GenomeNet

Database: RefSeq
Entry: NC_010381
LinkDB: NC_010381
Original site: NC_010381 
LOCUS       NC_010381             177642 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Lysinibacillus sphaericus C3-41 plasmid pBsph, complete sequence.
ACCESSION   NC_010381
VERSION     NC_010381.1  GI:169825414
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604328
            Assembly: GCF_000017965.1
KEYWORDS    RefSeq.
SOURCE      Lysinibacillus sphaericus C3-41
  ORGANISM  Lysinibacillus sphaericus C3-41
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae;
            Lysinibacillus.
REFERENCE   1  (bases 1 to 177642)
  AUTHORS   Hu,X., Fan,W., Han,B., Liu,H., Zheng,D., Li,Q., Dong,W., Yan,J.,
            Gao,M., Berry,C. and Yuan,Z.
  TITLE     Complete genome sequence of the mosquitocidal bacterium Bacillus
            sphaericus C3-41 and comparison with those of closely related
            Bacillus species
  JOURNAL   J. Bacteriol. 190 (8), 2892-2902 (2008)
   PUBMED   18296527
REFERENCE   2  (bases 1 to 177642)
  AUTHORS   Yuan,Z., Hu,X., Zheng,D., Yan,J. and Cai,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2007) State Key Laboratory of Virology, Wuhan
            Institute of Virology, Chinese Academy of Sciences, Wuchang
            Xiaohongshan Zhongqu 44, Wuhan, Hubei 430071, P.R.China
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Bacillus sphaericus C3-41 is available from Wuhan Institute of
            Virology, Chinese Academy of Sciences. Email address: yzm@wh.iov.cn
            DNA used for sequencing was isolated from B. sphaericus C3-41
            following standard protocols.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 01/21/2015 18:31:54
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 457180)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,668
            CDS                          :: 4,248
            Pseudo Genes                 :: 304
            CRISPR Arrays                :: 1
            rRNAs                        :: 31 ( 5S, 16S, 23S )
            tRNAs                        :: 85
            ncRNA                        :: 0
            Frameshifted Genes           :: 269
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..177642
                     /organism="Lysinibacillus sphaericus C3-41"
                     /mol_type="genomic DNA"
                     /strain="C3-41"
                     /db_xref="taxon:444177"
                     /plasmid="pBsph"
     gene            439..1674
                     /locus_tag="BSPH_RS22445"
                     /old_locus_tag="Bsph_p001"
                     /db_xref="GeneID:6020534"
     CDS             439..1674
                     /locus_tag="BSPH_RS22445"
                     /old_locus_tag="Bsph_p001"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291638.1"
                     /db_xref="GI:501248620"
                     /db_xref="GeneID:6020534"
                     /translation="MFLERITERQEEILVYLFKVRGATVKQITQGVFSTTEDLSDSHL
                     YRKMFDTVNRLEKKQLITSFASKYSKALIYFLTEKGLNMVYDFLFVPLNHTGKGFNDD
                     YGYFKHSVHMPPKLSVNHFLQQTNFYNIVLALKKKVPGAFDYRDNLYAAKQYDYMAGT
                     TNITGAYKPDGELLVEDQRFFIEVDTGSEYSSEFQTKFNNLFNYLQSLANNGEEIPTA
                     IVFVANKVQRRRFNGLVNPSEQRRYFTIKEAFEKACGNFTKRVDLVYLQLKQVERYFL
                     QFTREEKRPEFNKIANQLNRIKKFNYYKGERDDEFYFQDPDNPNLTYFVMRIEAFSNL
                     RWKRLLQVMEKQEEGGRNMRAIVFYEHFFSPPLHLGDRSSLPAKTKELYDKIYHLKLS
                     DNGLQWYNPYHESINAPFQ"
     gene            1818..4811
                     /locus_tag="BSPH_RS22450"
                     /old_locus_tag="Bsph_p002"
                     /db_xref="GeneID:6020524"
     CDS             1818..4811
                     /locus_tag="BSPH_RS22450"
                     /old_locus_tag="Bsph_p002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000379347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraG/TraD family conjugal transfer protein"
                     /protein_id="WP_012291639.1"
                     /db_xref="GI:501248621"
                     /db_xref="GeneID:6020524"
                     /translation="MKQLKKKEGKIENRFARLNRIAKIEEFIRIKFHLGAVTSLSFIN
                     VFILVPIALCMWLGAILGNPSMMLMQDWSWGITIFFWILPLLTWYYSTITIPYQKDHK
                     YILDFNDTVRGRWISAIANVGALHVMTWAVFAKYVVEYYLGYLASIRLDAAYKPFLLT
                     TDLDSFILILFVLPALISGLMIFIQVRDFMVHKDMLSESFMTWKAPIIRRFTHKKLLG
                     TADIIIGYQFKTMIPIVLKEAQRFLHEAVIGATGSGKTSTALLLRIAQDLINIATGRR
                     KMGLVFLEPKGDGVDDVLKMCKKLKIPDEKIKVIDATKAFTIKFNPFIGPSAPAAATF
                     EGTINALSGDQDDFYKGQQNEAASTLTKLAKIAFGEKTNIFHIQRMFSDPRYLANIVE
                     SIREQITTNREKQFREQKDLIMLLDSLGTSVEHIEQTEHELMFKLKNLSNSSAINENQ
                     KKLNEIQELKKRNNLLRAQQIEIDNTEQIIFYFENEVLLYKVDQRTQQPILYPKNHIY
                     ANQQMVESKKDKFVTGAKKYLNDIALNDLLKNLFIGAEGEEVFDADEFLREGGVLLVN
                     TSLAELDELSLMFGQFFIRQFQSAIFRRPQEGRIPIFFYIDEFPLYVNEAFERILTLG
                     RSYNVGAVIAMQSIGQLEGVKAGYQDIILGNASSKTVFGRGPNKDNEYFSLEFGEKEI
                     NEESLNESASPMTSEDQKWGYRLNTAKKKVARFSTTAIRELPFKHMIVQIVDETNSIA
                     PPLKAVGRFVNEARFIKPYLNLKKSDIKSNQEKEVGGLVENAIKGFSKPEIKEGDIVH
                     IPIESMPKLEDEVKPFDKSEDELLEILKYVEEVEEFIEQKTIAQQENSWEQILYSSED
                     NKEDVSSVATNENKVELEPIHIESTDEIKVSKITKEGEQNIENLMKELHEAVEGSTGN
                     KQVYNPLDSEELVVNDYLPPPEENEELPPLEHAYLAALPTEVNHINKQINEPQTKKTV
                     ADSNSIEKPAVQPYVTMGTMIEDDF"
     gene            4837..5592
                     /locus_tag="BSPH_RS22455"
                     /old_locus_tag="Bsph_p003"
                     /db_xref="GeneID:6020519"
     CDS             4837..5592
                     /locus_tag="BSPH_RS22455"
                     /old_locus_tag="Bsph_p003"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291640.1"
                     /db_xref="GI:501248622"
                     /db_xref="GeneID:6020519"
                     /translation="MTVSYLKYEEPQGLTFNLSRFKLERLGVVCFVNNENALDLLNNL
                     CKVYLVPNVFMLNAGLGNTGRFNPLLGNHNTASDTLCELLQHPVGLNIDLLNTTRLIE
                     AYMLLLKMNFNNGVTFKHVRQVIIDRDYCRFITQSLSNKGISNEIISKLLNIVAITET
                     VEIRDYLDRSLKSLDNLTPLKGHLFEHNFSQHTFNTYGFLQDGGALIVNTGAQKEASD
                     ILERSIVFHLKNLIMEKPMIYKAPTQIYDLYEL"
     gene            5781..6875
                     /locus_tag="BSPH_RS22460"
                     /old_locus_tag="Bsph_p004"
                     /db_xref="GeneID:6020542"
     CDS             5781..6875
                     /locus_tag="BSPH_RS22460"
                     /old_locus_tag="Bsph_p004"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659270.1"
                     /db_xref="GI:753952670"
                     /db_xref="GeneID:6020542"
                     /translation="MTTTNIFTQHEEQLQLQQALATLREAARMKTRILKGTVYGVETL
                     TLVGHKQQVLAVDFNGIFGYIPASKIDNYDFKGLQAFVGTEFDFVVEELFIPSELETD
                     NDEIEEAPNNATEAIVESNPEITLSEEYEQKTISVDAADTLVSEEPSQLTEQKNSKHS
                     KHDSSTIKQTRFIGNRAAALEIQSNRFWKSLQTKGVSNQIYDAFVSGVDKVNVWLVVE
                     GMRVRMNRMNFSYKFIDDLRNELYIGDMIKVKVLSFEEKEVDGNKVRNLEVSRKVLEK
                     DPKEFLHNIKVKGTYLGVVKNIDIDNGVFVELQTFGITVLTSFPSMDSGIKLQKEKQV
                     NVRVTKINTETGFVHGVIFDPRSGRRPRRD"
     gene            6879..8015
                     /locus_tag="BSPH_RS22465"
                     /old_locus_tag="Bsph_p005"
                     /db_xref="GeneID:6020398"
     CDS             6879..8015
                     /locus_tag="BSPH_RS22465"
                     /old_locus_tag="Bsph_p005"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291642.1"
                     /db_xref="GI:501248624"
                     /db_xref="GeneID:6020398"
                     /translation="MAESLFVVKDLDPNSQRSSSVTLGPPKATSHPFIGGTTPKDVLQ
                     YLPPSGDPFSLYGDPYAELVYIDNEQGFRKASYWLQDRVESNSFTDKEIALINFLSVH
                     RCATRSQIKKALFSPSDNEQKVKKFIETSHKRGIISCFSWQSPCRFENQKKKPRVYGL
                     SPIGCQAAEILFHRQLPREFRFQPVKFPIGTNPKMDYIFQHLVANELYCNMMTVDRVI
                     NWERSRRVLLNDGSEFKTQYATELIKDYNEIRTLWIEVVRVKAGWYEAIIRRFQTIQN
                     ALERAEELSKPERIIVIADDDSRIPILAELAETYLPDIKIRFTTDERLLSSWGPETFI
                     QCVAGEQVLNPSPIPFLLPDYKGMTATEYRNSYSSIEFEDEFED"
     gene            8026..8301
                     /locus_tag="BSPH_RS22470"
                     /old_locus_tag="Bsph_p006"
                     /db_xref="GeneID:6020452"
     CDS             8026..8301
                     /locus_tag="BSPH_RS22470"
                     /old_locus_tag="Bsph_p006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013405965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417270.1"
                     /db_xref="GI:670468582"
                     /db_xref="GeneID:6020452"
                     /translation="MNLMSLIVKSDSDIEELLRVNETLIVNGQQYMVVTDPNNGTAAF
                     VKVFTNENGEDRISDIYDDDEFQKVQNAYENQGNIKLTIRRQYFDAK"
     gene            8291..8839
                     /locus_tag="BSPH_RS22475"
                     /old_locus_tag="Bsph_p007"
                     /db_xref="GeneID:6020497"
     CDS             8291..8839
                     /locus_tag="BSPH_RS22475"
                     /old_locus_tag="Bsph_p007"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291644.1"
                     /db_xref="GI:501248626"
                     /db_xref="GeneID:6020497"
                     /translation="MLNEIIKPLYANEIIKSLYAGEKIIIVGECGAGKTHLLNQIREA
                     LIADNNPASILAGKFQANSEKDFDEILDEIKHHKNYAGKNFILMDEEDKFWLDDFKFL
                     DKIADKLQSDIGYVATMQAGRGMKKIQEVIADKNVTKYFSKIIVVGYPRRSKGYFIVI
                     DKKDENTFNWSHFERLQSNLYY"
     gene            8879..9367
                     /locus_tag="BSPH_RS22480"
                     /old_locus_tag="Bsph_p008"
                     /db_xref="GeneID:6020485"
     CDS             8879..9367
                     /locus_tag="BSPH_RS22480"
                     /old_locus_tag="Bsph_p008"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291645.1"
                     /db_xref="GI:501248627"
                     /db_xref="GeneID:6020485"
                     /translation="MDNREQFLNYQINLANKMLGVTFNGTTLQEKECFFQQYNEPLRN
                     AVAQMFSQMHVARTAIVIRFGDGCTETDWVVAESKEQAVQFYMEVMKGTDIELEDLEI
                     SDIDIQLEYMLYKEDEVPVADQVIFNKSKTNGYLEVPFVYAISYALENGMKLPDIIQS
                     FE"
     gene            9588..10133
                     /locus_tag="BSPH_RS22485"
                     /old_locus_tag="Bsph_p009"
                     /db_xref="GeneID:6020481"
     CDS             9588..10133
                     /locus_tag="BSPH_RS22485"
                     /old_locus_tag="Bsph_p009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012676114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291646.1"
                     /db_xref="GI:501248628"
                     /db_xref="GeneID:6020481"
                     /translation="MKKTAILVDEMNVIQQLRRLGIHGFNPWNAFYQALQRWNGDKKG
                     VKAFYCANVPKEDAEHEKRNNFFEGLINHNIKVSVGTVVYDSNSRRIAKGVDVALALD
                     IVEHARSGVQDIFICTGDADVVPAIIRAQELGSRVHVVVSRAIPAKNITLAADSVVRL
                     EDILETMPPHRIKYFAKERVS"
     gene            10133..10972
                     /locus_tag="BSPH_RS22490"
                     /old_locus_tag="Bsph_p010"
                     /db_xref="GeneID:6020509"
     CDS             10133..10972
                     /locus_tag="BSPH_RS22490"
                     /old_locus_tag="Bsph_p010"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291647.1"
                     /db_xref="GI:501248629"
                     /db_xref="GeneID:6020509"
                     /translation="METAPQEIFDLTLAKKTENEKELENAYRRIPDEYHDFIVLLEQK
                     IKITDSRYFLAEEFITMGAYQDEKGIYLKIKKPYMTVDGRIRMARDEHSKKEAKLIIS
                     EPQIIQVGNRICMNVTVESEIHGTATGTIEVNINGFGVDKKNPVANAQTSALGRALGF
                     LGYGIIGTAATASLDEATNLYNSLFASPSKEQVDPKKPEIKRVRICGPIEYKNNDLGY
                     VQIQLETEEYVIMQIGKSLFRYENILVTNAVVKVRGWWNGEIFAAAPDQDIILDQNKK
                     IVS"
     gene            11099..11950
                     /locus_tag="BSPH_RS22495"
                     /old_locus_tag="Bsph_p011"
                     /db_xref="GeneID:6020507"
     CDS             11099..11950
                     /locus_tag="BSPH_RS22495"
                     /old_locus_tag="Bsph_p011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000456898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291648.1"
                     /db_xref="GI:501248630"
                     /db_xref="GeneID:6020507"
                     /translation="MNYETKMAKILKENLFVNHRIEAQTGNTALQQITYKAQNTMEHN
                     LVYTLTNNNIFVTGDFGEAVFTFPFTVTLHNLKNCSLELFRSSLNTFSKCSWHFDKET
                     AISALKGYWEEKKVDSIYEDHDKIYEGFMFAIHCSNSVEDYNSELLPVISKTTGDAQL
                     LRVAADFGKCISPNLIAMWVGLLDIVRINEKTAINIEKVEVNTQYFKELLQYAEFSPT
                     FIIGGDEFSDDHTDFKKVERYNDLAIALNEQGISYIKIPVTDLKSLQFGEKEAKGIEE
                     YHARYKK"
     gene            11995..12270
                     /locus_tag="BSPH_RS22500"
                     /old_locus_tag="Bsph_p012"
                     /db_xref="GeneID:6020409"
     CDS             11995..12270
                     /locus_tag="BSPH_RS22500"
                     /old_locus_tag="Bsph_p012"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659272.1"
                     /db_xref="GI:753952674"
                     /db_xref="GeneID:6020409"
                     /translation="MKQQYYMGNGKGPNCDRGELLKGVKKLEEGSLLVINELGNGAGW
                     KFEVLDTEVVSISKEDYHYMLDIHCNDWTEESEEKVTAKMKEVLVLK"
     gene            12558..12926
                     /locus_tag="BSPH_RS22505"
                     /old_locus_tag="Bsph_p013"
                     /db_xref="GeneID:6020532"
     CDS             12558..12926
                     /locus_tag="BSPH_RS22505"
                     /old_locus_tag="Bsph_p013"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417274.1"
                     /db_xref="GI:670468586"
                     /db_xref="GeneID:6020532"
                     /translation="MRTPILLRLPSDVVKLLNLYMDEEYIQHLNTALDRLLLEYTRKY
                     DGSGPLFQNSYTWPSPNDEDTSYLYKVPDKVLTRIDSMVTEAFDKGYTRLTGANRSGV
                     IYNLIRVYVPSSYQTSAQIS"
     gene            13367..14410
                     /locus_tag="BSPH_RS22510"
                     /old_locus_tag="Bsph_p014"
                     /db_xref="GeneID:6020470"
     CDS             13367..14410
                     /locus_tag="BSPH_RS22510"
                     /old_locus_tag="Bsph_p014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000107503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291651.1"
                     /db_xref="GI:501248633"
                     /db_xref="GeneID:6020470"
                     /translation="MRVIDGIQFFDAEQQFLKLYEYEQEHEQQKKLTASSVVTYLLMR
                     SQCDEAGLIYETEFNLKLVCEKLGLPYSSIHNGYHRLYEIGLLAITRIGERTYIQLPM
                     VAAHVPSKEDNEISSYFRIPNAIFNGTFLNTFIKARDVRGLLGVFDLLNGLFREYSNK
                     RNTSLKRKKETLIKKLKQSKYAFKSWIRRVFSNKESLIEIKIEHEDMYELKFSEAAFT
                     DREQDVVYEKFNAAVRNTLSSLLKSSSIKYATKDLKDMQFACQQELTAPLYRAILVND
                     QAEKFASLVVPDVISNTINKIENSNAKVLGAYFRRTIKSQIQEVMKEEIPLRRLIAST
                     YRDEGLEVPVQFL"
     gene            15110..16525
                     /locus_tag="BSPH_RS22515"
                     /old_locus_tag="Bsph_p015"
                     /db_xref="GeneID:6020451"
     CDS             15110..16525
                     /locus_tag="BSPH_RS22515"
                     /old_locus_tag="Bsph_p015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013429744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417275.1"
                     /db_xref="GI:670468587"
                     /db_xref="GeneID:6020451"
                     /translation="MTNIHVSQRGNSMPRISQETIDAVLSVPIIDLANVMGDKLIRKG
                     KQYTIPCPDPNHTEKVSDNAYIEPNKNVFKCFSCMVGGNSAVAYYAIKTYGTYDSKKH
                     FLPSVRAVAELMGIQIKNEDGTISLPGATEPQRRFVKAVELEPKEPKILDVVYRAFLN
                     LCPIRQNHLNEWINKRRYSKNEIQTMMLKSVPTSDEWKSIYQTLHDLGYPLERIPGFA
                     ERFIPEFYEECNPELGSGLETLQIQGKDTRGTWLYTPSTFVSGYFIPVRDENGYIVRL
                     RICQDNGNPKYIWFSSEHNLQTETKLPYIRRNGTSSGAPHSVSVPFTILNKWQPGTHV
                     SEVISIKEMIITEGEHKSQISANFFNRYVRGLAGIGNFATLLDEIKELKALGLEKVVI
                     AIDMDTLEKEDDSIKSEKKQKNLFNILKTFATELLKLDVTCCLWTWNLQHGKGLDDLV
                     YNRKLPIEINLRTGERQTVRI"
     gene            16537..>16818
                     /locus_tag="BSPH_RS22520"
                     /old_locus_tag="Bsph_p016"
                     /db_xref="GeneID:6020391"
     CDS             16537..>16818
                     /locus_tag="BSPH_RS22520"
                     /old_locus_tag="Bsph_p016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008881980.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417276.1"
                     /db_xref="GI:670468588"
                     /db_xref="GeneID:6020391"
                     /translation="MQSILLTGRLTTDPLLTYTPEIAKCTFFLAVASNHNGYKKTDFI
                     PCVAWRQQAELLGNFARKGQKIEVRGYIRSRTFTSEGQKVSYLEFEIVDA"
     gene            16856..17455
                     /locus_tag="BSPH_RS22525"
                     /old_locus_tag="Bsph_p017"
                     /db_xref="GeneID:6020390"
     CDS             16856..17455
                     /locus_tag="BSPH_RS22525"
                     /old_locus_tag="Bsph_p017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_012291654.1"
                     /db_xref="GI:501248636"
                     /db_xref="GeneID:6020390"
                     /translation="MINRVVLVGRLTKDPELRYTPNGIASTRFTIAVNRTFSNQQGER
                     EADFISCVAWRKQAENLANYMRKGNLIGVEGRIQTGSYEGQDGKRVYTTDVVADSVQF
                     LEPRNGNGGAPPAPQNNGGQTYGNNQPSYSGGQPQQQFGGSMPGQGSYGGGSYPNNQP
                     NQTYGPPGGTSQPNYTRVDEDPFANSKGPIEVSEDDLPF"
     gene            17654..18751
                     /locus_tag="BSPH_RS22530"
                     /old_locus_tag="Bsph_p018"
                     /db_xref="GeneID:6020399"
     CDS             17654..18751
                     /locus_tag="BSPH_RS22530"
                     /old_locus_tag="Bsph_p018"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007201578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_012291655.1"
                     /db_xref="GI:501248637"
                     /db_xref="GeneID:6020399"
                     /translation="MQMQLNSKTIVNGINKVGRFKSKEKTKPALQFILLNVNTDNLEF
                     IASDNEVYYKHVEPVAEGITKTGSFLIPFKLEDALRKVSGTVSLTLEGTTLKFEAKGI
                     KASIPVAVYNDFPKEPTGEAGPAIQFTKEQLLEIVNQCGYASATSDTRPVLKGLNMSG
                     QNGEFQVVSTDSYRLVKKVRKQAIELPALTIPTKTLKSVLESLEDEVDFAMAPFGTQL
                     IIKTDAQEIFIRLITSTYPDTSKLAVIGDDYIKVKVNTKEITDALETVMLFAEEKSKG
                     KNVLLESKGDQLRISVKGENGEIEHFINAEGEEFTKTAMNAKYLITAVNAHKKSTTDL
                     LFKKGKSEAPVFIMCDDETLVQLILPIRIKQ"
     gene            18919..19269
                     /locus_tag="BSPH_RS22535"
                     /old_locus_tag="Bsph_p019"
                     /db_xref="GeneID:6020525"
     CDS             18919..19269
                     /locus_tag="BSPH_RS22535"
                     /old_locus_tag="Bsph_p019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291656.1"
                     /db_xref="GI:501248638"
                     /db_xref="GeneID:6020525"
                     /translation="MEEYVMKTNDIVINKVKKWLEAEDKSYKWLAEQLGVSKPLVGFM
                     LNGERTLKPERIEQLAKIMGITTKELVQSDAIKKDQLTVNLRGELSNRRSKRELDSLL
                     FAINDYLGLKEQVK"
     gene            19270..>19992
                     /locus_tag="BSPH_RS22540"
                     /old_locus_tag="Bsph_p020"
                     /db_xref="GeneID:6020448"
     CDS             19270..>19992
                     /locus_tag="BSPH_RS22540"
                     /old_locus_tag="Bsph_p020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013858323.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659318.1"
                     /db_xref="GI:753952752"
                     /db_xref="GeneID:6020448"
                     /translation="MERKKSPEEIYAEDIAEAFALSYLQEKFGHDFFIGSQIENIIAE
                     NENVNIIYQYVEDVKYFGAAVSHESGEKFIAINSYHPLRIRYFTVAHELWHLTRGIMI
                     QDKNFNHERAADRFAAAVMLPRTLTKDLWERYKKESGIEKTVISIADLAQVPYQSVIR
                     RAKEIGIKFPSSLLKKTEEEWQVERIKLGFPSSNLDKAVKDTRFFAYEDVVVKGVEHY
                     GLDTLTAASKLAKFAPQKAEQYQ"
     gene            20021..20662
                     /locus_tag="BSPH_RS22545"
                     /old_locus_tag="Bsph_p021"
                     /db_xref="GeneID:6020403"
     CDS             20021..20662
                     /locus_tag="BSPH_RS22545"
                     /old_locus_tag="Bsph_p021"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291658.1"
                     /db_xref="GI:501248640"
                     /db_xref="GeneID:6020403"
                     /translation="MSRKGKVFIDTNILFYASQYHIKDVFQWIESLYEEIYIHQMVLD
                     ELISSTARSKVESKLKEGQWILFDPDDEETLSDEQFAIYEGYLSDVKQAFVDLDEKKK
                     SEGRRLKNTNDLGEMHSLAAAMLIGASIIFSNDYDVLEVIHDAQLCITLDETEESVLI
                     DHDSLLDFCCYLVDSKLESKGPVKKFLKLFQGDKVIEFDTRINEKESTSKISE"
     gene            20785..21822
                     /locus_tag="BSPH_RS22550"
                     /old_locus_tag="Bsph_p022"
                     /db_xref="GeneID:6020484"
     CDS             20785..21822
                     /locus_tag="BSPH_RS22550"
                     /old_locus_tag="Bsph_p022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036146846.1"
                     /db_xref="GI:738190791"
                     /db_xref="GeneID:6020484"
                     /translation="MQLELFDKNDFKQHKKYLDGLMKSKEDIIKIAQKAGRTRLYKVL
                     SFGGGTQSSHLLEAHFRNEIDYDFIVFSDTGAEPEFIHEQVSWWRRRQKELSNNTPFI
                     ITTHNSMERGLEEMLMRYLQTDYQRFQLPLYFNKVDEETGEIRKGGLMKRQCTGDFKI
                     VPAQQAVRNEIKKQLGLRPKQQIPKDIGIIMDIGFSYDEMNRVGGYISHQSKYIYLAY
                     PLIEQGLTTQDSIEFLINNDFPSRRSRCYFCPFNCSGERARDIGMDWEEIIETEPISF
                     LKACFFDEELRKCQASGKKNMQSIPYFHFSRKALKEVYSDSFKLLNNKFGLKILEWRK
                     EWELFIDSKYN"
     gene            22105..23103
                     /locus_tag="BSPH_RS22555"
                     /old_locus_tag="Bsph_p023"
                     /db_xref="GeneID:6020498"
     CDS             22105..23103
                     /locus_tag="BSPH_RS22555"
                     /old_locus_tag="Bsph_p023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010676344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291660.1"
                     /db_xref="GI:501248642"
                     /db_xref="GeneID:6020498"
                     /translation="MAKSIHASINEFSKNCVDLDPTKLGTARSSRNWLVDKIENFEKT
                     DNEFPEIYKKENNVQMGSFARRTKIRPLDDIDFIVVFDGKGSKYVTNSYGEITINVPE
                     TATNLSRLTNDENSLNSIKLLNKLKSSLQNVPQYSAADIKRNFEAITLKLTSYDWNFD
                     IVPAFITAPDSSQRTYYLIPDGQGKWKKTDPRIDARRATEINQKRDGKVLRIIRLIKY
                     WQKRHSVPNIGSYLLENLLLNYFNNNEVSASDQVTLRDVFSYLRNSIYHSCNDPKEIQ
                     GNLNLLNLDVKDRFSEAAANASICAQNAINFMAKDDHKAAHAEWKKVFGSEFPDYE"
     gene            23096..23977
                     /locus_tag="BSPH_RS22560"
                     /old_locus_tag="Bsph_p024"
                     /db_xref="GeneID:6020561"
     CDS             23096..23977
                     /locus_tag="BSPH_RS22560"
                     /old_locus_tag="Bsph_p024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000890773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291661.1"
                     /db_xref="GI:501248643"
                     /db_xref="GeneID:6020561"
                     /translation="MNEITINKNQNKPESLRLLAAMRLLYGRAKILRTLRVCITVLLP
                     IISILSLNYFPSFKEGLAFLAGVWLVLNRIFFLEIEKRMVKDAAKIQEEFDVNIYQIS
                     WNSLLVGEKIPVEGIKRLNQKSKEKEENLKDWYPGLKSPDHFLNVLLAQRTNIAWDID
                     LRKFYKNILYGVTTLYIIILIAICFQINLPTQTLIISFLVPSFPLILHLFETANGHKQ
                     RHESLEKVLPKVTGDIDNYSTNEQGMIANTIRGYQDIVFLKRCDVNMIPNKIYWLKRN
                     LYDKIAKETNEEKSDNQ"
     gene            24239..24829
                     /locus_tag="BSPH_RS22565"
                     /old_locus_tag="Bsph_p025"
                     /db_xref="GeneID:6020469"
     CDS             24239..24829
                     /locus_tag="BSPH_RS22565"
                     /old_locus_tag="Bsph_p025"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291662.1"
                     /db_xref="GI:501248644"
                     /db_xref="GeneID:6020469"
                     /translation="MLIEIGSHQQLKTSEKRNNNMTSTITTTTVCVGCNKLDGYISII
                     YVDKETKEYKAECAHCKNVFTTTFEPTTQQNFGNKIDEELEQEQIKALLEGSKYLFLP
                     DADDKDVILAFRVMLENGEEPTNKEAFNSMYHCVISNSVHEFETNDLHELLDRPDDLY
                     YDYGVGSDCETIEWLDINIDVRYLYLINNTFYYYVG"
     gene            25036..25242
                     /locus_tag="BSPH_RS22570"
                     /old_locus_tag="Bsph_p026"
                     /db_xref="GeneID:6020540"
     CDS             25036..25242
                     /locus_tag="BSPH_RS22570"
                     /old_locus_tag="Bsph_p026"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291663.1"
                     /db_xref="GI:501248645"
                     /db_xref="GeneID:6020540"
                     /translation="MEKASFDTFLNTEERAKAYIENMSTEDKELANNFFLELLENDEI
                     EHRNFNEWLFDYLHDCIYESGAEG"
     gene            25640..26668
                     /locus_tag="BSPH_RS22575"
                     /old_locus_tag="Bsph_p027"
                     /db_xref="GeneID:6020393"
     CDS             25640..26668
                     /locus_tag="BSPH_RS22575"
                     /old_locus_tag="Bsph_p027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010165185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659319.1"
                     /db_xref="GI:753952754"
                     /db_xref="GeneID:6020393"
                     /translation="MGLESTPPDFRTSINLLPLSDYDHIIISESGGKDSMACLFYLME
                     LGVPINKLELWHQSVDGGGANHIEFMDWPVTESYINEVGKLFGIKTCYQWREGGFFNE
                     LMRKDSLTGDVYYTTEDGEIIHLPTKSGKLNTRLKWPALSPDLRIRWCSPYVKIDVFR
                     RVLNNHPLYKDKKILVVTGERREESANRAKYAEAEIHACNSKKRLVHAWRPIIDWSEQ
                     QVWDMYEKRRFLPHPAYLLGWNRTSCFGCIFSTADLWAMMREIAPGRFNKLVEVEKQL
                     NHTVDTNRLTLVQKADMGSIERLPKDSRLSQWVSAALNKNFTKADLIMDKWELPAGAF
                     RGNVGGPV"
     gene            26689..27279
                     /locus_tag="BSPH_RS22580"
                     /old_locus_tag="Bsph_p028"
                     /db_xref="GeneID:6020392"
     CDS             26689..27279
                     /locus_tag="BSPH_RS22580"
                     /old_locus_tag="Bsph_p028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017170349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036146845.1"
                     /db_xref="GI:738190790"
                     /db_xref="GeneID:6020392"
                     /translation="MILLQTPMNVFESYCGKAKVTGEVKVETEKGQVLYTSKHTFTDL
                     LTGRIILKGGYYYFVDDNELAFMEKEEQEFERQRQMKIEEEIERLEAERLIQEAKLKA
                     FKEAYSLPFEYTTKIKIVLSGLSINSNGCGSKKNTVFHVFVKNDFNDGRFKRTAESFL
                     CSPNDNGKWTTLDDYEHNDQLITCKKCLSIMERWKK"
     gene            <27806..>28759
                     /locus_tag="BSPH_RS22585"
                     /db_xref="GeneID:23320124"
     CDS             <27806..>28759
                     /locus_tag="BSPH_RS22585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016121271.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036146936.1"
                     /db_xref="GI:738190884"
                     /db_xref="GeneID:23320124"
                     /translation="IKVASFFAGSGIGDQGLKEAGFDIVFALENDINAADTYRANHGD
                     HITVQDIEDFDGSTLNGIEFAFGSPPCVDYTPANQKTNKWHNPEPTLIDEYLRVLKEM
                     PDLKVWVLENSKLFLTAGNGDVIRDICNELPDYDISYGILDAVDYNSPQRRERTFIIG
                     SKIGKIELPTPITTPDNYKTVQEAFAGLSDNLPNQKDVTTPKATTKARMGFVPQGGNW
                     RDIPKNLLPKRFGKNTHSSIYRRLELDKPSFAITNVRKSNILHPLYDRVLSIREASRL
                     FDLPDNFIFKGPLSAMQQQVANGITVNVAKAVGQKILYAFKK"
     gene            28825..29382
                     /locus_tag="BSPH_RS22590"
                     /old_locus_tag="Bsph_p030"
                     /db_xref="GeneID:6020438"
     CDS             28825..29382
                     /locus_tag="BSPH_RS22590"
                     /old_locus_tag="Bsph_p030"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291667.1"
                     /db_xref="GI:501248649"
                     /db_xref="GeneID:6020438"
                     /translation="MRDILIVTQDNVLEIAGSLLLNAKHTVNNSNSFGFHNKESQEIA
                     YKMLDDLYEKLKKLGYNPSGLFYHIQLQIDYTYGYAPITEWAELKNELMDHFEFNLLV
                     DGKYYAYGKSLMAKYNIKYKNENPIMKQTHFSDCDLKYICSNFEDESLKTLAFVTGKK
                     ERDILIEIERLKKWWLFDYYKNYCY"
     gene            29438..29674
                     /locus_tag="BSPH_RS22595"
                     /old_locus_tag="Bsph_p031"
                     /db_xref="GeneID:6020408"
     CDS             29438..29674
                     /locus_tag="BSPH_RS22595"
                     /old_locus_tag="Bsph_p031"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036146844.1"
                     /db_xref="GI:738190789"
                     /db_xref="GeneID:6020408"
                     /translation="MRMNVQKMWMLHDTLFLNENDALKVEEKEVREKVKAVYVGLDEG
                     VDYDLTQVRSDFFGSWIFKTEKEAQGEVDEFNRS"
     gene            30398..30814
                     /locus_tag="BSPH_RS22600"
                     /old_locus_tag="Bsph_p033"
                     /db_xref="GeneID:6020483"
     CDS             30398..30814
                     /locus_tag="BSPH_RS22600"
                     /old_locus_tag="Bsph_p033"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291670.1"
                     /db_xref="GI:501248652"
                     /db_xref="GeneID:6020483"
                     /translation="MAFKSILEKDTTINANNTRMELLSQSNKDISQLDPFLLEDFSLA
                     IEQKYHLDIMSNHDGKNDRYRLIDALIDIDALVNNMVLPLKLEVEMDGNTKILDFNIS
                     QIEYSKSAGMENPKYYIYCDNSDNIGFRFWFIQKKS"
     gene            31172..31699
                     /locus_tag="BSPH_RS22605"
                     /old_locus_tag="Bsph_p034"
                     /db_xref="GeneID:6020472"
     CDS             31172..31699
                     /locus_tag="BSPH_RS22605"
                     /old_locus_tag="Bsph_p034"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291671.1"
                     /db_xref="GI:501248653"
                     /db_xref="GeneID:6020472"
                     /translation="MNNKWSKLAIRSGVLVMLVSAVGGGVYLAEQKSEITEKKQVEVK
                     DNPTDLYLQNVYGTYLKDVVPRWNELTDKRNMDYLKTKQLIGDWKDMLLSQEQTYVSL
                     NQLLMQQVNTLEDFFKLTQQDETSEQRKSLRKLSADFTEGHQKVKETVLSILEEYKAD
                     YEVFSDGSIEYVFPQ"
     gene            31755..32114
                     /locus_tag="BSPH_RS22610"
                     /old_locus_tag="Bsph_p035"
                     /db_xref="GeneID:6020441"
     CDS             31755..32114
                     /locus_tag="BSPH_RS22610"
                     /old_locus_tag="Bsph_p035"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291672.1"
                     /db_xref="GI:501248654"
                     /db_xref="GeneID:6020441"
                     /translation="MIKPEFLHIRTTELFKDDIKAQNIFQKWSERFNEQKKEYNLNIF
                     NLAEVILWQPEDDNLSNLIFLLEQGRKTNQVVVLMGDEEQFEKLKNTNMKLYETILGN
                     TIDLEKEDVAVCIEITE"
     gene            complement(32301..33485)
                     /locus_tag="BSPH_RS22615"
                     /old_locus_tag="Bsph_p036"
                     /db_xref="GeneID:6020547"
     CDS             complement(32301..33485)
                     /locus_tag="BSPH_RS22615"
                     /old_locus_tag="Bsph_p036"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659274.1"
                     /db_xref="GI:753952679"
                     /db_xref="GeneID:6020547"
                     /translation="MVKVIIKNKYIYIIALFFKKSIDRNGLIYDIIIHILVITYYPIQ
                     AERIYRIFQRSNGMKAYAFFYWCAFFVFSNNHEGANKMKKLLIGMIGLLPLLYVSDVT
                     TETNMATSYLLFLKDYWPLLLVGLITLKYAKKAYDSRFNELENMRYRHYRSEVKRYYG
                     TPYVPAIMTQYLTNPPGAISPNQWDYINNRFYQMVVNDFRDNVYVFRDFNSFEPGKKN
                     TVIDIVGWAKILRLSAIFVVSFGWFAYWIINNSFFNNWPFFTLPLLVVAWIKIIIKLQ
                     AIMHYLPSKFDSTLEDNSNTRIYWRDAFPDRPFGHTVLRAYFYEKEKRMRYVASLNNQ
                     PMGPSLDTWTHYAFPELPYPHIELPEWEKDYDQFYEQKAQQLNLEDSSQKQNVILFKK
                     VT"
     gene            33587..34489
                     /locus_tag="BSPH_RS22620"
                     /old_locus_tag="Bsph_p037"
                     /db_xref="GeneID:6020402"
     CDS             33587..34489
                     /locus_tag="BSPH_RS22620"
                     /old_locus_tag="Bsph_p037"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008679632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_012291674.1"
                     /db_xref="GI:501248656"
                     /db_xref="GeneID:6020402"
                     /translation="MGQITLFDIQEKSEKANGNTFENWLLVDGDNILNRTFHATKYEY
                     KTAPDGRHTNGVSAFLKMVFGYQRKFSANIVVFFDQGKGFRKELYPEYKDGRKEKPEE
                     LIQQFPTLKEVLLAADIPSFESDYFEADDLIASSISKLQGHKYILSNDKDLLQLVSDD
                     VTVIRKGNKNVDSLITPETFTNEYPGMTPLQIVDIKALAGDSSDNIKGVPGIGEKGAF
                     NLVQFYGTVENMIVSTECPKELKRYFTKLMAAKEDAIFSKMLTTLRKDASITIQARPL
                     NEHGLREQCDILSLVIIKAYMNLY"
     gene            34543..34866
                     /locus_tag="BSPH_RS22625"
                     /old_locus_tag="Bsph_p038"
                     /db_xref="GeneID:6020572"
     CDS             34543..34866
                     /locus_tag="BSPH_RS22625"
                     /old_locus_tag="Bsph_p038"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291675.1"
                     /db_xref="GI:501248657"
                     /db_xref="GeneID:6020572"
                     /translation="MNIDKLWASFEENKGSYKGMEILKLIYFNNNGLRIKDIREEFDS
                     WSIKLLELLHEEMTCIPTFEMETELNINFGETAPIFNFFEASTECGIGDDVLKMVKPK
                     KKRFF"
     gene            34878..35363
                     /locus_tag="BSPH_RS22630"
                     /old_locus_tag="Bsph_p039"
                     /db_xref="GeneID:6020419"
     CDS             34878..35363
                     /locus_tag="BSPH_RS22630"
                     /old_locus_tag="Bsph_p039"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291676.1"
                     /db_xref="GI:501248658"
                     /db_xref="GeneID:6020419"
                     /translation="MYLKEKQIGEGDRLEFNLLFSRLIAIKLIERELKIDCSEELIEV
                     NVSYYMQYDDFFNELHWFLKTAGIGDFDYFDDDVYGLTFSLLNNLSDDEQFFFQDWKE
                     NLIEEIKENEFIDFFEGEIEWISFDTLQFPLGYIFTPMHEVYSFFIDKQLELQSLCKK
                     Q"
     gene            35408..36607
                     /locus_tag="BSPH_RS22635"
                     /old_locus_tag="Bsph_p040"
                     /db_xref="GeneID:6020416"
     CDS             35408..36607
                     /locus_tag="BSPH_RS22635"
                     /old_locus_tag="Bsph_p040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000859307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291677.1"
                     /db_xref="GI:501248659"
                     /db_xref="GeneID:6020416"
                     /translation="MNKIIATFQNREPITVERVQDGLTIGRYNLTPAAFIESMAKELP
                     FENLFALVVEQVIEDNAFNDYFDEIYIHRKEKKYTDFLNAMLNNAPSNWLDEPRLHDF
                     VINALSQFKVTKEDETVILNLFRSVKRIITQENQSVFVELALQVFSNLINSKEKEDSL
                     KKFLSLLYSNLNVNKKEELDDWFVMNIDSIPSDIKAEVIVKVLEDKNFLRDVYRLLNS
                     DKKAFNTWLNEMVDNMPLTWRVDGFKRTVKPEDVYLKTIQIPKNCVNIDVSVSKLVYS
                     IEIPKKRMRVKFGDIAYEDVGHPKLLAKIEVVDEKFQSMSLFAIKDGEDILYKYPYSN
                     VYDSGKVCWHVMDRNTIISLKEIEMLPMMFLSTPNNSHLNSKTLNLYLKYQGKDFDDS
                     ELEPFTY"
     gene            36856..41313
                     /locus_tag="BSPH_RS22640"
                     /old_locus_tag="Bsph_p041"
                     /db_xref="GeneID:6020422"
     CDS             36856..41313
                     /locus_tag="BSPH_RS22640"
                     /old_locus_tag="Bsph_p041"
                     /EC_number="3.2.1.1"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Includes: Alpha-amylase (EC 3.2.1.1)
                     (1,4-alpha-D-glucan glucanohydrolase); Pullulanase (EC
                     3.2.1.41) (1,4-alpha-D-glucan glucanohydrolase)
                     (Alpha-dextrin endo-1,6-alpha-glucosidase); Derived by
                     automated computational analysis using gene prediction
                     method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="amylopullulanase precursor
                     (Alpha-amylase/pullulanase) (pullulanase type II)"
                     /protein_id="WP_012291678.1"
                     /db_xref="GI:501248660"
                     /db_xref="GeneID:6020422"
                     /translation="MKTRKQEKLFWGSVAAGALIAGMTTGVGIQDAKALETTEQSIIY
                     YEDIYNINLSRDFDSDYKFESSVSSITNIRYDKDKKIFYFTVNGGNSDFGYITPSDRI
                     NNTYGQFGFSLYFDTVTLIGRNQHYESYHNKVRQKVDFYSKSGEVFFNGNEIGIRMNY
                     EPTSLKIRGNLDADWGSIYLNSMNLLDQPLRLKNEKPSIQLEPTLSVVIDELKDKAVT
                     LSIDFPNDAVTKEYRIDGGIWTQYTAPVQLIKNGTIEARATDLAGNESISQLLSVDIQ
                     AIKLKWLLDNYTAASVDDFKWAGIPGVTSENIEQLKGIVTDYISTFNGGEITVPTVSV
                     YETWLTYIDILTKVQTSIENAKNFVNPRELTLAIKDIKDTINSLPDWVGAKTSFNDEI
                     SLLDRYSIALDAVIDSETSLQQEDKDAAQSLVDVIGNAQIQEQLSDRLNVVQNFIEAT
                     TSVEYAESTRLEEDILEAQAKVKELPENTVKTELQNRLDTLLHLIGVEIAVNTSESTL
                     LQEDKDKAQTLVDTLQDGHYKDTLQSRLDLVQDIINASNAVKQAEITSSDENIATAQD
                     AIDLLPDGEKKLELQDRLDKVKGFIDLISEIDKTLKEAEDTLITEQLGNVQDMITSLP
                     TSTIKDSLQDRLNNLLEYRESEKVVSKAEELKVQSYKDRAQESVDLLKPWKGKDHLQE
                     RLDKLQDVIDQKEGNLIDKILNDPDNVTSQELADFTDNDVVDEKLRDYIENIIEEAEN
                     GSITKDDVVQIVRLITFLEQSKRSMAEEHISKYEAELLSTTVSVKSKFPNASVLRSIP
                     GYLNDALDLPTFAQELADLLKRPFEEVLAELDGLLGSDKVATLAYTVKYVTEDGKVVS
                     EQSKEAPAGNVTVQAQTPEGYELVSEGKQTFELTEDTKGTAILFKVKPTIEVTKGSYT
                     IEYVTLENEVVHTETIQVDFGTIEVVAKVPEGYELLKTEESSQKIVLSKDVPFETLRF
                     VVVKDEASTEMPSTGEEVKESSEIEGPAKEVPSTEELPVEGKNKELGNVETQPTTVDI
                     STETVTSQTIGAETALVRSLLVASLDNTYFTATSQNLGVSHNQYLYDVSQSVLLVKAF
                     VGNPTEENRLDAKNFILGNLYAGEFKTVLLKIIALAGEEIPADGEDITIIHPSKPSVK
                     PDPPVVTPPTPPVVSPPVVIPPISGGETTAEIEKIHPVEKIDDGYKWGVTNPQKPSYV
                     FQTDDIRIELNLDSIQDVKDLEVYWLNKNKGYYDLVIKANGKIIDRLKKSVNLKFKYQ
                     HAYLLQVKEGINKAIPHVYNDSAFSFKANGSSSFYFSQTLITFRDIYNNQNKKVIEEL
                     ASRNVVNGTAPGYYNPNGSLTRAEFSAMLVRGLGLETTEVYDGVFKDVKEKDWFAKDV
                     HTLYATGIIKGVTPTKFNPNSPLTRQQAAVMLNRVLEYLEVEKRESEKLDFIDAAKIS
                     EDAKQAVATMKALGIFSGKPGNKFDPQANLTRAEMAKVLEMTLKIADLF"
     gene            41699..42772
                     /locus_tag="BSPH_RS22645"
                     /old_locus_tag="Bsph_p042"
                     /db_xref="GeneID:6020420"
     CDS             41699..42772
                     /locus_tag="BSPH_RS22645"
                     /old_locus_tag="Bsph_p042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000174336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291679.1"
                     /db_xref="GI:501248661"
                     /db_xref="GeneID:6020420"
                     /translation="MVNITNVSIFDVGVKDTEPKKETEKEVKSVSKVGKGAKPKEEKV
                     EIKINNEWTVHFATESFNATDFVEEIPEEGITLEELRKGIERVFPKFSAARTKFDLDK
                     ENKRIFPDAFAGSKGAGAFTPSFFLSREAAIKSNSHIKYLLGKENSVFRVITSAIGTF
                     ITRVNDETITDNVLSNMPYYKESNLEQIEESFTFNLPKIPFYYLQKICSFFMSFINKG
                     DNYEVACKIFWDTEKREYIIDVPKQTVTKVTIQFEYSGAFTGRNSLRYIPVLELHSHN
                     VMRAFFSKTDDLDEQEYGLYGVVGRLNRKEIQFAFRVKCDDSYLHVLMNHIFEIENAH
                     MNLPIDFPDEWLEKVTTKKGFYL"
     gene            42769..43629
                     /locus_tag="BSPH_RS22650"
                     /old_locus_tag="Bsph_p043"
                     /db_xref="GeneID:6020414"
     CDS             42769..43629
                     /locus_tag="BSPH_RS22650"
                     /old_locus_tag="Bsph_p043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001201945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659275.1"
                     /db_xref="GI:753952681"
                     /db_xref="GeneID:6020414"
                     /translation="MKIVDTPNFDVVIIGAGANGSHFFRNLLQDISCYGSRLKNCKFT
                     IVDGDQVEKKNLNNQLFDSDDVGAYKVQALVDRYGEHYQVDCAAVATYVTTLEDLEKL
                     FRGPKGLQRILVGCVDNNRTRQLMHEYFESSSDLIYVDVGVEGVILKDELPKEMDDKE
                     SIIMSSGFSGQIVIGFRKDNTTVLPSVADVYPTILTDFESAFPTQACAEVKDNPQRVE
                     TNKMAAQFANIILNNLFHTGELLQEEITFNARLGTSVVSYIDVRKEREYIKLIREENN
                     NEQQQLCIVS"
     gene            43598..>44659
                     /locus_tag="BSPH_RS22655"
                     /db_xref="GeneID:23320125"
     CDS             43598..>44659
                     /locus_tag="BSPH_RS22655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285587.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_031417301.1"
                     /db_xref="GI:670468616"
                     /db_xref="GeneID:23320125"
                     /translation="MNNSNFVLYRKYRPQGFDNLIGQNHVKNTLENSIKHNKVAHAYL
                     FTGPRGTGKTSAAKIFAKLLNCQSPIDYNPCGECVCCQDSNTDIIEMDAASNNGVDDI
                     RDLREKVNYAPAFGKKKVYIIDEVHMLSTAAFNALLKTLEEPPAHIVFILATTEPHKI
                     PATILSRCQRYDFRRISQDDIVHRMKTIVEAESVEIEEQALRLISQIAAGGMRDALSL
                     LDQAISKVEGKVTLQDIIEITGAVDTRKIGTLIQYINQSNIEGALEHFNTCFESGQEP
                     HFFLEEMMIYLRDILVNRKLGEKATLKKGHNDPQFYEIANSVGPDKIYDYMDLLNKAH
                     SNMKFHNDVQLLMEMTIIEM"
     gene            <45572..>46009
                     /locus_tag="BSPH_RS22660"
                     /db_xref="GeneID:23320126"
     CDS             <45572..>46009
                     /locus_tag="BSPH_RS22660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010077664.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417302.1"
                     /db_xref="GI:670468617"
                     /db_xref="GeneID:23320126"
                     /translation="GKLAHAYLLVGSSLEFALWITQCVYCKDQNACGQCANCRRIKHG
                     NHPDVHIIVPDGTKIKVDQIRELQREAALKAVEGQKQVFIIDNANKMNENAANALLKS
                     LEEPLQDTLYLLVSETKNNILPTIISRVQTLKMKEENRLVDEAE"
     gene            46624..47760
                     /locus_tag="BSPH_RS22665"
                     /old_locus_tag="Bsph_p046"
                     /db_xref="GeneID:6020562"
     CDS             46624..47760
                     /locus_tag="BSPH_RS22665"
                     /old_locus_tag="Bsph_p046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013277001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417303.1"
                     /db_xref="GI:670468618"
                     /db_xref="GeneID:6020562"
                     /translation="MFRINSKDLKIVVERVMKSARRAKLKNTVIDVIASGTTIILKFG
                     GSELFVSQKIEANITKELNFSTTVMELNLKVSALPNNELITVEEKDNKIYFKWGRSSL
                     VRVERVDNQCIEMSFEGQGESYEWSYNSIQRITRNMTSFTAINGTAEAKKIPQLAGIY
                     IQYKKEYTELHASDSKKAISMVETDIKWFDEPAAIPTETWFAMYELLSEDSIINISSN
                     GKSLVKFESESTVIISRIIIGTYPDLSSIYVQPEQTATRWTIDRLELLEATRRARHLI
                     TTTGSNIELNSDGKKTYLVLKDQLVQQIGAMIVGDIKRFIINPEDLELILSILKTEDI
                     VLCYRSLSSSMTIYGIADEESDEESEDKKGEMNIKCMLSTMVGK"
     gene            47801..48442
                     /locus_tag="BSPH_RS22670"
                     /old_locus_tag="Bsph_p047"
                     /db_xref="GeneID:6020518"
     CDS             47801..48442
                     /locus_tag="BSPH_RS22670"
                     /old_locus_tag="Bsph_p047"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291684.1"
                     /db_xref="GI:501248666"
                     /db_xref="GeneID:6020518"
                     /translation="MEFIILLIILGSISILGVLPVVFAIRKEKKPSPWVIPTHYISPE
                     QFNMQPPVSQLENVPKISESIVVETQEPVAISVDDFTASDLGEEIENNLEELLTEIKS
                     ENEELKDIRKKIEFFYSEKVAVLVTAVPGAIGKGEQIVYGILTSESKIEFEGNFVEIC
                     GEIPSNKDIGEDVIIKGNLLENGKFYSLHWEYPDMIVHGYSDDFNLSNESLGA"
     gene            48775..49272
                     /locus_tag="BSPH_RS22675"
                     /old_locus_tag="Bsph_p048"
                     /db_xref="GeneID:6020539"
     CDS             48775..49272
                     /locus_tag="BSPH_RS22675"
                     /old_locus_tag="Bsph_p048"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291685.1"
                     /db_xref="GI:501248667"
                     /db_xref="GeneID:6020539"
                     /translation="MKTSTITQSNVVNNEYIAEEIKNLLLCTPKNISNINLKVNNEWR
                     GIERKLQELEMTIRSLPKGQIKLFSRNNQIQKFVLPTYSYSVSSVGEDYFDDNIIELP
                     EKMYRRFVMLISDQISDIPISLEHRTFYISWEFTETEENDWEFNAEVTVENEIHLPRM
                     VSKYG"
     gene            49410..49724
                     /locus_tag="BSPH_RS22680"
                     /old_locus_tag="Bsph_p049"
                     /db_xref="GeneID:6020529"
     CDS             49410..49724
                     /locus_tag="BSPH_RS22680"
                     /old_locus_tag="Bsph_p049"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417304.1"
                     /db_xref="GI:670468619"
                     /db_xref="GeneID:6020529"
                     /translation="MSNLMTPFNLFVLNNINKNIYNGNSATSDKDPLGKLLFDFIKTF
                     GGWGTAIFTLAVMVLAICLMITSPSPRMRTVMWTGLLVCACAAAIFFSAYFIGPGFKN
                     YF"
     gene            49784..50095
                     /locus_tag="BSPH_RS22685"
                     /old_locus_tag="Bsph_p050"
                     /db_xref="GeneID:6020535"
     CDS             49784..50095
                     /locus_tag="BSPH_RS22685"
                     /old_locus_tag="Bsph_p050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016204245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291687.1"
                     /db_xref="GI:501248669"
                     /db_xref="GeneID:6020535"
                     /translation="MIIVPVDLTGEQKTVMAYFSVRQVLIVLPALAVTFGMLLKLNIP
                     FLSFGWILLIRVLLFLIINAITFSLAFIKLPSRDQYLSHTVLFKIQFWLSQKKYTNIQ
                     L"
     gene            50225..51148
                     /locus_tag="BSPH_RS22690"
                     /old_locus_tag="Bsph_p051"
                     /db_xref="GeneID:6020559"
     CDS             50225..51148
                     /locus_tag="BSPH_RS22690"
                     /old_locus_tag="Bsph_p051"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291688.1"
                     /db_xref="GI:501248670"
                     /db_xref="GeneID:6020559"
                     /translation="MELVDIVARGSFIMLFATLGLAFIGKRRIDRNEPAFGWKRKQFL
                     AEQKSGSLDADKHKEHTAIESKSNPFKLWKERKLLSIRDLLEVKNIEYGIVERDKNEF
                     CAVLGTDYVNFDLLQRSEQQAILEGYQQLFKSVNFEVQLFVLSERQDFRKEKRRFNEN
                     LLNCNSQTIKYNEGVIKSIEETTVEDFRITNKIYYVISYIYEPSKMAKLTREQKEKAI
                     RNEIFLRLEIVRKALSRAKVTAHFNNTIETLNVFKQSLNRDRSLLHEIEEVATKEKTA
                     LYVTLDAATLPDVEGLIRDNLNDEEVNPVGA"
     gene            51252..53147
                     /locus_tag="BSPH_RS22695"
                     /old_locus_tag="Bsph_p052"
                     /db_xref="GeneID:6020410"
     CDS             51252..53147
                     /locus_tag="BSPH_RS22695"
                     /old_locus_tag="Bsph_p052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291689.1"
                     /db_xref="GI:501248671"
                     /db_xref="GeneID:6020410"
                     /translation="MINEGIEFHSDYFIIQIGIGTKKYGRSFYIKPSGYPRKVRIGWL
                     VGLFKAEDINVSVHSKPFDRTDAVRQLKNKLDDYETVVISAQKQDNAGKIEAIGQQVR
                     DAKTLREQIQNNMNSLHFTSISATIYADTLEELNEKSVAVERALAAESIEVVNAYDRQ
                     KEGFLSTQPLGANYLKNSERNLDENALAAMFPHNSSTLNHTGGMPIGVYNNEYIYFNN
                     FDSKLESFSMGIFGISGAGKGVFVKTVIGRGYLDGITKNIILDVEPEYTELTYALGGI
                     VIELRSDDVVSNFSRINPLDVYVEKEVKRRYTPFEYIVEKVNINEKVKEAIEFFKVMK
                     ESTYPKDPNLDPHELDALDKILKKLYAKCGITEDPESLYYHEEGMDEQGNIIFNRVYK
                     KMPTISDVHRDIQALVENGNEMLKNLLSVVSLFLAGRSFGMFDCQTDIRDKDGNPLPP
                     TALDESPIVTFDISKLSKNGIERPLAQHVLMTWVWNRLIVNNPKEKKRVIQDEAWMML
                     KFPSMIEFFKTLSARGRKWNVSLTLVSQRYEMFHRNEEARDIIAQLGTVAFMKQSSSD
                     VEKILEAFHFSDDVGQVIRTAEQGDVVMKAGKEIVYFHVVPTESEWQYINTNMNVTVD
                     ELIAKGG"
     gene            53149..55998
                     /locus_tag="BSPH_RS22700"
                     /old_locus_tag="Bsph_p053"
                     /db_xref="GeneID:6020445"
     CDS             53149..55998
                     /locus_tag="BSPH_RS22700"
                     /old_locus_tag="Bsph_p053"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659276.1"
                     /db_xref="GI:753952684"
                     /db_xref="GeneID:6020445"
                     /translation="MRILKIVMLLFFCFFISPFSANARVDEGAGGGVGNQNTSEADKT
                     TTFNCPGGALISKDVNNAVDKFKDEKANLPEKFIASQLQNFWNIGDINSLSTLIYGNP
                     YCVWADSILRKESSIVMSSNGIFTQAEKEHVIDPILKMFQASYIYILVLAIMVSSVKT
                     MLNSTRGRAMSDLGDDAKMWVASAGFILFYPKITGILFELNAALVLSLKSLLESKGVN
                     LDSFSLIASWKDLFIGDVSPLPLSYIMVIFAEWVLAAVLNGVYILRKILIGLLLVLGF
                     VAAFSLLFARTRPFFGAWLKELCSNVFLQSVHAIVLYTMILMSSVGVSVSTNFISPLF
                     DSGPVLLTATTDEYDMTKTGAGTFFKLIMMAAFIPVTGLITRMLKMGDSTSKLGTAMT
                     MLGVGGFMSTYNLTKQAGSVITGGSVFSSMSNSLSGGDSTNQSFNNTVGTNSPSDSNT
                     TSITMNALGNNSTPWKATKDAISKGVGISTAIGGGMILGPPGAQAGFKLGSKSAELLM
                     QTPRSIGFGVKGISDTLKNAKQYSGPNGVGMKGVMGNLAARRQFFGNMGESVGVMVGQ
                     GAFGRQLGQIASGVSRQAIASLPMEQGGMMFKNSNGLPALGTFQNLAHHYPNEKIQFI
                     QNNQGSGFYLNDNGTLRQIGLTGAADPSLENGVSRVIDYKFRAPNSDIQLDNKGSYSP
                     GSQIALNNSALPSYNDALSRMSSTTTASNVGGLPSSMINPIGQPMKAVNGYPLPLRAQ
                     NRWEGHVEHIASPATNIGNPMARSSLSTGTTTPFAAMSNVTAPIAASTQSSYGQVAST
                     ALNSYQSNLAQYSSHSSSIPSLDLSTSSISGVGNRVVGLPGSTDSVSRTSGAYFVGGL
                     SPTGQITTDSVNMINNPLTPKFDNPSFRADHVNPDSFVYHISPNADLRNNVDIGADKV
                     NQITQRVKKAPSDVQSGWAQLLKNDYSEERKSNIS"
     gene            56015..57901
                     /locus_tag="BSPH_RS22705"
                     /old_locus_tag="Bsph_p054"
                     /db_xref="GeneID:6020454"
     CDS             56015..57901
                     /locus_tag="BSPH_RS22705"
                     /old_locus_tag="Bsph_p054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000383797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659278.1"
                     /db_xref="GI:753952688"
                     /db_xref="GeneID:6020454"
                     /translation="MKKVIMFCCLFLLVFPSFAYAEEGKENSCKSKELLSDERRLQIK
                     EFQDKDATIQESYTIDIFEGFWNIVGINSVSSLVFGNPYCLWSGDNSPLVYGIFPEHY
                     KEQIIDPMFNFFTSLFVGLLVLAMMIFAAKRMINPFNKNLFVDEFLQYFMAAVLITLF
                     WSAVDYVFLFNETIVATFRNLLLSQGIDLDGVAIFASQDDFNFTDIVIIFAEWILMVF
                     LNAIYLLRLFLLTVLMGMGGLAIVSLLYPESRHIFSLWLQDIIGSIFMQSIHALYCTF
                     ILLVFSTVSGEFSVFFKLFCLILFLPLTTFLQGIFKLSSGGTLTGIGLNGVNSIAATV
                     SFGKSMKSLNHRTPNMGKLSETKISALAKGNNSKPWQKTTNLLAKTGMYAGGAAGLVL
                     GPGGVILGGMAGSKMLTSTLQTPRNIAGGLKGLKDTFGAANSKGMSNVMGNIQEKRNF
                     YGNVGESLGTMVGQGKMGRQIGSFASGVSNKRILNSSELGGLSGLSIRDLASRYPESE
                     FIFKQTNEGSGFYKVSDGEDLLISPIGAADTSLADGETRCIDYKSRGSGIEYDSSKGT
                     YNPSERTSSLDRTSDAYIQNSYGTRFADPSFNAQRMNPDDYFKENLNNSVPKPDEHRH
                     PGFV"
     gene            <59162..>60019
                     /locus_tag="BSPH_RS22710"
                     /db_xref="GeneID:23320127"
     CDS             <59162..>60019
                     /locus_tag="BSPH_RS22710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019380455.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417309.1"
                     /db_xref="GI:670468624"
                     /db_xref="GeneID:23320127"
                     /translation="DYMSLYKEAAEACGIDWFVLAAVHGVETNYSKDPVATDPSKGSV
                     VNGELIGAVGHFQFMPLTWVGWGISKDYPTTPKGNLLVDDLSIITSLPNISKYKGYGL
                     DANKDGKADPWDVVDAAYSAACYLGANGYKSGDEASIRKAIQRYNHSNSYVNKVYNLA
                     MNINGGFSEIPVAEGTFTYPAIGRISSPYGYRGKAFHYGVDIASGGKHVPIVAAADGV
                     VSRSEYHYSYGNVVFIKHNLNGKTYETVYAHMRDLPPVKVGENVTKGQTIGTMGTTGD
                     STGIHLHFEV"
     gene            60110..60748
                     /locus_tag="BSPH_RS22715"
                     /old_locus_tag="Bsph_p056"
                     /db_xref="GeneID:6020550"
     CDS             60110..60748
                     /locus_tag="BSPH_RS22715"
                     /old_locus_tag="Bsph_p056"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291693.1"
                     /db_xref="GI:501248675"
                     /db_xref="GeneID:6020550"
                     /translation="MFKEVLQEIKKVFLSKKVVKIFGYSAGLIMVFCLYLWITSPKAN
                     VENIEPLWTNSSSDISAFKDGDIKKLALTDEESYSSVEAAISLFFSYAQHGEVDLFAS
                     SLNHEQFQNDFFQYDVTERHGKIEEALNRISRKGQLESISVVKNGWALEPDTVRLVVD
                     LFYKDLKEPVRIGVLIAGEKEYEAETEETTKVYYVVSSVWEVIRNIEGKVEK"
     gene            60745..61224
                     /locus_tag="BSPH_RS22720"
                     /old_locus_tag="Bsph_p057"
                     /db_xref="GeneID:6020474"
     CDS             60745..61224
                     /locus_tag="BSPH_RS22720"
                     /old_locus_tag="Bsph_p057"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291694.1"
                     /db_xref="GI:501248676"
                     /db_xref="GeneID:6020474"
                     /translation="MNNEPVMLMVKYIQMVLTPVSAIFFIIGLFIFIIMYKNPMRRRT
                     AFLITVMSPIMFMFLLYGVVMICYYTLDGPIQDVNNEGLWFFEGFISSKLSGGYHVFK
                     IIMRPLLILAVLIGMGILHHGSGIPGRKRMGTGILFGFGLIWLLLEIGPSIYTVLSS"
     gene            61440..61700
                     /locus_tag="BSPH_RS22725"
                     /old_locus_tag="Bsph_p058"
                     /db_xref="GeneID:6020528"
     CDS             61440..61700
                     /locus_tag="BSPH_RS22725"
                     /old_locus_tag="Bsph_p058"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659280.1"
                     /db_xref="GI:753952691"
                     /db_xref="GeneID:6020528"
                     /translation="MEENLKKMKEKAYFYKGFGFHYLSAITNEDETVKGGSLFLIGKQ
                     MITLAVSNGYWTDHNGNPYKFKYRGRALYVGKIAVGFGNSDI"
     gene            61822..62373
                     /locus_tag="BSPH_RS22730"
                     /old_locus_tag="Bsph_p059"
                     /db_xref="GeneID:6020499"
     CDS             61822..62373
                     /locus_tag="BSPH_RS22730"
                     /old_locus_tag="Bsph_p059"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291696.1"
                     /db_xref="GI:501248678"
                     /db_xref="GeneID:6020499"
                     /translation="MDTKPIINSPIIKHIGELCNTPITIIATESGAGAPVLLQNLIEQ
                     NKWKIKFKKVDLEWFDLSELEDENTVDIDFTIYVFNDILPSATLNEPLNLFLPEPEKD
                     AYIQHCLHEYFNQNYEIFRSIESEIENNKVIILTTKNLAPIFNKAAKDNTLIVCEHPI
                     LTISVEQKIEDKTITLYEKYPIR"
     gene            62440..62826
                     /locus_tag="BSPH_RS22735"
                     /old_locus_tag="Bsph_p060"
                     /db_xref="GeneID:6020494"
     CDS             62440..62826
                     /locus_tag="BSPH_RS22735"
                     /old_locus_tag="Bsph_p060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291697.1"
                     /db_xref="GI:501248679"
                     /db_xref="GeneID:6020494"
                     /translation="MEDRKIMLNQQDIELIEYMDYQVMNNGMDGWLGNRAYEKVFEFI
                     EILKKRNSVLDQQVASIFSKVTVSGLGYYQHKDSVFIPEIKEMCDEYEKEIEECSKQY
                     QQIGKDFMNSYGLEDYLTKFTKNISS"
     gene            62993..63538
                     /locus_tag="BSPH_RS22740"
                     /old_locus_tag="Bsph_p061"
                     /db_xref="GeneID:6020490"
     CDS             62993..63538
                     /locus_tag="BSPH_RS22740"
                     /old_locus_tag="Bsph_p061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291698.1"
                     /db_xref="GI:501248680"
                     /db_xref="GeneID:6020490"
                     /translation="MNKKYEEIKFFAGNTIEQAVKELLSYKEEGKLVCGEFNGVVLYS
                     DIVTMESAYQKITGKTKAEFDKSQQEWKEKYDEKKKKHEDEIPNLTKVWMEKGREILS
                     EDRWEHWDKIVPVRLNDLNEDMELGASLDIVRILNSNGTLDEAKEKIESQGHSGMSFG
                     LVCAMVKEFSDRGNEFVEYVK"
     gene            63883..64080
                     /locus_tag="BSPH_RS22745"
                     /db_xref="GeneID:23320128"
     CDS             63883..64080
                     /locus_tag="BSPH_RS22745"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417314.1"
                     /db_xref="GI:670468629"
                     /db_xref="GeneID:23320128"
                     /translation="MIDIIIEKPYKVSLLMIGIGLISFFMAYGTNIIWLQLIGVLLGF
                     FSAFGLFAIALFIILSIGNKA"
     gene            64298..64540
                     /locus_tag="BSPH_RS22750"
                     /old_locus_tag="Bsph_p062"
                     /db_xref="GeneID:6020458"
     CDS             64298..64540
                     /locus_tag="BSPH_RS22750"
                     /old_locus_tag="Bsph_p062"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291699.1"
                     /db_xref="GI:501248681"
                     /db_xref="GeneID:6020458"
                     /translation="MYKKITLANIERNNRCQLTDEQFKDVRKEIEYAIDGLNKGIEEG
                     RDYFLDSYMRGYDCELIGMKRICSSIGISIFVNKEE"
     gene            64591..64959
                     /locus_tag="BSPH_RS22755"
                     /old_locus_tag="Bsph_p063"
                     /db_xref="GeneID:6020455"
     CDS             64591..64959
                     /locus_tag="BSPH_RS22755"
                     /old_locus_tag="Bsph_p063"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291700.1"
                     /db_xref="GI:501248682"
                     /db_xref="GeneID:6020455"
                     /translation="MKSIIPDMLKQYKAGIINDEELGNMLKLLIQKAIIDSSDKNNIE
                     SDLSKYIGTISMPNKAVLSDAIHSLMEMQPNASKVAREANVPRNTVIRIWSGEASVEN
                     IRLGTAEALFGYYLKLKGWC"
     gene            64962..65513
                     /locus_tag="BSPH_RS22760"
                     /old_locus_tag="Bsph_p064"
                     /db_xref="GeneID:6020425"
     CDS             64962..65513
                     /locus_tag="BSPH_RS22760"
                     /old_locus_tag="Bsph_p064"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291701.1"
                     /db_xref="GI:501248683"
                     /db_xref="GeneID:6020425"
                     /translation="MSYDSIKEKIQAPFPPGTVQVKEQNKKAYIPAQVYWNRLDEVAG
                     PMVNWSIKSVDIAESHVIVIGTLHIAEVSRDGIGYNSFKDEHLIKAAISSAESEAFRN
                     ACDKYKMGWVDLAPYRAWSDNPGINIEKVTPTIQGDSYERKCLKCKKILDKQDNIFLE
                     IHSIRQNYCSEHVPQYLIKRNGG"
     gene            65521..65988
                     /locus_tag="BSPH_RS22765"
                     /old_locus_tag="Bsph_p065"
                     /db_xref="GeneID:6020478"
     CDS             65521..65988
                     /locus_tag="BSPH_RS22765"
                     /old_locus_tag="Bsph_p065"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417317.1"
                     /db_xref="GI:670468632"
                     /db_xref="GeneID:6020478"
                     /translation="MKVKYLTCSLCNHFDAVNKKCSVLPFDTTSNEREYAGRCAAENR
                     FVRNINVIPDYFNYFNDDEVPVCFEEDLSNLPKDENGNPLFVITKRGLERAIPADPEM
                     KLTSSRFIGVEKIYTLQGQSELLQEIGYTQLQKLAFIKGTIISPLLEVQLKCV"
     gene            complement(66144..66545)
                     /locus_tag="BSPH_RS22770"
                     /old_locus_tag="Bsph_p066"
                     /db_xref="GeneID:6020487"
     CDS             complement(66144..66545)
                     /locus_tag="BSPH_RS22770"
                     /old_locus_tag="Bsph_p066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291703.1"
                     /db_xref="GI:501248685"
                     /db_xref="GeneID:6020487"
                     /translation="MGGQITNNTPEVLMVYGPPNNNEYDNGTYIAKSGLISDKNIDVD
                     GFYVPADRKIKQFSGIVVDGPVAVKFINGIHFTVTQEGAIYIVDRPNFGLFKPSEYCR
                     PTNYPKCVNWDIPNWTYPEVLSTCADCINKI"
     gene            66786..67280
                     /locus_tag="BSPH_RS22775"
                     /old_locus_tag="Bsph_p067"
                     /db_xref="GeneID:6020551"
     CDS             66786..67280
                     /locus_tag="BSPH_RS22775"
                     /old_locus_tag="Bsph_p067"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291704.1"
                     /db_xref="GI:501248686"
                     /db_xref="GeneID:6020551"
                     /translation="MTEKELEISNNLSYEDNQFANEMGKLINLNNPQFYFRINLNPVP
                     TQVFQLSVDFNTNFENVVVIYYADNEKIYIPKYVEKNYTKDGAKVSHGIGFGENSKWN
                     GKLIVAGFHKTTEPNPNSPWYLSPVKVIKQEIAPSGHHVIEFGFEDGTGWDFNAIRIT
                     LWWE"
     gene            67735..68109
                     /locus_tag="BSPH_RS22780"
                     /old_locus_tag="Bsph_p068"
                     /db_xref="GeneID:6020489"
     CDS             67735..68109
                     /locus_tag="BSPH_RS22780"
                     /old_locus_tag="Bsph_p068"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291705.1"
                     /db_xref="GI:501248687"
                     /db_xref="GeneID:6020489"
                     /translation="MKKINLGTTDFERFNSLYQVEVECYCEQTVIPMDMNNFEFTNIR
                     SFGEASVFKLINKQSGIPVLFLENAELIYSELTISLVRLLKCTHETEVFEQLTQTVGF
                     MFTEDPIDIIGIYLEKYNGDIK"
     gene            68109..68978
                     /locus_tag="BSPH_RS22785"
                     /old_locus_tag="Bsph_p069"
                     /db_xref="GeneID:6020522"
     CDS             68109..68978
                     /locus_tag="BSPH_RS22785"
                     /old_locus_tag="Bsph_p069"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291706.1"
                     /db_xref="GI:501248688"
                     /db_xref="GeneID:6020522"
                     /translation="MQLRLFDISLFPTNTTEPAVSLTLLEKLEQVEMTTETRISSQDN
                     EHCIQQEKLYKGAFTLLKNTLDAFEAHYELQVNDFNLDYSKRGYIDSHDDIRHIKTRI
                     DSNYEKFVSRMVSYFEKEYTVTLDANCIIEKYTPESIDYSKVVEEIFEQLGGLNFSEK
                     AEQELIANSRSLVRNKSNIKITKSKITIAYLVYWSTGWNGKYRLGYSNNNIEKLFEAL
                     SHFENKETKMLEPFKVHFELLKKGEEEYDILKKYDYSLSKVAGIRFYKNLKVEIFFMS
                     NEDADTFNKSYLL"
     gene            69174..70085
                     /locus_tag="BSPH_RS22790"
                     /old_locus_tag="Bsph_p070"
                     /db_xref="GeneID:6020475"
     CDS             69174..70085
                     /locus_tag="BSPH_RS22790"
                     /old_locus_tag="Bsph_p070"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291707.1"
                     /db_xref="GI:501248689"
                     /db_xref="GeneID:6020475"
                     /translation="MEDQLMLFDIDSFATSQKTVVEEVINEVVVTTNPLGNLMERLNA
                     VEITTDNRISEIELDYCKKIEAVYLDSKQVLEDVLSSLTTVFDRQKNVKINGKDLYYL
                     SEFEDIYYVEKRLTYIYRRFVSDITCFFAQRHNVTISSDDIKKKYSYETITYSLIVDE
                     IFEQLGGLNFKEKAIEEIKTNSRKIVYQKDRIIVSRNKMSIDDLIWWNSYAYDGGKEL
                     DYSDSNLRSLFIALSHFIGNKETMLKELENIYAALRIGDKHYDIFSKYEINIGCLVSF
                     KVFKNRKVELVFSDNTSAEAFKNEYLL"
     gene            70137..73133
                     /locus_tag="BSPH_RS22795"
                     /old_locus_tag="Bsph_p071"
                     /db_xref="GeneID:6020513"
     CDS             70137..73133
                     /locus_tag="BSPH_RS22795"
                     /old_locus_tag="Bsph_p071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_012291708.1"
                     /db_xref="GI:501248690"
                     /db_xref="GeneID:6020513"
                     /translation="MKYKNSNVNIPQEQRKALNEKILYLLDNNLTQQYNISAEDVFNA
                     YTGDGGLHDLSFNKFDSYHAFSEAKKEIENGQFFTPALLAKYLVECLKPTEYELIADL
                     TSGMGSFFNYLPNELNIYGNEIDLKAFKVSRFLYPSANLTNQDIRYYKSEVQFDIVLG
                     NPPFNLQWQVNDNKYVSQLYYCIKAHEVLKAGGLMALIVPKSFLADDFTDGGMIAEID
                     HMFDFIGQTLISKDAFSSLGVTSYETKIMFFQKRSEHLQQRPYKSNEFISVSDASDIH
                     ENIIKPVKHQLEAVRAKIQLENRRSLNSEYEYKKNKLLFDIKRNPKLQKHYANCLAYA
                     ERLHTQEKPNNMDDKEWQQKKVTENRVISYLKQALQKQHRTEETRTMTLVKTKYGLQY
                     KAYTPNDKKQLKALNLSLVPFGVNSYPFSDNKYKKLSEKKIKAYNLQETPFQKICPSK
                     EVAQWLTNLKIIDQVNQEEITLNDIQRDDTAKMLMKPYGYLQWGTGAGKSVSAIAQMK
                     YRLEKKQVRNIFIVAPAIAINNNWDDILANYGFNHIRIQKLKDLDQIKSGQIVILTFG
                     MLTKYERQLKRFIKLQSQKVMLVLDEADGICNPSSKRSQATLNVFRKVRYKLLLSATS
                     TRNNIPESFTAFELLYNNSRHMLSRNPTIIVEERKTKDLQEKENHLLNKAFPAYKKGH
                     THFRRSFSPERASVFGIGKLNQDIYNAEYLSDLINKTMITRTFEEVSGKHIYKLVQDP
                     VKFNPMENELYGIVVNEFHRIAHMFQSTGNSRKDAMLRIIQQLNSLLKACVNPQEFNE
                     YRSHQMPSKAVKMLDMIQKWSNDYIVFGCTHIKTVERYEAYIRNAFPDRPLFVITGDK
                     TSLNRRKAIIKELKQSKRGILICTQQSLSSSMNIDFVNNIVLLEMLWNFASMHQFFAR
                     FIRYTSTEQKEVHFVTVENSIESNMLQLIIAKEKLNNFMKNESIDEEEILEKFGIDFD
                     LVNMLLTKETDSEGKSYIQWGNQLVV"
     gene            73372..73563
                     /locus_tag="BSPH_RS22800"
                     /old_locus_tag="Bsph_p072"
                     /db_xref="GeneID:6020394"
     CDS             73372..73563
                     /locus_tag="BSPH_RS22800"
                     /old_locus_tag="Bsph_p072"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291709.1"
                     /db_xref="GI:501248691"
                     /db_xref="GeneID:6020394"
                     /translation="MNKKVTEINRYIGLEPQEFKVVGYSVPNNERDSLQQKCKIKISH
                     DDVALNIQQYLRWTPQLVV"
     gene            73781..74119
                     /locus_tag="BSPH_RS22805"
                     /old_locus_tag="Bsph_p073"
                     /db_xref="GeneID:6020495"
     CDS             73781..74119
                     /locus_tag="BSPH_RS22805"
                     /old_locus_tag="Bsph_p073"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659282.1"
                     /db_xref="GI:753952693"
                     /db_xref="GeneID:6020495"
                     /translation="MRKKNTEIEHVVDTFTKEILEDCVKYTSNFEGFEYYIKESHLGM
                     FLLVDNFSTTPFVLTKCTINDNDILPSLEAMYQDSIVATESLEEFKEEVQTHIYLEAK
                     ALVEKYLALD"
     gene            74366..74683
                     /locus_tag="BSPH_RS22810"
                     /old_locus_tag="Bsph_p074"
                     /db_xref="GeneID:6020389"
     CDS             74366..74683
                     /locus_tag="BSPH_RS22810"
                     /old_locus_tag="Bsph_p074"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291711.1"
                     /db_xref="GI:501248693"
                     /db_xref="GeneID:6020389"
                     /translation="MRLVIFAILTFFLIMFVNSYSQDPKIIEGTIEKKFYQEKKCIQE
                     LTYDPALNMYLPKENCEGPRWTITINNKEFQVTETLYNKLEVDSFYSLSYHPFKGLSL
                     LKK"
     gene            74881..75141
                     /locus_tag="BSPH_RS22815"
                     /old_locus_tag="Bsph_p075"
                     /db_xref="GeneID:6020439"
     CDS             74881..75141
                     /locus_tag="BSPH_RS22815"
                     /old_locus_tag="Bsph_p075"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659283.1"
                     /db_xref="GI:753952694"
                     /db_xref="GeneID:6020439"
                     /translation="MYIKGRKVKLITSKVFAFWSFSTILFALIAKVTFDSNVGDELTI
                     KQWVSFISATFCVIILCLPVVISIVTIINKCVERILRKEKIY"
     gene            75466..75768
                     /locus_tag="BSPH_RS22820"
                     /old_locus_tag="Bsph_p076"
                     /db_xref="GeneID:6020426"
     CDS             75466..75768
                     /locus_tag="BSPH_RS22820"
                     /old_locus_tag="Bsph_p076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000700013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291713.1"
                     /db_xref="GI:501248695"
                     /db_xref="GeneID:6020426"
                     /translation="MMLELNTITKCYFFEDISGDISLNKLDLTANLCPSDVEHYYRLN
                     VKGLFYPVFPQSLLKRQLVGYFIDEEYNEFIYIYKDDKKYIIDETMGDLGWLPLKE"
     gene            76395..76694
                     /locus_tag="BSPH_RS22825"
                     /old_locus_tag="Bsph_p079"
                     /db_xref="GeneID:6020449"
     CDS             76395..76694
                     /locus_tag="BSPH_RS22825"
                     /old_locus_tag="Bsph_p079"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659285.1"
                     /db_xref="GI:753952696"
                     /db_xref="GeneID:6020449"
                     /translation="MKKRSFVKDVNTAMVLKDYKEYENNINAVGANAEILVGTKEFAE
                     ILGWTKAKLSTKYSRQRDGQKVKDPLPEPIQLLAATPVWTLEQAMNYKKSLSKEE"
     gene            76776..76997
                     /locus_tag="BSPH_RS22830"
                     /old_locus_tag="Bsph_p080"
                     /db_xref="GeneID:6020466"
     CDS             76776..76997
                     /locus_tag="BSPH_RS22830"
                     /old_locus_tag="Bsph_p080"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291717.1"
                     /db_xref="GI:501248699"
                     /db_xref="GeneID:6020466"
                     /translation="MDITNINVFLTNQEEAYLKLCFVELENFREKGVLVEGEIRKLNN
                     QFFNGNPTTLFTIGELVYREIAIRHFNVC"
     gene            complement(77038..77337)
                     /locus_tag="BSPH_RS22835"
                     /db_xref="GeneID:23320129"
     CDS             complement(77038..77337)
                     /locus_tag="BSPH_RS22835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:YP_001552219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659287.1"
                     /db_xref="GI:753952699"
                     /db_xref="GeneID:23320129"
                     /translation="MCYVMKLCYILFCFFLYFNNDFYKCLAITKTMFRVTIYNIRTIG
                     NVVYCLAYHFLNFFFIHILTSIVNFHSEIALFWLLKTLILCILIFCSNIYSTEIN"
     gene            <78209..78520
                     /locus_tag="BSPH_RS22840"
                     /old_locus_tag="Bsph_p084"
                     /db_xref="GeneID:6020468"
     CDS             <78209..78520
                     /locus_tag="BSPH_RS22840"
                     /old_locus_tag="Bsph_p084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017474172.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659321.1"
                     /db_xref="GI:753952758"
                     /db_xref="GeneID:6020468"
                     /translation="KANDKSIWYYKGLTNETLPYVLVVNYGVFPKTKKLRNEDVHYIF
                     DKKSYGDDLFLKKKISHMFKITKSEDIESIELNYTTNGTAPFYVWKYVKEFMYIDSDI
                     D"
     gene            78748..79029
                     /locus_tag="BSPH_RS22845"
                     /db_xref="GeneID:23320130"
     CDS             78748..79029
                     /locus_tag="BSPH_RS22845"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659289.1"
                     /db_xref="GI:753952702"
                     /db_xref="GeneID:23320130"
                     /translation="MNNSSQTKTLSSIKEFTDNPFVFIVLAGFLAVSARILFSIFPNL
                     LGVVTPYAFIFFSITCVIGAIYYYKERKFIMTALFIFNSFAIILLLFKL"
     gene            complement(<79454..>79903)
                     /locus_tag="BSPH_RS22850"
                     /db_xref="GeneID:23320131"
     CDS             complement(<79454..>79903)
                     /locus_tag="BSPH_RS22850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012094735.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659322.1"
                     /db_xref="GI:753952760"
                     /db_xref="GeneID:23320131"
                     /translation="YSMKAGDIFLTNATVSSGIVGHAGIAINDTYILHIPGPNKTTQL
                     LTLSDWKSKYAGSNGTTWVHRVNSSDLASKAATWALKNYYNSSGSTGSQNIKPSYKIT
                     TALSSTDPTYCSKIVYQAYYNADKDVSGTWVYNRSGIVSPYDFRSNVF"
     gene            80283..80624
                     /locus_tag="BSPH_RS22855"
                     /old_locus_tag="Bsph_p086"
                     /db_xref="GeneID:6020570"
     CDS             80283..80624
                     /locus_tag="BSPH_RS22855"
                     /old_locus_tag="Bsph_p086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009925059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659290.1"
                     /db_xref="GI:753952705"
                     /db_xref="GeneID:6020570"
                     /translation="MKKILAILLIFTFFSIITIYMYFSKVPGKLEEAESAFENYIEAQ
                     GVSENNIKSKEFNKNYKFGGYDITVTYKDEPSSYVYEYFYNAKTKKINLIVLDDGRSI
                     NEGIKYPPIKE"
     gene            81095..82201
                     /locus_tag="BSPH_RS22860"
                     /old_locus_tag="Bsph_p087"
                     /db_xref="GeneID:6020569"
     CDS             81095..82201
                     /locus_tag="BSPH_RS22860"
                     /old_locus_tag="Bsph_p087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012961021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase XerS"
                     /protein_id="WP_012291724.1"
                     /db_xref="GI:501248706"
                     /db_xref="GeneID:6020569"
                     /translation="MPAITPKVLQAEKHIEDATPLFPVYVQEYIRDKKSKYSPLTLSG
                     YLYNIEKFLNWLLEEGIVDAKNIRDIHYESLSTLAKLDVELFVDKMASEILSGEDDNE
                     PKRRSKTSVARAVQALKSLFRYLTVETEDKVTQEPYFNRNVMLKISVDLELESKSRRS
                     KRIEKKTYKSDEIDELLHFIDEEYAATLSSRKLTYFEMNKIRDLAILAVLFGSGIRGN
                     ELVGLKIKDVYMKDCYLDVIRKGDKADSVAIRPSALTYLEEYLKQRSKLYSVKTNYPF
                     VFVAKSPDGTVKQMSNQTLIRLVKKYTLAYGKEITPHKARYTFSKQYQAQGGTLIGLR
                     DQLGHQNIETTSLYTTESMKEQKDVVTRMDKPSN"
     gene            complement(82592..82789)
                     /locus_tag="BSPH_RS22865"
                     /db_xref="GeneID:23320132"
     CDS             complement(82592..82789)
                     /locus_tag="BSPH_RS22865"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659292.1"
                     /db_xref="GI:753952709"
                     /db_xref="GeneID:23320132"
                     /translation="MTEQHDFYSVVLNLFLLIFVSGVLVYISFMKYDLPIFIYILCGF
                     EILLNIFNICRCTYRLIRFDY"
     gene            83113..83700
                     /locus_tag="BSPH_RS22870"
                     /old_locus_tag="Bsph_p088"
                     /db_xref="GeneID:6020568"
     CDS             83113..83700
                     /locus_tag="BSPH_RS22870"
                     /old_locus_tag="Bsph_p088"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291725.1"
                     /db_xref="GI:501248707"
                     /db_xref="GeneID:6020568"
                     /translation="MVTSLIKREIAEQFNIYKDELGIEEKVPLKFRGLGNGGGYFWGQ
                     VKLENGTVKQWSSYPERTKFLLIHELVHAKYKETKNPFLSTLIITPSLVLLYLMRELR
                     ANTIAYQTLGCKDSILEDYFYNYYPTQSNGYFNLSGGYVSGKTNVTLIKANPIWNRNA
                     IEEAIEFFTSEFSYLKRTSKRKIEQVKNCFIEQLY"
     gene            complement(83853..84125)
                     /locus_tag="BSPH_RS22875"
                     /old_locus_tag="Bsph_p089"
                     /db_xref="GeneID:6020567"
     CDS             complement(83853..84125)
                     /locus_tag="BSPH_RS22875"
                     /old_locus_tag="Bsph_p089"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659294.1"
                     /db_xref="GI:753952713"
                     /db_xref="GeneID:6020567"
                     /translation="MPHFLNNHKKDCLFMTKQYIASIKNTTTGSWLKSTNSHNNTTSS
                     GIIHSYDHTLLKEERLIFKDKNVAENTLKTLQVNYPDIFILVNETI"
     gene            complement(84175..84600)
                     /locus_tag="BSPH_RS22880"
                     /old_locus_tag="Bsph_p090"
                     /db_xref="GeneID:6020566"
     CDS             complement(84175..84600)
                     /locus_tag="BSPH_RS22880"
                     /old_locus_tag="Bsph_p090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291727.1"
                     /db_xref="GI:501248709"
                     /db_xref="GeneID:6020566"
                     /translation="MAIIQIIKKLISWLFIFILLYLSIDGMYIISTAISEVPDKKTAI
                     ESIRAIVASLLALTIALMFIFFYPIRMFRSYKEGFLIIFMYLLLLSFAFVGNLEITFY
                     TGLTYLVLNLVLDITLTIVQKNHDKKLEPKNNNTVKVPN"
     gene            complement(84694..85524)
                     /locus_tag="BSPH_RS22885"
                     /old_locus_tag="Bsph_p091"
                     /db_xref="GeneID:6020565"
     CDS             complement(84694..85524)
                     /locus_tag="BSPH_RS22885"
                     /old_locus_tag="Bsph_p091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016204180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659295.1"
                     /db_xref="GI:753952716"
                     /db_xref="GeneID:6020565"
                     /translation="MNAARLQDGTIIIAKDYYSENHGSEIYCMDIACGAPVHFVQEGK
                     KVSFFKTSGKGESVHKELCAFAAKMTFERSLFKVTQFQQELKSQVEPIMVRLNTNKLD
                     PDYVSRSVEREGSNKEVDARELKISNESPKPPQTVSSLKSLKKLFQTADPDLLASIFI
                     SYNGHKLPITDLISDQYIAAKKLWQGTSLNVNYFVHGEVTSIVRLDKVWYFNMGDDRF
                     PFTLVVFEKYFEHFTYTDEDLLNRTILVMGRLKKNDYNKDKFVTEMVIKADAYIEFLD
                     "
     gene            complement(85773..86036)
                     /locus_tag="BSPH_RS22890"
                     /db_xref="GeneID:23320133"
     CDS             complement(85773..86036)
                     /locus_tag="BSPH_RS22890"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417339.1"
                     /db_xref="GI:670468655"
                     /db_xref="GeneID:23320133"
                     /translation="MKNWHLIHFVVPLLWVLVLNLLKDSPPILLGLENKTLLTVVLFL
                     IISWLIYDVIRVREQKVLLKMTVFTATGLICGGLLSKLIISII"
     gene            complement(86058..87344)
                     /locus_tag="BSPH_RS22895"
                     /old_locus_tag="Bsph_p092"
                     /db_xref="GeneID:6020563"
     CDS             complement(86058..87344)
                     /locus_tag="BSPH_RS22895"
                     /old_locus_tag="Bsph_p092"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291729.1"
                     /db_xref="GI:501248711"
                     /db_xref="GeneID:6020563"
                     /translation="MGDANLVITTKNCETRYLPYKTFHIQDNPTVRDMLNEIYSNKEN
                     IQLSCSCNPYNTSMVLSKSKSGRFFVKSKPHSKSLHFKCEFAYTQDGSKESTHFPSIY
                     SPELFISDRDNNYLIEFDLSLNLEPLKRNTLALKLSNLGLELLARAWDYLMDNYMKKK
                     SHYYPDLNSIKFSLINLFVGKKDYHKGNTITPPLTSVKLDKNINLEDILYLGLHSTAA
                     IYAINKRYGVYAVVLTSLYNSEISEHDEEYYLLTLSINNRIKGKVRQYHRKFIMKKTL
                     FKSSIEKYSIEQFSHLDNFLNERKVPYYLIGLAKSDSYANLPELVEIALIPVNYNGVI
                     VRNIEELRFTNLLCVRRRIFKKPISRTIHYNNIAPSFILYDSIKPTICEVIVDTTNSL
                     EKIEYFNNQTDFLFYAWFANKYTKITENIPDVYINE"
     gene            complement(87429..87695)
                     /locus_tag="BSPH_RS22900"
                     /old_locus_tag="Bsph_p093"
                     /db_xref="GeneID:6020560"
     CDS             complement(87429..87695)
                     /locus_tag="BSPH_RS22900"
                     /old_locus_tag="Bsph_p093"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291730.1"
                     /db_xref="GI:501248712"
                     /db_xref="GeneID:6020560"
                     /translation="MRLHKVLVDKKQYVLIKEYESKYGDNIRSLDFMIPMKIQGAWGL
                     YKVHYCYASFYNRYYAELELKEKADGKFEALLLAIKNASKGGMI"
     gene            complement(87836..88447)
                     /locus_tag="BSPH_RS22905"
                     /old_locus_tag="Bsph_p094"
                     /db_xref="GeneID:6020558"
     CDS             complement(87836..88447)
                     /locus_tag="BSPH_RS22905"
                     /old_locus_tag="Bsph_p094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002415202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291731.1"
                     /db_xref="GI:501248713"
                     /db_xref="GeneID:6020558"
                     /translation="MHSFKWGITIAIILLLSGCQYNAPDYGEAAKNNTDTEDENGIET
                     TTTEIISWNGVVTSIDEDLKIHLETTTPEFPHKEIALAAIELPIVRDHVLSREVQQIL
                     TDLLVAETVRIEVDLKDPKNTDIPHAYIYIDDMRVQDLLVRSGLAFLDGDNTMYTSHL
                     MTLQEEAIDQLKGIWANKSSSLSDSILTGIKENMVDIIESSKN"
     gene            complement(89043..89372)
                     /locus_tag="BSPH_RS22910"
                     /old_locus_tag="Bsph_p096"
                     /db_xref="GeneID:6020555"
     CDS             complement(89043..89372)
                     /locus_tag="BSPH_RS22910"
                     /old_locus_tag="Bsph_p096"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291733.1"
                     /db_xref="GI:501248715"
                     /db_xref="GeneID:6020555"
                     /translation="MFDKFPYTRKVIQDLEYENYLDQTEWLFCDDETALLTLAKLVKT
                     SEQLTSSNIPDRLAAKERVNEDYLEVGRSVQVLARNEARHQLSLSNDDVANLFSSVEI
                     GGARFMN"
     gene            complement(89378..89704)
                     /locus_tag="BSPH_RS22915"
                     /old_locus_tag="Bsph_p097"
                     /db_xref="GeneID:6020554"
     CDS             complement(89378..89704)
                     /locus_tag="BSPH_RS22915"
                     /old_locus_tag="Bsph_p097"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291734.1"
                     /db_xref="GI:501248716"
                     /db_xref="GeneID:6020554"
                     /translation="MKNKQPEIIYRYIRKKTRDILDGEDLILILVDVRKIHTVRRFNK
                     ESTKVISGGLYQNEFTVDDQPDYIKDLPFGRYAIEISEEEFEYLSLLSQNDVQSFIRY
                     IKRTSR"
     gene            complement(90419..90646)
                     /locus_tag="BSPH_RS22920"
                     /old_locus_tag="Bsph_p098"
                     /db_xref="GeneID:6020552"
     CDS             complement(90419..90646)
                     /locus_tag="BSPH_RS22920"
                     /old_locus_tag="Bsph_p098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_012291735.1"
                     /db_xref="GI:501248717"
                     /db_xref="GeneID:6020552"
                     /translation="MNNLNVAFGKVLKIYRKDAGLSQEQLALQCDLDRTYIGLLERAE
                     RQPSITTIFKICTALNVKPHEFIKEVEKLIN"
     gene            complement(91109..91378)
                     /locus_tag="BSPH_RS22925"
                     /db_xref="GeneID:23320134"
     CDS             complement(91109..91378)
                     /locus_tag="BSPH_RS22925"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417344.1"
                     /db_xref="GI:670468660"
                     /db_xref="GeneID:23320134"
                     /translation="MAFQTVWYNRKNKTRVIPMCPKCNQMKKKTSKKRIYTQKNGIKV
                     IITHIPAEECKCDYYITIADALTIETHLSKNTYNEPTYLNFNELK"
     gene            complement(<91483..91764)
                     /locus_tag="BSPH_RS22930"
                     /db_xref="GeneID:23320135"
     CDS             complement(<91483..91764)
                     /locus_tag="BSPH_RS22930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001995888.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417346.1"
                     /db_xref="GI:670468662"
                     /db_xref="GeneID:23320135"
                     /translation="MKKQNKHMQSEWDKELEEIKKCVKQGNVLSSHILDRLEERGISI
                     MDLVAAILQGEIVEGYDVAQYPNYRNPNMIRNLIGMDTQGRKLKIGVAIE"
     gene            complement(92148..93125)
                     /locus_tag="BSPH_RS22935"
                     /old_locus_tag="Bsph_p101"
                     /db_xref="GeneID:6020546"
     CDS             complement(92148..93125)
                     /locus_tag="BSPH_RS22935"
                     /old_locus_tag="Bsph_p101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009790740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417348.1"
                     /db_xref="GI:670468664"
                     /db_xref="GeneID:6020546"
                     /translation="MEKEQVKGYSIQEITELLGVVEMTVYQYIKKGLLEEVDQPNLKY
                     TINGQRLFTVESVEALKDKMTVGKDYISLNAYAKQNGINQIVLKKLIAENDIDIPKGT
                     QGLREVFLITPDIKAQLDKLVLENSFTHFKTKSKYYNSKYDIALLQSFVDTEGKAFRI
                     VKNGAKWGVYEETGFTQFECLDGLKPLYSIHKPTVNALSMYVYFKIPNEDKNRYNYVD
                     AIYATFGIENAQLLLTDTQIAVRVKVSSWSMSEDDKHLENLLTLNQYASNGELIYIDN
                     ILSVESTDKRVVVILPKDIHSKLSKHAKDQKITDSKAAQQIILDYFENR"
     gene            complement(93166..93582)
                     /locus_tag="BSPH_RS22940"
                     /old_locus_tag="Bsph_p102"
                     /db_xref="GeneID:6020544"
     CDS             complement(93166..93582)
                     /locus_tag="BSPH_RS22940"
                     /old_locus_tag="Bsph_p102"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291739.1"
                     /db_xref="GI:501248721"
                     /db_xref="GeneID:6020544"
                     /translation="MVVLEQIQLFTEEQFDQSPESNFKKGSSTKSIPLFEEKLLNKRI
                     TPLLKAAKIGSAELRVCIRGVYTHWMVVEVSTLTASVTMTIMNNGDADYIHWQSGPCT
                     IEYENQYFNKRYNPNTFFYLEKRLEQSLIDFLSYKT"
     gene            complement(93647..93991)
                     /locus_tag="BSPH_RS22945"
                     /old_locus_tag="Bsph_p103"
                     /db_xref="GeneID:6020541"
     CDS             complement(93647..93991)
                     /locus_tag="BSPH_RS22945"
                     /old_locus_tag="Bsph_p103"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659297.1"
                     /db_xref="GI:753952719"
                     /db_xref="GeneID:6020541"
                     /translation="MGNKSTVIILLTGFTMVIGLGFYVIKEYYRILDPEEHTVTNFKL
                     IENTTYSYLEFESNNETMKINIDNIRNIILSDENYSYYSYLRPHYTIHFTEEDYERFF
                     SENDKGKGNSAE"
     gene            complement(94847..95026)
                     /locus_tag="BSPH_RS22950"
                     /db_xref="GeneID:23320136"
     CDS             complement(94847..95026)
                     /locus_tag="BSPH_RS22950"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659299.1"
                     /db_xref="GI:753952722"
                     /db_xref="GeneID:23320136"
                     /translation="MGIFNPDNKGIIKISSLGNTRLSSLTDDFMKRLGYVRCDKDGTP
                     LIKPLISKDYLKMLR"
     gene            complement(95110..96081)
                     /locus_tag="BSPH_RS22955"
                     /old_locus_tag="Bsph_p104"
                     /db_xref="GeneID:6020536"
     CDS             complement(95110..96081)
                     /locus_tag="BSPH_RS22955"
                     /old_locus_tag="Bsph_p104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_031416906.1"
                     /db_xref="GI:670468182"
                     /db_xref="GeneID:6020536"
                     /translation="MCDFCSTVYDSKEELDHKDEGFWCEACDGFTYFNHTRPNHDRFI
                     LILEDPSEPALKQEYKTDIKLSSHLSPLRYPGGKSKLVNYLYSHLSESKRKTLYSPFV
                     GGGSYELALLHSEIISQLKINDLDYGVFSLWWTMLHMPSELIYRIQNDIPSRNQYFAA
                     QRNIKNKFKGQDMIEAAWDTLLVNRLAFSGIPKAHPLGGKNGTQSKLLARWSPKTLIK
                     RIQAISEMADKITITCQDAYGFVEEAYWDTDGTIFVDPPYVSKGEALYNHYYTATDHK
                     NLAFLLNHLYQGMPGADIIVTYDYNRLITDSYEYQTESHVIGRKYSI"
     gene            complement(96287..96655)
                     /locus_tag="BSPH_RS22960"
                     /old_locus_tag="Bsph_p105"
                     /db_xref="GeneID:6020533"
     CDS             complement(96287..96655)
                     /locus_tag="BSPH_RS22960"
                     /old_locus_tag="Bsph_p105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009328344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659301.1"
                     /db_xref="GI:753952725"
                     /db_xref="GeneID:6020533"
                     /translation="MDYIVDFVKSQSTEFLLGCYFEIDEWKRSGTITNGYLLELQSRF
                     NLNSNQLFGIGALLHEQLIQKTAILFNFCVQWLIHERLLCTLNNKDESAFYYPNDSAF
                     TFYLNREEQCICSSSRNKYS"
     gene            complement(96842..97522)
                     /locus_tag="BSPH_RS22965"
                     /old_locus_tag="Bsph_p106"
                     /db_xref="GeneID:6020530"
     CDS             complement(96842..97522)
                     /locus_tag="BSPH_RS22965"
                     /old_locus_tag="Bsph_p106"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291743.1"
                     /db_xref="GI:501248725"
                     /db_xref="GeneID:6020530"
                     /translation="MFNSNYRKEEKSPPLSIKNGLQDLERDMIHMLKESYNYITKHPK
                     AKIISGINALFTFALWFILLDFYRYYNNVFGESNLFFNLYEMISLPKENLYIIAGLHL
                     ITTTLTVYFLGNAVTFLLERIRFERHITNKSIDTYLKQERSMIIFLFGFLTGFIFYLV
                     ILKDMQFHQFILRDVIVCIFMLITIFVYRYNKLVLKFSNDMKNQVLNTYLEAIESLIE
                     EKKNEMND"
     gene            complement(97597..97923)
                     /locus_tag="BSPH_RS22970"
                     /old_locus_tag="Bsph_p107"
                     /db_xref="GeneID:6020527"
     CDS             complement(97597..97923)
                     /locus_tag="BSPH_RS22970"
                     /old_locus_tag="Bsph_p107"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291744.1"
                     /db_xref="GI:501248726"
                     /db_xref="GeneID:6020527"
                     /translation="MMLNLFIKRKKEIVTTITISSKKSPVKIGDNQKSCLISVKIGNE
                     EFFYFTDVNIHYKIKDFPLYAVEYLKNFGKGFWCKVEKQIIKKDTFIKINNHYFNVND
                     LNIKLN"
     gene            complement(97945..98346)
                     /locus_tag="BSPH_RS22975"
                     /db_xref="GeneID:23320137"
     CDS             complement(97945..98346)
                     /locus_tag="BSPH_RS22975"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659302.1"
                     /db_xref="GI:753952727"
                     /db_xref="GeneID:23320137"
                     /translation="MSSQSIIRKILLIISIVFYNLILVGCNDEQSMGSKELIFLEKTK
                     DYGYPLFIFESIVDKKYYSIEVTNWEYDNTIFEDGEKIEVDARTAKELDVIDRGLFSL
                     FFNFAQTTDLEVYINDDWQPLFEMTDYSKSN"
     gene            complement(98672..99679)
                     /locus_tag="BSPH_RS22980"
                     /old_locus_tag="Bsph_p110"
                     /db_xref="GeneID:6020520"
     CDS             complement(98672..99679)
                     /locus_tag="BSPH_RS22980"
                     /old_locus_tag="Bsph_p110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659304.1"
                     /db_xref="GI:753952730"
                     /db_xref="GeneID:6020520"
                     /translation="MELYIQFEFESIKMIAKQTSFTKLERLYGFYFYDLTHPEDDEHF
                     PDAIVKEGAAHFNYWGSIMTDRPIEQVEHLGQYYIADWALNLDDEEAPAPNEDFVNCT
                     QFYTYDFYVSGVENEENIKFHRVDNLLDLIEPYEYSTQELTMDRTWNMPNKNTFEIHS
                     IKDLLKEELTGGLIIDPFANNNSLAHMTNDLNTKYETDFHMDALEFLKLFADESVDVV
                     LFDPPYSPRQVKEAYESIGLDTQGGRLTRASYWSNLKKEITRILRVGGKAISCGWNSG
                     GMNNKDVFHINRIRLVAHGGNHNDTIATVSVKTKRIENIYVVEQAKVKNNQDYKQLSL
                     W"
     gene            complement(100278..100490)
                     /locus_tag="BSPH_RS22985"
                     /db_xref="GeneID:23320138"
     CDS             complement(100278..100490)
                     /locus_tag="BSPH_RS22985"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659305.1"
                     /db_xref="GI:753952732"
                     /db_xref="GeneID:23320138"
                     /translation="MRHHLLITIIFLKVSTSVSLAILIYLESILATEITAMFTAKNIL
                     SSFNYLLDMGLIVTNLPQKDVEENKN"
     gene            complement(100641..100937)
                     /locus_tag="BSPH_RS22990"
                     /old_locus_tag="Bsph_p113"
                     /db_xref="GeneID:6020515"
     CDS             complement(100641..100937)
                     /locus_tag="BSPH_RS22990"
                     /old_locus_tag="Bsph_p113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_031416914.1"
                     /db_xref="GI:670468190"
                     /db_xref="GeneID:6020515"
                     /translation="MKSTGVVRKVDELGRVVLPIELRKSLGIKEKDPIEIFVDGDKII
                     LKKYVPNMSCAITGEVSSDNLSVLDGKLILSEHGAEHLIKEIQLLLINKGSLNN"
     gene            complement(101068..101274)
                     /locus_tag="BSPH_RS22995"
                     /db_xref="GeneID:23320139"
     CDS             complement(101068..101274)
                     /locus_tag="BSPH_RS22995"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036146679.1"
                     /db_xref="GI:738190620"
                     /db_xref="GeneID:23320139"
                     /translation="MDIYKVIYGVGNTCGGYNQAKVVASKKEHVQGLLNEQEDESVLI
                     TLIEITTEDTSIYKHEQVLSIDIA"
     gene            complement(101388..103193)
                     /locus_tag="BSPH_RS23000"
                     /old_locus_tag="Bsph_p115"
                     /db_xref="GeneID:6020511"
     CDS             complement(101388..103193)
                     /locus_tag="BSPH_RS23000"
                     /old_locus_tag="Bsph_p115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="reverse transcriptase"
                     /protein_id="WP_012291752.1"
                     /db_xref="GI:501248734"
                     /db_xref="GeneID:6020511"
                     /translation="MSTTLRHAEYYDMQSIFDDLYERSKNNATKGLNLYEHIISKNNI
                     LLAYRNIKANTGSKTAGTDGITIEQYKIEDVETFVDEIRATLKNYKPQTVRRVEIPKP
                     NGKTRPLGIPTMRDRLIQQMFKQILEPICEARFYNHSYGFRPNRSTHHAMGRCQFLAN
                     IALNQHVVDIDIQGFFDNVSHSKLLKQMYSIGICDKRVLSVVSKMLKAPIKGIGIPTK
                     GTPQGGILSPLLSNIVLNDLDWWISNQWENMKTKFNYKERKNKVLMIKRTTTLKEMYI
                     VRYADDFKIFTKSHKNAIKLYHAVKGYLKNHLNLDISNEKSKITNLRKRASEFLGFSL
                     KVIKKGKRYVANTHVMDDKVKTILQKARKLIHEIKKNPTAKMAMNYNAYVLGIKNYYK
                     IATHVNTDFSEIAYRLSRTLYNRLKSIGNYGIPIKPSETYKRFNKNNFKTFEIENIHL
                     FPIADIKTVNSTNFSQDLCNYTKEGRLKLHKQLKNDVAIEINRLLKTISYNDNLEYAD
                     NRISRYSMQSGKCAITGDFLVAEEVHCHHRIPRYMGGSDEFKNLVIVHSNVHKLIHAT
                     ETETIERYKSLLQLDGKQLEKLNQFRKKCNLVALV"
     repeat_region   104878..105173
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=104944..104975
                     /rpt_unit_seq="atttcaatccacgctcccctaaggagagcgac"
     gene            complement(105341..106198)
                     /locus_tag="BSPH_RS23005"
                     /old_locus_tag="Bsph_p117"
                     /db_xref="GeneID:6020506"
     CDS             complement(105341..106198)
                     /locus_tag="BSPH_RS23005"
                     /old_locus_tag="Bsph_p117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein"
                     /protein_id="WP_012291754.1"
                     /db_xref="GI:501248736"
                     /db_xref="GeneID:6020506"
                     /translation="MTKNEIKAINKKDFAIVFSVKNANPNGDPNNGNRPRQSPFDSIG
                     EISDVAIKRKIRNRFMDYDQDIFVQSEDRTIDGFRSLKDRADSIEGLKGADSETYKKI
                     ACETWIDVRTFGQVFSFKGDKNDSVSVGVRGPVAIQSAFSVHPIEITSTKITKSVNLV
                     TSNKKTSDTMGEKHRVNYGLYVCYGSINSQLAQDTKFSDKDAALLKEILSSIFENDLS
                     AARPSGSMEVHNVYWWEHNSPLGQYSSAKVHRSLEIKQTVESPTSYDDFEIKVNELDG
                     LSVEVLPGY"
     gene            complement(106191..108011)
                     /locus_tag="BSPH_RS23010"
                     /old_locus_tag="Bsph_p118"
                     /db_xref="GeneID:6020505"
     CDS             complement(106191..108011)
                     /locus_tag="BSPH_RS23010"
                     /old_locus_tag="Bsph_p118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018663049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291755.1"
                     /db_xref="GI:501248737"
                     /db_xref="GeneID:6020505"
                     /translation="MSLLNALVQTYDNNLEVVGKVNKKRNGTEYTLLPIAHSTQVTHV
                     EVFVSNQGEFLSAAVIEGERNTVIPVTEASSGRTSGLAPHPIHDKLMYVAGDYSDYIS
                     GKSKAREAFKLYLEQLSKWCDSEYGHESLSNLYEYLKKGTLIEDLVKNKTLYLDDNGM
                     LLLKWQKKNEKTPDIYKIVSNVADVAIRFTIEGLEPVMWENTDIRNLHIQKTISDITE
                     LDFCYVTGEYAPISVNQPKKIRNTMDQAKLISSSNANALTFKGRFAEARDSFNISYEA
                     SQKAHNALKWLINRQSINIDGRVFLVWSDGMEQPKNWDELLRAGEQEAKEFYLNLTGV
                     KEGHIDSKNTYLTILDAATPGRLAVTSFEQLTTSSYYKRVYNFYNKYIWYFTHRKNDN
                     GENQEGLAAPTLKEILNVIYPDTTRADILKNTYNTLLICVLYNRPIPREYINRAVARL
                     KNGNEMGTWEWDKNLSITCALINYERGKGEFSVSLDTQNNNRSYLFGRLLAVAEVLER
                     SALGSENRPTNAARYTASFVQAPARTWTILQQKIVPYQNKLNSKLAAYYQAIIDNIIS
                     LMNPNDFSNKTLEETYLLGFYSQRKDLYTKKEKKGDKSND"
     gene            complement(108027..108755)
                     /locus_tag="BSPH_RS23015"
                     /old_locus_tag="Bsph_p119"
                     /db_xref="GeneID:6020504"
     CDS             complement(108027..108755)
                     /locus_tag="BSPH_RS23015"
                     /old_locus_tag="Bsph_p119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein"
                     /protein_id="WP_012291756.1"
                     /db_xref="GI:501248738"
                     /db_xref="GeneID:6020504"
                     /translation="MAWTIEFLVYGRNALFTDPFSKTGGEKTTTLIPTYEAMKGVAES
                     IYWKPSIKWHIDSIRVMKAIRTESKGVLPRVYSGGKMLSLYTYLHDVAYQVRATISPN
                     ESRPDLKNDYNMVKHHQMALRSLDKGGRRDIFLGVRECQAYVEPCKFGSEDGEYDSTG
                     TIGFGLMVHGFNYPNNRSKLFEVRFWKPEMLNGIINFPKPSDCIYTRKIREMNVKQGA
                     RFQSVDDALDILIREDGLGFFNNI"
     gene            complement(109035..109535)
                     /locus_tag="BSPH_RS23020"
                     /old_locus_tag="Bsph_p120"
                     /db_xref="GeneID:6020501"
     CDS             complement(109035..109535)
                     /locus_tag="BSPH_RS23020"
                     /old_locus_tag="Bsph_p120"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291757.1"
                     /db_xref="GI:501248739"
                     /db_xref="GeneID:6020501"
                     /translation="MKNEYVGIKEIAEIGASIEFEKDGQILDLAVYEVFEDHVVVTGG
                     INVQHKDYTITAYDLQERKMRELPRVNLLFTEQEVGKEMMEKFIITQKDNDFAEIGHC
                     FRCKFDGEKVTIHNDMSWWSVTIPLEQFRNEFKEMSKEDYSTYINACNEGEDQVIESV
                     IKKYLG"
     gene            complement(109551..109886)
                     /locus_tag="BSPH_RS23025"
                     /old_locus_tag="Bsph_p121"
                     /db_xref="GeneID:6020500"
     CDS             complement(109551..109886)
                     /locus_tag="BSPH_RS23025"
                     /old_locus_tag="Bsph_p121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009331304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291758.1"
                     /db_xref="GI:501248740"
                     /db_xref="GeneID:6020500"
                     /translation="MNKWNNFETLEHHKGKIWVSKLFKLENRGNICYLQNGEFLMLAY
                     VSPSMLENKLLDTVIKDIIIANGTPYMLSEDTITCSVCGNSYDEGDVNIVDYPDDVCV
                     TCEKNYTGS"
     gene            complement(109927..110667)
                     /locus_tag="BSPH_RS23030"
                     /old_locus_tag="Bsph_p122"
                     /db_xref="GeneID:6020496"
     CDS             complement(109927..110667)
                     /locus_tag="BSPH_RS23030"
                     /old_locus_tag="Bsph_p122"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291759.1"
                     /db_xref="GI:501248741"
                     /db_xref="GeneID:6020496"
                     /translation="MKSTHEIIAEAAKQLKLGVFNRVAVREESWALDKEKYYNRHLDD
                     NEYIEIITFYNNKRNKTGNFIESLHVYFRWSLDDINVCAYTTSENQSVYQGTKIRNLK
                     NPTKIGEVTTTFKDIAAVLKQFVLDAQKVLNIYLNKKIDPQFEATVKLLVETYSDKSN
                     NLECMTVHFAIHSPSVSINLETGWGGDDFFFTVSKDRKKASMKIKLDAFELAPGDRTT
                     YIETVDINEGDFLTAYKKFFYDYHLITQ"
     gene            complement(110703..111560)
                     /locus_tag="BSPH_RS23035"
                     /old_locus_tag="Bsph_p123"
                     /db_xref="GeneID:6020493"
     CDS             complement(110703..111560)
                     /locus_tag="BSPH_RS23035"
                     /old_locus_tag="Bsph_p123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase"
                     /protein_id="WP_041659307.1"
                     /db_xref="GI:753952738"
                     /db_xref="GeneID:6020493"
                     /translation="MITAKSYFSGAGGLDLGIIEAGIDVIESFEIDKKACNTLRNNFK
                     HIINETDITKITVLDQQDADVYIGTFPCTKYSNIADIHGTRTGDDLFLHFFRHVALAQ
                     PEAYVIENVPGMKKFQVVMECLTKLPNYYVRVECPVNANMWLPQERKRLIVIGTKRPF
                     NNLDYPESTPIKMRDIIDVGTEVYTPKYVQKRLEGHYRDKPIITDLDGIAPTCVAHYS
                     KDRSTRLINDGVKIRPYSVREWARLQGFPDWFKFDGTDNDAYKMIGNAVPVNMGLWVG
                     KQLKKYFAG"
     gene            complement(111776..112027)
                     /locus_tag="BSPH_RS23040"
                     /old_locus_tag="Bsph_p124"
                     /db_xref="GeneID:6020492"
     CDS             complement(111776..112027)
                     /locus_tag="BSPH_RS23040"
                     /old_locus_tag="Bsph_p124"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659309.1"
                     /db_xref="GI:753952741"
                     /db_xref="GeneID:6020492"
                     /translation="MLILNDNKTIESIFEGYDEWLLIGNEPQRKDVDEYTERYDLAGN
                     RTCLYCSSRLPEDHPLTVCDSCYPDEDQTIESDLEGYDE"
     gene            complement(112087..112344)
                     /locus_tag="BSPH_RS23045"
                     /old_locus_tag="Bsph_p125"
                     /db_xref="GeneID:6020491"
     CDS             complement(112087..112344)
                     /locus_tag="BSPH_RS23045"
                     /old_locus_tag="Bsph_p125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011989067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291762.1"
                     /db_xref="GI:501248744"
                     /db_xref="GeneID:6020491"
                     /translation="MNLKTAANWKWSLHQYLQVGDIVDDEIYSHFVNVLPPATFKQSL
                     VQMGEPYCHVEGQPTYPTLQKTEHGWKYMGNCFRGEVVNKD"
     gene            complement(112513..113445)
                     /locus_tag="BSPH_RS23050"
                     /old_locus_tag="Bsph_p126"
                     /db_xref="GeneID:6020488"
     CDS             complement(112513..113445)
                     /locus_tag="BSPH_RS23050"
                     /old_locus_tag="Bsph_p126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013400351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291763.1"
                     /db_xref="GI:501248745"
                     /db_xref="GeneID:6020488"
                     /translation="MIHLLFGTEDFLIAEKKKEICRVEGVSISSFDMRETSLTSALED
                     AQMSDLFGGKKIVFLNDSYFLTGDTSKKITHDTDALLDYLESPNPDSTVVLVVNNEKL
                     DKRKKVVKELLQKATTTFEAKPLYNAEKWLVERCKVYGKTLTRQAAVIMQQQLGKDLF
                     LLDTELTKLVLAVDNPTISEKDLEGVLSRTLEGDVFKIVDHVIYKRSEALEILDDLFR
                     LGHDSIQILLILAGQFRLIHQVKAIHELGESPKNILKGIHPYRLSMAEEQCQLYSIED
                     LQQRLKDCAELDLQMKRGYCDKVIGLETLILKWL"
     gene            complement(114009..114197)
                     /locus_tag="BSPH_RS23055"
                     /old_locus_tag="Bsph_p127"
                     /db_xref="GeneID:6020486"
     CDS             complement(114009..114197)
                     /locus_tag="BSPH_RS23055"
                     /old_locus_tag="Bsph_p127"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291764.1"
                     /db_xref="GI:501248746"
                     /db_xref="GeneID:6020486"
                     /translation="MTENQRFELAVLLEKYSLINGMLVNGSTEQKKQAKKELQLLQNE
                     VSPFLTPELIHAAQLELS"
     gene            complement(114213..114650)
                     /locus_tag="BSPH_RS23060"
                     /old_locus_tag="Bsph_p128"
                     /db_xref="GeneID:6020482"
     CDS             complement(114213..114650)
                     /locus_tag="BSPH_RS23060"
                     /old_locus_tag="Bsph_p128"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659310.1"
                     /db_xref="GI:753952742"
                     /db_xref="GeneID:6020482"
                     /translation="MANMIQIAETLKYQAEIFNVTYEEAWHKYLHPGIRDKHPLAEIL
                     PHIKKLEQETTSNILIRSKKNQRKLEASHDTYRFECIPDKNGYKLKIYKDEKHFYSHG
                     LLVPSPKAATTVIRRVTKLPKLELDWIDNISRRKIRVKPAYLN"
     gene            complement(114722..115453)
                     /locus_tag="BSPH_RS23065"
                     /old_locus_tag="Bsph_p129"
                     /db_xref="GeneID:6020480"
     CDS             complement(114722..115453)
                     /locus_tag="BSPH_RS23065"
                     /old_locus_tag="Bsph_p129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010300440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291766.1"
                     /db_xref="GI:501248748"
                     /db_xref="GeneID:6020480"
                     /translation="MKDLNKAVGFTLKDMVSMFWFSATKERAMFVEEIHGAFMDAFPG
                     RNVSYDYVARIAKSLEKQDLLTVKRDQNKKFYRVTEAGIERLKRYSGLYKERTLEVYQ
                     VVQRIEYHLTRSGDGPIPITHELPQEYRTFLAKLFSIKDLTRYLFLYYGQTKSQFYAA
                     EIEHLSKEMFGWSPSNPYVHKIAAELEADGAIKGDWAEPVKRTVRFLKLTEDGKVFFK
                     QIEQDLTDQIKNIKKFLALLILFFE"
     gene            115721..116569
                     /locus_tag="BSPH_RS23070"
                     /old_locus_tag="Bsph_p130"
                     /db_xref="GeneID:6020479"
     CDS             115721..116569
                     /locus_tag="BSPH_RS23070"
                     /old_locus_tag="Bsph_p130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="WP_012291767.1"
                     /db_xref="GI:501248749"
                     /db_xref="GeneID:6020479"
                     /translation="MLVATGIEIINTEDWLYQVKWDGWRVLIHKAGDRIEAFTREGNN
                     ITAKFPELEEVGHSITVDTAIIDTEGVVLRQGISVFEDFSYRGILTNKEKIKEATITH
                     PVTFVAFDILTTDKKLMHHPLFERKEHLSSIITPSNSLQVTPSVDGDGSNIFEITKDK
                     GMEGIIGKKRDSIYQLNHRSKNWLKYKHFKIIETVILAYRENPFSILVGTELESGRYK
                     RLATVEFGFKPEEKMAFRHIAKSVITTVDRDLIWLEPRLYCKVQYLEKTNSGLLRTVS
                     FKGFIF"
     gene            <116821..>117459
                     /locus_tag="BSPH_RS23075"
                     /db_xref="GeneID:23320140"
     CDS             <116821..>117459
                     /locus_tag="BSPH_RS23075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017692359.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659324.1"
                     /db_xref="GI:753952764"
                     /db_xref="GeneID:23320140"
                     /translation="FKDVPSSHWAFKAITEVAKKGLVTGYTDGTYKPSAQVTRAEFAT
                     FLSRVFDSKERQTSNFKDVENSHWASDAIQEGLAVGFIKASDFSNNKFEPNKPMTRGE
                     MSRWLANGLAHVNADYGKAIEEMANSSLTIIPIPEFYRGGVSKTDLPYIGVALGTGLL
                     SGYEDFTFKANGNTTRAEVATILIRFMDVMKKATTDFTGLSELREVANTGTNI"
     gene            complement(118057..118497)
                     /locus_tag="BSPH_RS23080"
                     /old_locus_tag="Bsph_p132"
                     /db_xref="GeneID:6020476"
     CDS             complement(118057..118497)
                     /locus_tag="BSPH_RS23080"
                     /old_locus_tag="Bsph_p132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036169533.1"
                     /db_xref="GI:738213876"
                     /db_xref="GeneID:6020476"
                     /translation="MEKLKLTYIGTDEWSRPVFESEEGRIFKDLNCGDGQLDLCTAGS
                     FDGEPDTPIHYIEKYKNVEFIILGMEEQPSAEEKFNYMMLSRLQSDCDYYLGHGDRNG
                     KNLWAGNVSEQIVKMKELYNSFNDDKKPEWITLDDILEYENKMT"
     gene            complement(118625..>119167)
                     /locus_tag="BSPH_RS23085"
                     /old_locus_tag="Bsph_p133"
                     /db_xref="GeneID:6020473"
     CDS             complement(118625..>119167)
                     /locus_tag="BSPH_RS23085"
                     /old_locus_tag="Bsph_p133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291770.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_036169542.1"
                     /db_xref="GI:738213885"
                     /db_xref="GeneID:6020473"
                     /translation="IIGRKKDISTNLKVLDLFDMTIVELQDIGLSRKEALRIRAVKGL
                     LKIMNSERQGKVKSISNASEAAEYVMDEMKNLKQEHFVCLFLDTRSRVIKKETIFIGS
                     LNSSIASPREIMRLALKYSAAGIICLHNHCSGDSEPSMQDLEVTRRLFEAGDLMGVEL
                     IDHIVIGNNEFTSIRENNLL"
     gene            complement(<119467..119682)
                     /locus_tag="BSPH_RS23090"
                     /old_locus_tag="Bsph_p134"
                     /db_xref="GeneID:6020471"
     CDS             complement(<119467..119682)
                     /locus_tag="BSPH_RS23090"
                     /old_locus_tag="Bsph_p134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000679230.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417250.1"
                     /db_xref="GI:670468559"
                     /db_xref="GeneID:6020471"
                     /translation="MKGVCKEAPVNSNLVIDEEYYLTPHGSQGYLVSRFPSPLSHFGA
                     YQKKYFKVIENEVENTLESKEDDKNQDY"
     gene            complement(119710..>120051)
                     /locus_tag="BSPH_RS23095"
                     /db_xref="GeneID:23320141"
     CDS             complement(119710..>120051)
                     /locus_tag="BSPH_RS23095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002415202.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417251.1"
                     /db_xref="GI:670468560"
                     /db_xref="GeneID:23320141"
                     /translation="KVRALLVDASEIKGKDGKPEPFAIEARDAARELLEQADSISLFY
                     DIGARTDHYDRNLMYVKVDGILLSIPLLEKGLLQIAYVKPPNTKYLSEYEKAQEIAKA
                     KNIGLWSLNYK"
     gene            complement(120348..120590)
                     /locus_tag="BSPH_RS23100"
                     /old_locus_tag="Bsph_p136"
                     /db_xref="GeneID:6020465"
     CDS             complement(120348..120590)
                     /locus_tag="BSPH_RS23100"
                     /old_locus_tag="Bsph_p136"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291773.1"
                     /db_xref="GI:501248755"
                     /db_xref="GeneID:6020465"
                     /translation="MVKQIIVMNGGLIQNIISEGDIDVTIVDYDTEGADVGELMKVNE
                     DDAYVFSPQVEVNIDEVNEILTIIEKARAVSEVASE"
     gene            complement(120696..120962)
                     /locus_tag="BSPH_RS23105"
                     /old_locus_tag="Bsph_p137"
                     /db_xref="GeneID:6020464"
     CDS             complement(120696..120962)
                     /locus_tag="BSPH_RS23105"
                     /old_locus_tag="Bsph_p137"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291774.1"
                     /db_xref="GI:501248756"
                     /db_xref="GeneID:6020464"
                     /translation="MQTNTDNHVTIIEDIIKKIENYKNASDTLATALYQLAALKSPEY
                     FKVSDFVQRLETCCLTYDEHRIINELSSYLEDFSMSLKQIEKNK"
     gene            complement(<121103..>121309)
                     /locus_tag="BSPH_RS23110"
                     /db_xref="GeneID:23320142"
     CDS             complement(<121103..>121309)
                     /locus_tag="BSPH_RS23110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003656456.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036169545.1"
                     /db_xref="GI:738213888"
                     /db_xref="GeneID:23320142"
                     /translation="RNESIRKAVASNLKDLLLIRKVSQNELSNGTKIAKTTIADYVRG
                     TTLIKLENLEKIARFLNIEPAYIDP"
     gene            122893..>122997
                     /locus_tag="BSPH_RS23115"
                     /db_xref="GeneID:23320143"
     CDS             122893..>122997
                     /locus_tag="BSPH_RS23115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017294036.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_031417252.1"
                     /db_xref="GI:670468562"
                     /db_xref="GeneID:23320143"
                     /translation="MTTATLTSKGQLTVPKEIREFLKIDTGDTIEFVTD"
     gene            123794..124438
                     /locus_tag="BSPH_RS23120"
                     /old_locus_tag="Bsph_p142"
                     /db_xref="GeneID:6020459"
     CDS             123794..124438
                     /locus_tag="BSPH_RS23120"
                     /old_locus_tag="Bsph_p142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003349842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291779.1"
                     /db_xref="GI:501248761"
                     /db_xref="GeneID:6020459"
                     /translation="MEVSSDMKEKRKKRKDAKVDYKPTVPIPLKTSIERLSAITGIVV
                     KDIADHLVVSALNSVEVISYISKCFQRDLRFNNTLYFGNSENPTVTKRHPAGTTDRVS
                     LRVSQNTDHLIGSIAYALRCTPHTACAALIEQAMLNYDIVNDFIRNYLINGLDEDRLN
                     ELQKVMNYINSMDNTFEYSWADLLSLIAREVNAPITSPNEMVDEFIINNWRDNR"
     gene            complement(124476..124811)
                     /locus_tag="BSPH_RS23125"
                     /old_locus_tag="Bsph_p143"
                     /db_xref="GeneID:6020457"
     CDS             complement(124476..124811)
                     /locus_tag="BSPH_RS23125"
                     /old_locus_tag="Bsph_p143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012294845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659313.1"
                     /db_xref="GI:753952745"
                     /db_xref="GeneID:6020457"
                     /translation="MLHIWGALMVPEHLQLLREWKKSVNAEPPRKLSEWELDEIQENI
                     SRAAADKMHVKLTVWEEGNYKEYNGVINKIIPYKRELVLITLSSTKFLSFDQIYSAKT
                     ESNFDISEI"
     gene            124938..126302
                     /locus_tag="BSPH_RS23130"
                     /old_locus_tag="Bsph_p144"
                     /db_xref="GeneID:6020456"
     CDS             124938..126302
                     /locus_tag="BSPH_RS23130"
                     /old_locus_tag="Bsph_p144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018766408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012291781.1"
                     /db_xref="GI:501248763"
                     /db_xref="GeneID:6020456"
                     /translation="MGGKYHYKLRPEALGKDSPPLIVFDINNKPFRPLTEFYQYELGR
                     LSNKTAISYLQSLLPFFNWIQQYGYYQGRKVIWTDVPDSIRAVVRTYLIDNMNCKVQE
                     HYNGTFNFVHLTHKSPSTVRHFLSALKSFYNSMIQKKLYHFQNPFIDFSYKLLNEMES
                     AIELQINNRTRMPDIAGTEEPKNYRRVTNSYYKIVGDTWIPNIIDDNSLPSQILSGGE
                     KIHWKLRDQVIARLLFETGARASEVIEVTIGDYRRRPSVREMNTFSKGSYKKRVKFLY
                     FTDDTAILLRRYIEGERKVYDKNKLGFTELPDEAPLFLTERGTPYTYQAWYPNWCKAC
                     ISAKLKVNPHKTRHWYVTQTLRFIYETSKNEADIQLHIRELISYMNWKSKETITVYEH
                     YFDLKKHLETQEQFFVKMEKETENYLRNKKIVHKENLTSSKLNSIKEPPIKDPLENFL
                     LGLE"
     gene            126311..128458
                     /locus_tag="BSPH_RS23135"
                     /old_locus_tag="Bsph_p145"
                     /db_xref="GeneID:6020453"
     CDS             126311..128458
                     /locus_tag="BSPH_RS23135"
                     /old_locus_tag="Bsph_p145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018783457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012291782.1"
                     /db_xref="GI:501248764"
                     /db_xref="GeneID:6020453"
                     /translation="MNILEQSNSEKKYWHKKFHGKIHEDILNLTNDIDWGFVHEDIID
                     YFEKYCIGYVWTNHLALIMLARSGYSRNSVNTVRGILGVLNVRFQSLFKELSIQTINH
                     WNPDIHLYEYLNKKILPEHTENQRFDLLKSYNSSISSVLNWLNSKFDLCTQEIFKPFL
                     LNRCNITHTISNQKKVLQLSQSHRKNETDAIIPHYPVIRGEAHFRWNKIHRLFTKFKE
                     LTAKVTPTTSLPLEFDYDEEQTRERLFFRIWDRPSFTIAHKDCYSRYSIDLAKNRRKT
                     YSNENNEFFLEFVNVESLDGNKCIEGLWFEDLISESVLNQLPATGSKEQKERKKKFLL
                     SWGYGDSDTDSIPMPFRTSVKGLLAQGDYICHAQNHTDCVLLKIETLYAAATFGLALV
                     DLITTTGMRINEVLQISYTKDCIIVLNQPDNPNKLEKRYILRLIPKGRDQPEDYFIGK
                     ETLNNLFKVFGFLKEHYNNNHIPKVKYRATRRHLFPEEKPYFFQYNYKHFTDDSVTAC
                     MRFLLHGMVFKTPEGDNVVLKAHLLRHAFATHAVQVEKIPLDIVGSWLHQKNIEVTDY
                     YSAPTPSQVAQRADAWLKYTATHINITEAVKRSPEELKLMYEEAKNKVGTLNKVIGGI
                     CTSHSFCPSKFQCVGCAAKVPESDKKNELLKMKEWAQKSGNDWRSMGLLPEVNRMNQV
                     IRDCDKELHEIELMEAYKKDENYKPEVRIKPIK"
     gene            128415..128915
                     /locus_tag="BSPH_RS23140"
                     /db_xref="GeneID:23320144"
     CDS             128415..128915
                     /locus_tag="BSPH_RS23140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002136093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036161884.1"
                     /db_xref="GI:738205969"
                     /db_xref="GeneID:23320144"
                     /translation="MKTINQKSESNQLNKERPWLEKHYTYKRNRTIELVKNSVDLLVS
                     KDKEVTISNIAQISKQIDPENKGIHPNTIRVNTEAHDYYSKHSKTYQKVMNRSKQQRK
                     NKKPISTENFENIKPNRNLVALQNRYKNLTKEDLISRLIGAEEYIVENNQKWLYKQFI
                     DYPIEF"
     gene            130767..131843
                     /locus_tag="BSPH_RS23145"
                     /old_locus_tag="Bsph_p147"
                     /db_xref="GeneID:6020447"
     CDS             130767..131843
                     /locus_tag="BSPH_RS23145"
                     /old_locus_tag="Bsph_p147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="WP_012291784.1"
                     /db_xref="GI:501248766"
                     /db_xref="GeneID:6020447"
                     /translation="MKKVLQPIHVYCLLFLSVSFLAHFVLIPSIFTVVEREAWISALL
                     SLIPIFLLALFISRITSSLNNSSILELKTVQNNKTLYVFIIYIYIVYLMSSTFVSLKF
                     TIIWAEESFNSDYPYFITVILFILLCFYGSLKGLKTIAIQSLIICSLYIFLFVLLNLG
                     NSMNNEYELLLPVNTSNTPSIYWGILYICIGILEMGFILIVLNGYVKEKLKRKGILIF
                     SILFVLFVLIAIVTAVSEFGIYLTQKMLFPINEQWRVLSFGKYFTRLDSLSVLQLLSM
                     AFIRICLFMYIVSSFFKNRKFILIVGYLCLTIGLLIPWSVSDFLSFIKSAYLLSIFLF
                     LFFFMIVFYVVEKKQKGVHHLDRK"
     gene            131830..133230
                     /locus_tag="BSPH_RS23150"
                     /old_locus_tag="Bsph_p148"
                     /db_xref="GeneID:6020446"
     CDS             131830..133230
                     /locus_tag="BSPH_RS23150"
                     /old_locus_tag="Bsph_p148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012293516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="WP_012291785.1"
                     /db_xref="GI:501248767"
                     /db_xref="GeneID:6020446"
                     /translation="MTENKDFLYKELGHQSDITISSKFYMFNNEKHEVIFVYCHSLVD
                     SVLFLNSLLPNIRFLAEHGHLHDVEIINRYLEVFEIKEYRTKTDEMNSKIFSGFLYFF
                     HVPSNSLYSTNLAKLPERSIEESNMEVSLRGPRDGFVENIDTNFSLIRMRLKSKNLSS
                     NDFTIGDTSKTKVLLLYIENYIDQNTLKNVQSKLNKIKVDNIASSYHIEELLYDKLPL
                     FPLLDYSGRPDFVVSSLNKGRFVILVDGSPSCLIGPVNLLLILKAAEDDQTNFLFVSL
                     SRILRITSLLTSIFLPGLWIALTVHQLNQLPFPLLVSISASKIGLPVSSSFEILIMLI
                     FFDLFREAGIRLPKAVGQTVAVLGGLIVGDAAIRAGFTSPSTLVIGALTVISSYTLIN
                     QNVLGNVFLIRVATLIIASFFGMYGFILSLLFFLTYISSLESFGHPYLSTFYKVSIPN
                     FIKGFFKMPFRIKIKD"
     gene            133260..134381
                     /locus_tag="BSPH_RS23155"
                     /old_locus_tag="Bsph_p149"
                     /db_xref="GeneID:6020444"
     CDS             133260..134381
                     /locus_tag="BSPH_RS23155"
                     /old_locus_tag="Bsph_p149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="WP_012291786.1"
                     /db_xref="GI:501248768"
                     /db_xref="GeneID:6020444"
                     /translation="MSHYYNCTFKITFIFPLLFILGGCLGTKEIQSEVYITALGIDYS
                     NDVYHLYFQAYGFTNVAGSDPSTEPAPIVVGHGEGETIQGAIDDIEKNSVNPLYYGHI
                     QTFFISKNILDGHLDEFFDFFSRDYYLRYNTLAYGYEEDDIKEILNVHGLFYKPPILT
                     FPYDPNEQLFFNSFISTSTVQDMIKRYYEPVGSIMVPTIKISEDYWMEDNKSKNILKI
                     SGAYFLSRQEFNGWIKEEELSGLDWFNKDFNNMKLLIKDKSVSMFIETIDYHIEIVDN
                     SIPKYIINLDIKASIRENPKNIGKETIENEIKNIILSQFQNTFSKGLEINSDVFNFSE
                     KAYRFKPQSWTVDKLNSITEHSIKKFNIHVFIKDEGAKK"
     gene            complement(134614..135072)
                     /locus_tag="BSPH_RS23160"
                     /old_locus_tag="Bsph_p150"
                     /db_xref="GeneID:6020443"
     CDS             complement(134614..135072)
                     /locus_tag="BSPH_RS23160"
                     /old_locus_tag="Bsph_p150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012291787.1"
                     /db_xref="GI:501248769"
                     /db_xref="GeneID:6020443"
                     /translation="MAVIVSDLTYVRVGTKRHYVCLFVVLFNREIIGRSAGANKTAEL
                     VYQALVSIRGNLNDIQMFHTDRGKEFDNKLISKALETFGIQRSLSMKGCPYDNAVAEA
                     MFKVFKTEFANGAHLSTLEQLALELDDYVHWFNNIRIHGTLGYLTPVEFK"
     gene            complement(135097..135408)
                     /locus_tag="BSPH_RS23165"
                     /old_locus_tag="Bsph_p151"
                     /db_xref="GeneID:6020442"
     CDS             complement(135097..135408)
                     /locus_tag="BSPH_RS23165"
                     /old_locus_tag="Bsph_p151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012291788.1"
                     /db_xref="GI:501248770"
                     /db_xref="GeneID:6020442"
                     /translation="MCDVLDIPKSTYYYHADVCGKRALKTEDNEISKEIARIFKESRN
                     NYGTRKIKEELSKLPDPKHVSRRRIGRLMKGLGLVSNYTVAQYKVHHSTCNEAPIKNE
                     L"
     gene            complement(135987..136403)
                     /locus_tag="BSPH_RS23170"
                     /old_locus_tag="Bsph_p152"
                     /db_xref="GeneID:6020440"
     CDS             complement(135987..136403)
                     /locus_tag="BSPH_RS23170"
                     /old_locus_tag="Bsph_p152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012294710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291789.1"
                     /db_xref="GI:501248771"
                     /db_xref="GeneID:6020440"
                     /translation="MKLNMILSVISIFLLLTLSACSQDEKEYNFYGTSNNWVVKYDTE
                     ISEGKEWADFSFEYIGEEDAPAIFGYNLKSKWFELTSKEERFNHQDKNINSGNSECTG
                     PPINNESCAVIIEEDEQMEAKIEWNGKSEVILLNRK"
     gene            complement(136672..136989)
                     /locus_tag="BSPH_RS23175"
                     /old_locus_tag="Bsph_p153"
                     /db_xref="GeneID:6020437"
     CDS             complement(136672..136989)
                     /locus_tag="BSPH_RS23175"
                     /old_locus_tag="Bsph_p153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291790.1"
                     /db_xref="GI:501248772"
                     /db_xref="GeneID:6020437"
                     /translation="MNELKKVVFRTIEIISLLAIGLLFTVYVLKPIYEGFGINFMGNV
                     WVNWFGVSYILFVMYTLIAALFLFKKSILFKQRLTSVFFWLIFIGANYVVFIPFIKGE
                     NPF"
     gene            complement(137505..138617)
                     /locus_tag="BSPH_RS23180"
                     /old_locus_tag="Bsph_p154"
                     /db_xref="GeneID:6020436"
     CDS             complement(137505..138617)
                     /locus_tag="BSPH_RS23180"
                     /old_locus_tag="Bsph_p154"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P12963.1"
                     /note="similar to 41.9 kDa insecticidal toxin of strains
                     1593/2362/2317.3; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_012291791.1"
                     /db_xref="GI:501248773"
                     /db_xref="GeneID:6020436"
                     /translation="MRNLDFIDSFIPTEGKYIRVMDFYNSEYPFCIHAPSAPNGDIMT
                     EICSRENNQYFIFFPTDDGRVIIANRHNGSVFTGEATSVVSDIYTGSPLQFFREVKRT
                     MATYYLAIQNPESATDVRALEPHSHELPSRLYYTNNIENNSNILISNKEQIYLTLPSL
                     PENEQYPKTPVLSGIDDIGPNQSEKSIIGSTLIPCIMVSDFISLGERMKTTPYYYVKH
                     TQYWQSMWSALFPPGSKETKTEKSGITDTSQISMTDGINVSIGADFGLRFGNKTFGIK
                     GGFTYDTKTQITNTSQLLIETTYTREYTNTENFPVRYTGYVLASEFTLHRSDGTQVNT
                     IPWVALNDNYTTIARYPHFASEPLLGNTKIITDDQN"
     gene            complement(138789..140135)
                     /locus_tag="BSPH_RS23185"
                     /old_locus_tag="Bsph_p155"
                     /db_xref="GeneID:6020435"
     CDS             complement(138789..140135)
                     /locus_tag="BSPH_RS23185"
                     /old_locus_tag="Bsph_p155"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P12964.1"
                     /note="similar to larvicidal toxin 51 kDa protein of
                     strains 1593/2362; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Larvicidal toxin protein"
                     /protein_id="WP_012291792.1"
                     /db_xref="GI:501248774"
                     /db_xref="GeneID:6020435"
                     /translation="MCDSKDNSGVSEKCGKKFTNYPLNTTPTSLNYNLPEISKKFYNL
                     KNKYSRNGYGLSKTEFPSSIENCPSNEYSIMYDNKDPRFLIRFLLDDGRYIIADRDDG
                     EVFDEAPTYLDNNNHPIISRHYTGEERQKFEQVGSGDYITGEQFFQFYTQNKTRVLSN
                     CRALDSRTILLSTAKIFPIYPPASETQLTAFVNSSFYAAAIPQLPQTSLLENIPEPTS
                     LDDSGVLPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQI
                     IPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMLFYFRSSGFKEQITRGLNRPL
                     SQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRLAGI
                     QSYPNAPITNPLTLTKHTIIRCENSYDGHIFKTPLIFKNGEVIVKTNEELIPKINQ"
     gene            complement(140581..141111)
                     /locus_tag="BSPH_RS23190"
                     /old_locus_tag="Bsph_p156"
                     /db_xref="GeneID:6020434"
     CDS             complement(140581..141111)
                     /locus_tag="BSPH_RS23190"
                     /old_locus_tag="Bsph_p156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012291793.1"
                     /db_xref="GI:501248775"
                     /db_xref="GeneID:6020434"
                     /translation="MNTNHDRFEELHTSQEELLHQSAGKESHKIPFCCVISIPYGFEV
                     ISNYQPKIMYHLGCLATVEETCRKTVQVDDCGNAEVDLHVLKAKGCIPFIANIVVKPT
                     CEQKGCSAKPHIKEIAISCQNSVCVDLILNCSVDSSQHIHLNCNNVVVCDLQMTPIKE
                     ACQHVKIKGNFQFLSV"
     gene            complement(141706..142701)
                     /locus_tag="BSPH_RS23195"
                     /old_locus_tag="Bsph_p157"
                     /db_xref="GeneID:6020433"
     CDS             complement(141706..142701)
                     /locus_tag="BSPH_RS23195"
                     /old_locus_tag="Bsph_p157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019419941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036161900.1"
                     /db_xref="GI:738205985"
                     /db_xref="GeneID:6020433"
                     /translation="MRSKTLRNALIIGMVFITLGGTTTINPSQTYAESNSMQEKNIGI
                     TNVNQVLEKIGSYYYQRNLSLTWYEAPNSIGVNHDFQLRKNPDSISSEVDLSISGEEI
                     ESLYYDSTIPKFLGENIFENNTNQEQTYNTSKFSETYTESTSTSVSKGFKINVGRDFT
                     IPLILNEGGKINLEYNSGSTNTNTLSKTYTLEAPSQPVKVPPNKIYKAVVEYSQRTYK
                     GTVKFYGRNTHNPYPINTIKTTGSYTGWMGMQEIKQFTFNDPLYKHYDGLSDSQKKEV
                     ENDGVVIIPFLGATFVVVEGKGSFEGVYGAKLNVKTYDVTDQNKVKLVDSRSIDL"
     gene            complement(143294..150865)
                     /locus_tag="BSPH_RS23200"
                     /old_locus_tag="Bsph_p158"
                     /db_xref="GeneID:6020431"
     CDS             complement(143294..150865)
                     /locus_tag="BSPH_RS23200"
                     /old_locus_tag="Bsph_p158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gramicidin synthetase"
                     /protein_id="WP_036162792.1"
                     /db_xref="GI:738206880"
                     /db_xref="GeneID:6020431"
                     /translation="MDEALYDVTENQKVMWLANQMDIEAGIYNEPVSIQLKGNLNLIR
                     LQKALEYIVVKHVALQMNIVPTNDGLKQIRKEKVHVDLDFYDWSSYPSSIRKQKLDDS
                     LRSNLHTRFDLTSDKLFRFQLYQLGPNEYLLYMLFHHIIFDGWSLGLLLCDLELAYSL
                     DTTVETEKNTHEIWMFENLLHKHLNYIGTVKYLESGEYWRTKLEGTLSRSAFPTSKAK
                     SLIKTYQGGALRYPIRPALSNLIEQFSKVNQVSSYRVWLSIYIVLLNQMTNQTDLLIG
                     MPINTRSRDEEDLEVFGYFVNTVPLRIAFSPTDTFLEVVQKVSYSVKEAIEHRNYPLN
                     HITQQFINQNENNPSLYSTVFNMIKLPNLRMEDLETGVITHHNRVSIFDMVWRLVQSQ
                     SDTITIEVDYNAGMYEENDIQNFIERFEHLLKILLENSDISMCNLNLLLPQDYDVYQN
                     TVVVKNVPPLTLDQLIDEQADIYPDCIAITMGQQNITYQELRVLSNKVALTLLNQGFQ
                     KQNRVSIILNRSIEAVVSMIGVLKAGGTYVPVDPDFPEDRIRFMLQDSESTHIITSQK
                     FSLHNFHQYQKVILYEDMSKQTFLEQVKRTHATEDGAYIIYTSGSTGSPKGVLIPHKG
                     VIHLIKSIKDKYHFQKDQVHIQFASLIFDASVWEIYSSLLTGGRLHILSEIERKSCKH
                     FIEAIEKQQVNFCLLPTVFFHTLSQAPIYELDRLNSLNYVFVGGESLLPETVRKWQEK
                     VGLKIPIVNAYGPTESTVCVATYPIINKVNETQANIPIGKPLSHTEIYILNEQNQICP
                     PYVPGEIYIGGDGLAQQYVNQPVKTKEAFVTVNLPTSSNARLYKSGDQGRITQDGQVE
                     FLGRKDKQVKIRGYRIELEEIEEQMLQHPSIEHATVIVYQNKSSDQQLMAFYILQKGD
                     NVNADDLQAYLSEKLPYFMLPSYMQDIEKFPLTPSGKIDSDSLQKQAESVLENRTHRY
                     TPPHTDTELQLQNIWAEVLRMESEQISIDDDFFTIGGHSLLTVQVINRIHARFHVQIS
                     LKDLYIYRTIHTCAEYIDQFNQIDSEDVIQLIPDQTHYPLSHAQKRLWFLYKRYPEDR
                     TYDIPIQVQIQPGIQIHILNKALCEIVKRHEIFRTVFREKQGEPGQHIQEELNVKAIH
                     VNITNIKKGKQAGYRLKCIQQIDSKGFDLEKGPLFRSILFTENEDCSWLYLNFHHIVM
                     DEWSLQLFLKELFEIYDELLLNKIVYHTKPVVRYVEYVAWQSKHLSLGTWELEEQYWK
                     QEFQNSHHPQLSLPYDRLSSNPLNRGAVLSKKIDQIHLTGLKKIAQQEDVSLFILLFT
                     AYTQFLQQICGQNDLVIGTPVSGRQHTAFEDVQGFFVNTVAIRINTTGASTMQELCEI
                     VKEKCFLAFQHQNYPFDKVIEVVNPERKEHDNPIFQTMFSYQQNSSQLFSLHRLDIQP
                     VKQTISKFNLSLTFVESEDGLIMDLEYNTDLFERTTISRFAEQLWQIIQMIQTDFTTS
                     FGQLSMLSDTDKAIYQKLNDTCMALPPYSSIQERFYQQVYRTPKTIAISTEDSSYTYE
                     EVNHYSNQIAHYLIEKGMQPNDVTAIFLDRSFESIVCMLGVLKAGCTYVPIDIKYPSD
                     RVSYIFNDSKAKLILTKEALKKKIQTYNEQVFLIEDIFASSSIKDILSKNRVDDTAYM
                     IYTSGSTGNPKGTLLRHAGVLNLVEWRSKTFCITEQDVLSQFYSHSFDSSVSEIFSAL
                     LTGARLHLLNEEQRISSQAYFDAVATYNITISDVATAFFKQLANEVSFKHRSPLQSLR
                     VLIMGGEAASAEAIRNWHSEMSDTVQIVNEYGPTETTVSSLYHVVSTKVESTVTHIPI
                     GKPIANTKVYILNENMQLCPIGVIGELYIESIGTAIGYVNQPEITKLSFLSNPFSANN
                     HSILYKTGDLARLSLNGNVEYMGRRDRQVKIRGYRIELGEIEDVLMQEPRIQQSVVLP
                     DAEGKELHAYYTVHKQTEISIEEVYKHVSTTLPEYMVPKGYVCIPEIPVTQNGKIDAQ
                     KLIGKYQIQYQKNKNHQAPVTETQKILANVWAEVLNKKDINIKDDFFSLGGHSLKIMP
                     TLVKLKPYFPKLRIQDFFQYPTIEKMAKKIEKDAIQLQNNIVATVEMHKNENNTNLDK
                     HENNKNWDNLIQVTQQKPRCVLLTGGTGFLGAHILEQLLLLPDTLIYCLVRNQKQESL
                     EIKVQEKMKFYFGESILEKMKHRVKVIEGDLSQESLGLTPNIKKELIQEIDTIIHCGG
                     EVRHYGDREHFIRVNVKSTQFLIDMSKEARARFHYISTISISGHAPHDNEKILFYERD
                     FDKGQQLDNVYVESKFLAEKLVRKAIKEGVSATVYRVGNLVGHTLDGRFQENIEENAF
                     YRLIKAILLLQMAPDIRTCIDLVPIDFGSKAIVQLVCTMETEGETFHIINPVQLEWKQ
                     FIEYVIQMGHPIKIVNTEQFMNLFKDNTLSEKQKYALELIVPLLEETAKNSLSIPTCK
                     DTQRFLQEVGVLCELPNAKFVSNLIDYGYRIGFFSISTEYTKI"
     gene            151773..152012
                     /locus_tag="BSPH_RS23205"
                     /old_locus_tag="Bsph_p159"
                     /db_xref="GeneID:6020430"
     CDS             151773..152012
                     /locus_tag="BSPH_RS23205"
                     /old_locus_tag="Bsph_p159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291796.1"
                     /db_xref="GI:501248778"
                     /db_xref="GeneID:6020430"
                     /translation="MENGFQKYETLDEVLLNTVNQKSNIQQYSERSSYSTRGRKPISD
                     EKIELIKKLHLKGLSIRSIASIVRVGLGTVQKYRK"
     gene            152051..>152773
                     /locus_tag="BSPH_RS23210"
                     /old_locus_tag="Bsph_p160"
                     /note="chitin-binding protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6020429"
     gene            complement(152847..153062)
                     /locus_tag="BSPH_RS23215"
                     /old_locus_tag="Bsph_p161"
                     /db_xref="GeneID:6020428"
     CDS             complement(152847..153062)
                     /locus_tag="BSPH_RS23215"
                     /old_locus_tag="Bsph_p161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000090434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291798.1"
                     /db_xref="GI:501248780"
                     /db_xref="GeneID:6020428"
                     /translation="MGKLTKIERMRQAASDARYARRHRDLQIAMNEILFILSEGTRYE
                     NDVKEAFDILEEYEIEIRAGRMGNRIF"
     gene            complement(153101..153349)
                     /locus_tag="BSPH_RS23220"
                     /old_locus_tag="Bsph_p162"
                     /db_xref="GeneID:6020427"
     CDS             complement(153101..153349)
                     /locus_tag="BSPH_RS23220"
                     /old_locus_tag="Bsph_p162"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291799.1"
                     /db_xref="GI:501248781"
                     /db_xref="GeneID:6020427"
                     /translation="MLDWLEKSNEELLNEAMEIYKEENNEQDLGNYVCHICFKPNHYF
                     LTTSSPVGDGYGHSINICDCCGRKIGELAEQLSQLKEK"
     gene            154137..154349
                     /locus_tag="BSPH_RS23225"
                     /old_locus_tag="Bsph_p163"
                     /db_xref="GeneID:6020424"
     CDS             154137..154349
                     /locus_tag="BSPH_RS23225"
                     /old_locus_tag="Bsph_p163"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036161903.1"
                     /db_xref="GI:738205988"
                     /db_xref="GeneID:6020424"
                     /translation="MGAIVTPGNVHDSHVLHPLVERVSQNVKKALAVAADAVYKTPAI
                     MNFLLENRITIFKNNEREKNDKRNRV"
     gene            complement(154551..154892)
                     /locus_tag="BSPH_RS23230"
                     /old_locus_tag="Bsph_p164"
                     /db_xref="GeneID:6020423"
     CDS             complement(154551..154892)
                     /locus_tag="BSPH_RS23230"
                     /old_locus_tag="Bsph_p164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291801.1"
                     /db_xref="GI:501248783"
                     /db_xref="GeneID:6020423"
                     /translation="MINGEARSVLHEFIKLDMAIRSLQQDYSSLEKLKMSKIYINIVE
                     GLLKSIRKDFHDKRRVLIKKNIAVVKWVKIDEYFSDVVIKTAGEDAVLRYANQALKTQ
                     VEELINSRLNK"
     gene            complement(154885..155223)
                     /locus_tag="BSPH_RS23235"
                     /old_locus_tag="Bsph_p165"
                     /db_xref="GeneID:6020421"
     CDS             complement(154885..155223)
                     /locus_tag="BSPH_RS23235"
                     /old_locus_tag="Bsph_p165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004224216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291802.1"
                     /db_xref="GI:501248784"
                     /db_xref="GeneID:6020421"
                     /translation="MIHDRGSMKWTVMMLPEHLDLIRVLRQEQFYDKKRELTEWELEE
                     IEHTIQYAFKMQKLITLMLWNDNNLRDETGLVTGTDTVKKELLIDTDVAIKRIAFDKI
                     QDAKMVDFDD"
     gene            complement(155469..155819)
                     /locus_tag="BSPH_RS23240"
                     /old_locus_tag="Bsph_p168"
                     /db_xref="GeneID:6020418"
     CDS             complement(155469..155819)
                     /locus_tag="BSPH_RS23240"
                     /old_locus_tag="Bsph_p168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291803.1"
                     /db_xref="GI:501248785"
                     /db_xref="GeneID:6020418"
                     /translation="MIKADERKLLHKYLLLELAIKSLQVDYEKLEQFKMNKVFIPMMD
                     KLLNNLRQDFFNLKRELAQKHIRAVGWQPIDEYFSDIQVATAGNDVVLRYANQALKSQ
                     VEKLLTKYITNGKC"
     gene            complement(156481..156954)
                     /locus_tag="BSPH_RS23245"
                     /old_locus_tag="Bsph_p170"
                     /db_xref="GeneID:6020415"
     CDS             complement(156481..156954)
                     /locus_tag="BSPH_RS23245"
                     /old_locus_tag="Bsph_p170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000476892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659315.1"
                     /db_xref="GI:753952747"
                     /db_xref="GeneID:6020415"
                     /translation="MYKSIKEWLFSYTYTKYLVKLNKYKENTIALPISDQLAIINLIK
                     ELGAKKCCLELYQKPKTESWVINMAELDITKTGIIEYKNPSTRLKFELDFKKYEHATI
                     SLANSKTIVFELSDSISKKLLYIKLKITLPVSLDELIEESKGLAREERLSKNKVH"
     gene            complement(157040..157219)
                     /locus_tag="BSPH_RS23250"
                     /old_locus_tag="Bsph_p171"
                     /db_xref="GeneID:6020413"
     CDS             complement(157040..157219)
                     /locus_tag="BSPH_RS23250"
                     /old_locus_tag="Bsph_p171"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291806.1"
                     /db_xref="GI:501248788"
                     /db_xref="GeneID:6020413"
                     /translation="MAPVKTLPFRIVIKPRTVKVGEQIKFEENMVRISSIKEIEFLPG
                     GYVAVKGQCREVNVL"
     gene            complement(157349..157588)
                     /locus_tag="BSPH_RS23255"
                     /old_locus_tag="Bsph_p172"
                     /db_xref="GeneID:6020412"
     CDS             complement(157349..157588)
                     /locus_tag="BSPH_RS23255"
                     /old_locus_tag="Bsph_p172"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291807.1"
                     /db_xref="GI:501248789"
                     /db_xref="GeneID:6020412"
                     /translation="MAMKKVSGFILNFTDEEFGGIRNFFVVFILMNWIFQFFINIKIG
                     ESLASAFGHSFFYALPLILTFAVVYVYIKKFIRND"
     gene            complement(157704..>160172)
                     /locus_tag="BSPH_RS23260"
                     /db_xref="GeneID:23320145"
     CDS             complement(157704..>160172)
                     /locus_tag="BSPH_RS23260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019005920.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659325.1"
                     /db_xref="GI:753952766"
                     /db_xref="GeneID:23320145"
                     /translation="GSKTKNLVQPSPSGSISSDSGEFDVVKGIPSSEYLRADAQSEEY
                     LYDQDFTQRTGNTEFNNIPVSKTFTLTWRTRHKDSDGDYYYVDHSDTETVDVSVSGIK
                     RPFSYWEIKKYSIWKLLNSHFTNYALPGGEHTINANTDVTADGSHSEPVESHVFPPDC
                     PDITLPSESIDGGSSRPNVPDIIGEATAAAEAAIGDNEVENDRAEFKGTVIMDNSRTT
                     TNGPTPNDVPDPGMIDMTSRGLLIDPQKTNYFQSPSTGKVNYGPVFSIDGSATALNFP
                     FDVNVVTVHTPVVIYSKASDDKEHDQRTKPPLRSTPTDPDKDRHAFILDRPFTVTMPT
                     SGQHRNIPGYGNRDYAKYIKQKQVKFPFDVYTKTKQGYYPANTWVNVPVDMETVEFFM
                     PVWVPEGEYTINFRSFAINALGSGDFGGSEHHANVTIPNPSFNVPPAGSLSAAHVATD
                     SIEVDVVGRLYDFRITDVLDYNWFDVFRDERNQHTGNYYWVGKNGIDGDLRGNQSPFV
                     LPVRHGSHPDSYDANGELKYYKNLGVKKGYQFKFDFKTKGTMYDMKDAIRITPTFYFV
                     DKDGKNRRPVDVYYHMDNKKFVQVGSKDDQEVRNVVLNEPLRNVEEKQLINNSKFYYS
                     RVAGDNVDKESDYYKAFKEYAELGLSEREFIRKYFKDYSKKNVITGTYGWQILNWRLR
                     TAIGPTDAPTNTMIPSSDVVASEQQWHSEYSLPSKLYVVEKGTNVTTYAAQNKMNDNA
                     PIFLKDGYIIVNFNIESIQNGDLDNPHLQYINAPMMNQWKLEGYQSSFTDGYNYVFNL
                     NDGDVIFYQGNQSSDDDFKSTVTH"
     gene            complement(<161139..>161978)
                     /locus_tag="BSPH_RS23265"
                     /db_xref="GeneID:23320146"
     CDS             complement(<161139..>161978)
                     /locus_tag="BSPH_RS23265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018884288.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659327.1"
                     /db_xref="GI:753952769"
                     /db_xref="GeneID:23320146"
                     /translation="ATTKFKDVPSSHWAFKAITEVAQKGLVTGYADGTYKPSAQVTRA
                     EFATFLARVFDSKERIPAKFTDVGSSHWANDAIQEGLAVGFIKNSDFTNNKFEPNKAM
                     TRAEMSRWLANGLAHANADYGKAVEEMANSSLTLIPIPEFYKGGVNKQDLPYIGLALG
                     TGLLGGYEDFSFKPSGNTTRAEVATILIRFMDVMKKAPSEFTGLNELREVSKTGTNIL
                     TLTRYEQSPMKFGGYEDVLGKQHTYLNNTGIVTIEHAIFVDTTGSKPVGIYKDMFFNP
                     KSED"
     gene            complement(162352..162804)
                     /locus_tag="BSPH_RS23270"
                     /old_locus_tag="Bsph_p175"
                     /db_xref="GeneID:6020406"
     CDS             complement(162352..162804)
                     /locus_tag="BSPH_RS23270"
                     /old_locus_tag="Bsph_p175"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291810.1"
                     /db_xref="GI:501248792"
                     /db_xref="GeneID:6020406"
                     /translation="MRYKKKGMEIKMFYKKLDLITEATKSNTVKEVCYVSRIFKQNVY
                     TDSNGDLEVDDQEIDVNLHLDIPVHTFESFINALLELRKDFDVACAYSKEPLTHENSN
                     KENIVADKSYTFTYWNSVHNNVLHSNNKQANVFIYLNEFERYANLIVY"
     gene            complement(163117..164094)
                     /locus_tag="BSPH_RS23275"
                     /old_locus_tag="Bsph_p176"
                     /db_xref="GeneID:6020405"
     CDS             complement(163117..164094)
                     /locus_tag="BSPH_RS23275"
                     /old_locus_tag="Bsph_p176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019005923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291811.1"
                     /db_xref="GI:501248793"
                     /db_xref="GeneID:6020405"
                     /translation="MKLGNFVLLFVAIFFVFMISQQIRFDEVKNVNDQKKTFDTYLTT
                     ASQDAITTLSNNANPSFEHYYLSDKYSAVNKEESYNAFVRTLNRNFEIHDKISEDVIA
                     QHIPLFAILEYDGLSINKFQVYKKSGLTYSKRIWMPKIPFTYTDASGNIFRFTLDDYI
                     QVYDQYNDEWFEGFVDEVAKEANVLLLKDKKKLEIIRKRTIVETLQSHFAEVIAEHNK
                     FAMKQGITYTFALPVIDDETWYNSIDDIGIYTFFQGYPYFKIDKMYNHYAFVGARIKK
                     NERIIGSTQDGRKIFYEENCNFSYPKEEVFSTKAEAAKAGYSEKSCLNK"
     gene            complement(164081..164611)
                     /locus_tag="BSPH_RS23280"
                     /old_locus_tag="Bsph_p177"
                     /db_xref="GeneID:6020404"
     CDS             complement(164081..164611)
                     /locus_tag="BSPH_RS23280"
                     /old_locus_tag="Bsph_p177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017692344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291812.1"
                     /db_xref="GI:501248794"
                     /db_xref="GeneID:6020404"
                     /translation="MEKMPVLLLAGIFAVIVMLLFPAQHTFQRQDELVEEKVELETTK
                     LVDSIRTKGYISADMLNRFHSQIGLSNYLFKVEIIHEKKIYVPVYSDPNNPNTYTGDY
                     EIHYENSYTKEINDYIYNKKKRYELSADDFITIRVQNMVRTNASILKDVLTFNFTDDT
                     PEIFVQYGGMILNEAR"
     gene            complement(164626..165003)
                     /locus_tag="BSPH_RS23285"
                     /old_locus_tag="Bsph_p178"
                     /db_xref="GeneID:6020400"
     CDS             complement(164626..165003)
                     /locus_tag="BSPH_RS23285"
                     /old_locus_tag="Bsph_p178"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291813.1"
                     /db_xref="GI:501248795"
                     /db_xref="GeneID:6020400"
                     /translation="MSEPIKEMFELAVASFLFTSALFQLFYSQDLFFKGTEGLPTTET
                     VYFNSHEVKTPTSYWTGAQIVLFLKEADLEETPVQVGGVLFERENQVEQLWKSINPKD
                     LFTMVPKIENGDKVARIQFTLAN"
     gene            complement(165051..165518)
                     /locus_tag="BSPH_RS23290"
                     /old_locus_tag="Bsph_p179"
                     /db_xref="GeneID:6020397"
     CDS             complement(165051..165518)
                     /locus_tag="BSPH_RS23290"
                     /old_locus_tag="Bsph_p179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017811722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291814.1"
                     /db_xref="GI:501248796"
                     /db_xref="GeneID:6020397"
                     /translation="MESPVVKAIILAVTIFMIGGVVAYSIWNYNTGTDATKAANNRLG
                     NSITQMEEQTYAMYDNIEIKGSEVINAVKNFKEDGEAGKIGIKIVTGENVAGTWYYNS
                     FNSSKLTAVSTDISKLHDSSSGNIYFVNPNGIFKGTLQRDTNNTIRAIIFNQK"
     gene            complement(165617..167656)
                     /locus_tag="BSPH_RS23295"
                     /old_locus_tag="Bsph_p180"
                     /db_xref="GeneID:6020396"
     CDS             complement(165617..167656)
                     /locus_tag="BSPH_RS23295"
                     /old_locus_tag="Bsph_p180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014600155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291815.1"
                     /db_xref="GI:501248797"
                     /db_xref="GeneID:6020396"
                     /translation="MLIAIISLAVVSVGSAVAFIIYEKNKKKQIGLPKKKISNKNFNK
                     FYQKFYLLSSRFRLTNNILLRVRKKVETLAVYDEYSLRRQVAQTMVTIISVILVIILA
                     LMVIRPGWLISFWIMVGLVFATDLMIDFFIVRIEKKLLPQIKEFLKRLRYFYAQTHMI
                     DEASFESINYTGSEMKVQAQRIHNTLTSVNPEEEQLKYEEVAPNRFLKVISGLMVLVK
                     EKGDVIDPENERGSAFTRGIAAITKELNLEIMYRSKLAYRLRFLAPLTLIPIIFALPI
                     QSAIVYLFPIMSRFYESRIGFLGAIFIYAFSIGMYFVIRKIKDVSDVSYQTKLNKIQW
                     EKRLYEKFKIVRLIVKIFSPNYKTVSYAKKSQLIKDANEPLEVEWLTLRQLVLSVITL
                     IILVSGMLYAHKSESQSALYNIIPSSMMTSNVSDEEYEEFKKTTDFDREMIMKLQSAS
                     EFTADGIMQTIANQMGIDEVENPKVKQAYDRIMEKYTIVENAYFKWWELLIILLIVFG
                     IWYIPEILLQLQKNLRRKDMENEVHQFLTIISILREFNSIGVLTLLVWLERFSVTFKE
                     PLQKCILNFDSGPEEALEELSNDISFEAFQQIVERLKLSISRLSVKEAFEDIELEREF
                     YLEQREEYNTRSISNRGDFAYLASVSPVATLLILHVLVPIIYISTTHLQSMMTGF"
     gene            complement(167650..169509)
                     /locus_tag="BSPH_RS23300"
                     /old_locus_tag="Bsph_p181"
                     /db_xref="GeneID:6020395"
     CDS             complement(167650..169509)
                     /locus_tag="BSPH_RS23300"
                     /old_locus_tag="Bsph_p181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012961128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_012291816.1"
                     /db_xref="GI:501248798"
                     /db_xref="GeneID:6020395"
                     /translation="MTGEFLNFTLIFLVIAVVITLFVFRIVFAKRVEEKEAYEKEVYS
                     FANLFEFVKQDIEKAITKNINNLGLAHDDMERNRRILNTLRDALRSCNTGDDSSKRYV
                     IEYICDSLSKQYNFTEDNVNYVFTFNSPGQLTARDKFDISLFVLRRKYGKNALSKMID
                     EFKLAEPRKSGGYYIEDEDINQVYKVYGKQITLKDKIQIIAERIYAHYKGYGIIDMVR
                     DMNIDGVSGGVSGMPSRMENIDDDEAFKLSLNKQKNSGLNCAWIMYKGKSIHLRFMAF
                     EHEAELIRVVQVSYRYKFPGQLSESNPFIINEGFDGSRVTVACPPFAESWVFFIRKKF
                     SSKSLELNQIVTHNNAELAMQLLIFLIKGNRTTAFTGAQGSGKTTLLIALIKYIHESL
                     NLRIQETAFELNLRMIYNLRNILSFQETDKITGQMGMDFSKKTDGHVNILGEVATPPV
                     ASSMIQAGHLSLFTLLTHHAKTTDNLIFDVANSLKKEGIYNDDRSAQLAVVQVLEFNV
                     HLTQLYDGTRFVERITQIIPIEPVESDLQSRIAKNKDEKDELLLDLQIEYYKQNTQVK
                     PFITRNIIEFKNGRYEVAEPITAEKQKEMLERMSEEEGQQFKNLMKLWGEQAC"
     gene            complement(169512..170291)
                     /locus_tag="BSPH_RS23305"
                     /old_locus_tag="Bsph_p182"
                     /db_xref="GeneID:6020388"
     CDS             complement(169512..170291)
                     /locus_tag="BSPH_RS23305"
                     /old_locus_tag="Bsph_p182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015359039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291817.1"
                     /db_xref="GI:501248799"
                     /db_xref="GeneID:6020388"
                     /translation="MGQLIASWSPIQGKSGVTTNTAVLATLAAITKPYASLLINASNN
                     PNVLEKYVKDNKSNDPVISEGISGLKRLLNSNLLTPDSLPDYAENIIYNKLDLILGSE
                     LDEVQVTKLLQSAVSAYEYVWVDIKTGDNSTGELILEQADLVLVHLPQSLYDIENVLP
                     DIKNKLKIANKTFFIIGNYDNNANLTVKNIKRILKVKNSFHCISYSSTLKNAFNNNTL
                     PEFLLKISKQEPFTNNTKFVQGAINIIDDMLLTLSNDRKGW"
     gene            complement(170308..171033)
                     /locus_tag="BSPH_RS23310"
                     /old_locus_tag="Bsph_p183"
                     /db_xref="GeneID:6020387"
     CDS             complement(170308..171033)
                     /locus_tag="BSPH_RS23310"
                     /old_locus_tag="Bsph_p183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009226200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291818.1"
                     /db_xref="GI:501248800"
                     /db_xref="GeneID:6020387"
                     /translation="MSQNQIQILFFGSKNKSDTLLYLGGMLRNLGKKVLISDMTAVDL
                     YKHSYSLDENLDLLDFDGVDVLLNIPNRSKIDQQLLSSEESLESYDVVLYDVDSLDVL
                     QSNLWSEIDANYYVGDFDLMHQKLDAQMIDYLAKTYTNRLRRVTFETSYQISLDAIEA
                     YITEEIQWTSMNFLFENDEAQEGNRVRMQHENIIPLKGLSNQHRKMLTEVISHMFELP
                     NSDIEIANKRFRWFPNLKQKVTS"
     gene            complement(171039..171989)
                     /locus_tag="BSPH_RS23315"
                     /old_locus_tag="Bsph_p184"
                     /db_xref="GeneID:6020386"
     CDS             complement(171039..171989)
                     /locus_tag="BSPH_RS23315"
                     /old_locus_tag="Bsph_p184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009226201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291819.1"
                     /db_xref="GI:501248801"
                     /db_xref="GeneID:6020386"
                     /translation="MKIRFVTKKLIIAASLGAAAMLLISGVAFYFLYKSNVEKQEELR
                     QNYKDKLAELEYTTEQSELVYTLNTDVDKGQLIHKSMVQPSLVPKNAVPADAMTDVQF
                     GASKYYAKANYKMSQPVAESLFYIGENLTKDIRSVEYAAIELPSRIQKDEYVDVRIQF
                     PTGEDFIVFSKKKVVDTQGLTLWLENDEGEIQSMSSAMVDAYLNAGKLYALRYVDGET
                     QEKAEITYPVNKAVLERIKVDPNIVDIAKLNLEKQNREALELNLQALDKAKAEELRSK
                     ESQQKSLKEQEDKERLLNSVNEDANAELDPSGVINEEYGE"
     gene            complement(172006..173496)
                     /locus_tag="BSPH_RS23320"
                     /old_locus_tag="Bsph_p185"
                     /db_xref="GeneID:6020543"
     CDS             complement(172006..173496)
                     /locus_tag="BSPH_RS23320"
                     /old_locus_tag="Bsph_p185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016423466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041659316.1"
                     /db_xref="GI:753952748"
                     /db_xref="GeneID:6020543"
                     /translation="MLFKFIFLKGGEKMKLILASYNVPFMKKIGVDFEGQGGEIVAYV
                     SSEEDLINELMKHPDVKGVLIQSNLAKKHNDMRLDYLVDLLIGIKAEKKFKDINFTIL
                     SEVQKGHPFLAELVEMGIYNIYCINQKNIKVEHLYQSFVQPTSFSEAIHFRNVDSTIP
                     WRRNIQTARTVELKFQSENQEVVPEKPPSKLRGAFKAISDKVGKREVNTGEMVHEEDT
                     DTSSKQEQDKEIVNEEPIEDLIVSEEEIKEDPKTSKVWNLKKNSETPKFKPIGTMLIS
                     VCGVEEHLGSTTAAISIAKYLVEQNYNVALVEGNYSQDFDRIHALSEGEKAAILKEDA
                     FKLKGIPHFKYRSEMDLDKILTSYDYVVLDLGRLSDSPLENEFGRAHIKYVICSGDEW
                     KKHWIDSFNREYGHYEGINYLVPGAHEKAIEDLRIHIKNDDCLPFPTLDSPYKLSEDD
                     CIAISTILSECVETSKKSKNYEKLKTRLLVATSMLVIILGYYVLFN"
     gene            complement(173585..174520)
                     /locus_tag="BSPH_RS23325"
                     /old_locus_tag="Bsph_p186"
                     /db_xref="GeneID:6020537"
     CDS             complement(173585..174520)
                     /locus_tag="BSPH_RS23325"
                     /old_locus_tag="Bsph_p186"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291821.1"
                     /db_xref="GI:501248803"
                     /db_xref="GeneID:6020537"
                     /translation="MEDTAQFDIKIGENEVCEFKWGYLNFMDARLAILSKDSNPKLVN
                     YLKTELKKRNSQILHISSKDNVEWIADTWSIKDFEGIPSEEVTSLFAQHRNKWVQLYL
                     DYICWAHKENRYNLIKAAAYEAHKEGPLFAYIKGLETVENEKHREILTEAFKKLENVN
                     WKRSNEGFHFVLDTTCPVKFVESLIIGVWSAWIFTVCIDEPLHITHLVELELDKLFNL
                     PLTLDNEERAFIERAMYLLSQLTYDYLCSTISVTPTLFPAVEMQCEHIIADHTDIIDF
                     DLYSHLGALHGNEFIWKYKEEYRKLNFTLEHITAK"
     gene            complement(174535..175392)
                     /locus_tag="BSPH_RS23330"
                     /old_locus_tag="Bsph_p187"
                     /db_xref="GeneID:6020508"
     CDS             complement(174535..175392)
                     /locus_tag="BSPH_RS23330"
                     /old_locus_tag="Bsph_p187"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417265.1"
                     /db_xref="GI:670468577"
                     /db_xref="GeneID:6020508"
                     /translation="MEIHDKIQEIRSVFGRDELYLKIQRDFDLDELLNPEDEFYEKLT
                     FDEYYKTKEAAAMLGIADKSQQILNHLNNPNLADYIKATQSTDRRYRLTWQPLFRLKM
                     LFYLFDKNFKPNDVAILLGATAMYVPPTNEAPKSSVNHSSNIDLDKFKDDLVEFEKHQ
                     QQEMMKMFNAINERNQVLLEQAKAESKMELIIQQLDDLSNVEKQYEILLNILEESEKA
                     EPIKLKSIFKWMQISDEKTDYNKQKIDINSQLNQIKTKREELQSNLKDVKEKITLCTN
                     KMDRIGNTN"
     gene            complement(175692..176969)
                     /locus_tag="BSPH_RS23335"
                     /old_locus_tag="Bsph_p188"
                     /db_xref="GeneID:6020432"
     CDS             complement(175692..176969)
                     /locus_tag="BSPH_RS23335"
                     /old_locus_tag="Bsph_p188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication protein"
                     /protein_id="WP_012291823.1"
                     /db_xref="GI:501248805"
                     /db_xref="GeneID:6020432"
                     /translation="MEQKLSLNFGFLGLGMGGTSIAAACADIKTNIKNNNYPYTALLI
                     NSNQIDLNKIEPANTTSEKMLIGDGKGAGRDILIGEQLYENDQEDIKQRVETRFKEVD
                     YVWLVAGLGGGTGTGAVIQAIGTLLKSGFNGRFGMILTLPRLKEGRTVIENALQRLQK
                     ISQAMGKLGPILLVDNEKLFKQFSEEKPNSSVSEYLRFSNKYVAEALHDLNTVTASYL
                     PTGEYHFDSSEFEKLLKTPGLLHFARFTEKASSIDSSNNLSYAQKLKELIQKGVLSDG
                     YNLEEAQRLAVSVLTDNATAKRMFTFEFTKRMEDLVNELSPTALEKPIATYQSKDIKG
                     PAEVSFYAVFAGLGLPQARISEMVTEHNRLKELEQKVLETEKKDLFASFDASPTPKKE
                     EKTNDLEALFGSDTEKEKGKDDVEDTLELLKLL"
     gene            complement(177021..177332)
                     /locus_tag="BSPH_RS23340"
                     /old_locus_tag="Bsph_p189"
                     /db_xref="GeneID:6020514"
     CDS             complement(177021..177332)
                     /locus_tag="BSPH_RS23340"
                     /old_locus_tag="Bsph_p189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000098927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417266.1"
                     /db_xref="GI:670468578"
                     /db_xref="GeneID:6020514"
                     /translation="MEEMFFEMLAENLSNESKWFLVILEQESPNLVNKELLWEKVNDL
                     YSKAKKSEESLIKSRYVLDIHTARLEGAGLVKVERIGQIRMYSITAIGLKLLKYLKSK
                     D"
CONTIG      join(CP000818.1:1..177642)
//
DBGET integrated database retrieval system