171039..171989)
                     /locus_tag="Bsph_p184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695771.1"
                     /db_xref="GI:169825596"
                     /db_xref="GeneID:6020386"
                     /translation="MKIRFVTKKLIIAASLGAAAMLLISGVAFYFLYKSNVEKQEELR
                     QNYKDKLAELEYTTEQSELVYTLNTDVDKGQLIHKSMVQPSLVPKNAVPADAMTDVQF
                     GASKYYAKANYKMSQPVAESLFYIGENLTKDIRSVEYAAIELPSRIQKDEYVDVRIQF
                     PTGEDFIVFSKKKVVDTQGLTLWLENDEGEIQSMSSAMVDAYLNAGKLYALRYVDGET
                     QEKAEITYPVNKAVLERIKVDPNIVDIAKLNLEKQNREALELNLQALDKAKAEELRSK
                     ESQQKSLKEQEDKERLLNSVNEDANAELDPSGVINEEYGE"
     misc_feature    complement(<171687..171800)
                     /locus_tag="Bsph_p184"
                     /note="Domains similar to fish antifreeze type III
                     protein; Region: SAF; cl00555"
                     /db_xref="CDD:241945"
     gene            complement(172006..173508)
                     /locus_tag="Bsph_p185"
                     /db_xref="GeneID:6020543"
     CDS             complement(172006..173508)
                     /locus_tag="Bsph_p185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695772.1"
                     /db_xref="GI:169825597"
                     /db_xref="GeneID:6020543"
                     /translation="MCAFLLFKFIFLKGGEKMKLILASYNVPFMKKIGVDFEGQGGEI
                     VAYVSSEEDLINELMKHPDVKGVLIQSNLAKKHNDMRLDYLVDLLIGIKAEKKFKDIN
                     FTILSEVQKGHPFLAELVEMGIYNIYCINQKNIKVEHLYQSFVQPTSFSEAIHFRNVD
                     STIPWRRNIQTARTVELKFQSENQEVVPEKPPSKLRGAFKAISDKVGKREVNTGEMVH
                     EEDTDTSSKQEQDKEIVNEEPIEDLIVSEEEIKEDPKTSKVWNLKKNSETPKFKPIGT
                     MLISVCGVEEHLGSTTAAISIAKYLVEQNYNVALVEGNYSQDFDRIHALSEGEKAAIL
                     KEDAFKLKGIPHFKYRSEMDLDKILTSYDYVVLDLGRLSDSPLENEFGRAHIKYVICS
                     GDEWKKHWIDSFNREYGHYEGINYLVPGAHEKAIEDLRIHIKNDDCLPFPTLDSPYKL
                     SEDDCIAISTILSECVETSKKSKNYEKLKTRLLVATSMLVIILGYYVLFN"
     misc_feature    complement(172378..172677)
                     /locus_tag="Bsph_p185"
                     /note="AAA domain; Region: AAA_31; pfam13614"
                     /db_xref="CDD:222264"
     gene            complement(173585..174520)
                     /locus_tag="Bsph_p186"
                     /db_xref="GeneID:6020537"
     CDS             complement(173585..174520)
                     /locus_tag="Bsph_p186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695773.1"
                     /db_xref="GI:169825598"
                     /db_xref="GeneID:6020537"
                     /translation="MEDTAQFDIKIGENEVCEFKWGYLNFMDARLAILSKDSNPKLVN
                     YLKTELKKRNSQILHISSKDNVEWIADTWSIKDFEGIPSEEVTSLFAQHRNKWVQLYL
                     DYICWAHKENRYNLIKAAAYEAHKEGPLFAYIKGLETVENEKHREILTEAFKKLENVN
                     WKRSNEGFHFVLDTTCPVKFVESLIIGVWSAWIFTVCIDEPLHITHLVELELDKLFNL
                     PLTLDNEERAFIERAMYLLSQLTYDYLCSTISVTPTLFPAVEMQCEHIIADHTDIIDF
                     DLYSHLGALHGNEFIWKYKEEYRKLNFTLEHITAK"
     gene            complement(174535..175401)
                     /locus_tag="Bsph_p187"
                     /db_xref="GeneID:6020508"
     CDS             complement(174535..175401)
                     /locus_tag="Bsph_p187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695774.1"
                     /db_xref="GI:169825599"
                     /db_xref="GeneID:6020508"
                     /translation="MNKVEIHDKIQEIRSVFGRDELYLKIQRDFDLDELLNPEDEFYE
                     KLTFDEYYKTKEAAAMLGIADKSQQILNHLNNPNLADYIKATQSTDRRYRLTWQPLFR
                     LKMLFYLFDKNFKPNDVAILLGATAMYVPPTNEAPKSSVNHSSNIDLDKFKDDLVEFE
                     KHQQQEMMKMFNAINERNQVLLEQAKAESKMELIIQQLDDLSNVEKQYEILLNILEES
                     EKAEPIKLKSIFKWMQISDEKTDYNKQKIDINSQLNQIKTKREELQSNLKDVKEKITL
                     CTNKMDRIGNTN"
     misc_feature    complement(<174577..>174945)
                     /locus_tag="Bsph_p187"
                     /note="Chromosome segregation ATPases [Cell division and
                     chromosome partitioning]; Region: Smc; COG1196"
                     /db_xref="CDD:224117"
     gene            complement(175692..176969)
                     /gene="repX"
                     /locus_tag="Bsph_p188"
                     /db_xref="GeneID:6020432"
     CDS             complement(175692..176969)
                     /gene="repX"
                     /locus_tag="Bsph_p188"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication protein"
                     /protein_id="YP_001695775.1"
                     /db_xref="GI:169825600"
                     /db_xref="GeneID:6020432"
                     /translation="MEQKLSLNFGFLGLGMGGTSIAAACADIKTNIKNNNYPYTALLI
                     NSNQIDLNKIEPANTTSEKMLIGDGKGAGRDILIGEQLYENDQEDIKQRVETRFKEVD
                     YVWLVAGLGGGTGTGAVIQAIGTLLKSGFNGRFGMILTLPRLKEGRTVIENALQRLQK
                     ISQAMGKLGPILLVDNEKLFKQFSEEKPNSSVSEYLRFSNKYVAEALHDLNTVTASYL
                     PTGEYHFDSSEFEKLLKTPGLLHFARFTEKASSIDSSNNLSYAQKLKELIQKGVLSDG
                     YNLEEAQRLAVSVLTDNATAKRMFTFEFTKRMEDLVNELSPTALEKPIATYQSKDIKG
                     PAEVSFYAVFAGLGLPQARISEMVTEHNRLKELEQKVLETEKKDLFASFDASPTPKKE
                     EKTNDLEALFGSDTEKEKGKDDVEDTLELLKLL"
     gene            complement(177021..177341)
                     /locus_tag="Bsph_p189"
                     /db_xref="GeneID:6020514"
     CDS             complement(177021..177341)
                     /locus_tag="Bsph_p189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695776.1"
                     /db_xref="GI:169825601"
                     /db_xref="GeneID:6020514"
                     /translation="MNLLEEMFFEMLAENLSNESKWFLVILEQESPNLVNKELLWEKV
                     NDLYSKAKKSEESLIKSRYVLDIHTARLEGAGLVKVERIGQIRMYSITAIGLKLLKYL
                     KSKD"
CONTIG      join(CP000818.1:1..177642)
//
DBGET integrated database retrieval system