GenomeNet

Database: RefSeq
Entry: NC_010382
LinkDB: NC_010382
Original site: NC_010382 
LOCUS       NC_010382            4639821 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Lysinibacillus sphaericus C3-41 chromosome, complete genome.
ACCESSION   NC_010382
VERSION     NC_010382.1  GI:169825618
DBLINK      Project: 58945
            BioProject: PRJNA58945
KEYWORDS    RefSeq.
SOURCE      Lysinibacillus sphaericus C3-41
  ORGANISM  Lysinibacillus sphaericus C3-41
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae;
            Lysinibacillus.
REFERENCE   1  (bases 1 to 4639821)
  AUTHORS   Hu,X., Fan,W., Han,B., Liu,H., Zheng,D., Li,Q., Dong,W., Yan,J.,
            Gao,M., Berry,C. and Yuan,Z.
  TITLE     Complete genome sequence of the mosquitocidal bacterium Bacillus
            sphaericus C3-41 and comparison with those of closely related
            Bacillus species
  JOURNAL   J. Bacteriol. 190 (8), 2892-2902 (2008)
   PUBMED   18296527
REFERENCE   2  (bases 1 to 4639821)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2008) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4639821)
  AUTHORS   Yuan,Z., Hu,X., Zheng,D., Yan,J. and Cai,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2007) State Key Laboratory of Virology, Wuhan
            Institute of Virology, Chinese Academy of Sciences, Wuchang
            Xiaohongshan Zhongqu 44, Wuhan, Hubei 430071, P.R.China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000817.
            Bacillus sphaericus C3-41 is available from Wuhan Institute of
            Virology, Chinese Academy of Sciences. Email address: yzm@wh.iov.cn
            DNA used for sequencing was isolated from B. sphaericus C3-41
            following standard protocols.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4639821
                     /organism="Lysinibacillus sphaericus C3-41"
                     /mol_type="genomic DNA"
                     /strain="C3-41"
                     /db_xref="taxon:444177"
     gene            211..651
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /db_xref="GeneID:6020959"
     CDS             211..651
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /note="Chromosomal replication initiator protein; ATPase
                     involved in DNA replication initiation"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA"
                     /protein_id="YP_001695777.1"
                     /db_xref="GI:169825619"
                     /db_xref="GeneID:6020959"
                     /translation="MLLALVTAIAHAASLAVAEAPAKAYNPFFIYGGVGLGKTHLMHA
                     IGHYVLEHNPNAKVVYLSSEKFTNEFINSIRDNKALDFRNKYRNVDVLLIDDIQFLAG
                     KESTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEASATFTF"
     misc_feature    268..618
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    286..645
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    304..327
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(307..330,493..495,592..594)
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    481..498
                     /gene="dnaA"
                     /locus_tag="Bsph_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            686..841
                     /gene="dnaA"
                     /locus_tag="Bsph_0002"
                     /db_xref="GeneID:6022195"
     CDS             686..841
                     /gene="dnaA"
                     /locus_tag="Bsph_0002"
                     /note="Chromosomal replication initiator protein; ATPase
                     involved in DNA replication initiation"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA"
                     /protein_id="YP_001695778.1"
                     /db_xref="GI:169825620"
                     /db_xref="GeneID:6022195"
                     /translation="METRIAILRKKAKADGLEVPNEVMLYIANQMDSNIRELKVRLFA
                     SLPIHRS"
     misc_feature    <689..802
                     /gene="dnaA"
                     /locus_tag="Bsph_0002"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl17189"
                     /db_xref="CDD:247743"
     gene            913..1041
                     /gene="dnaA"
                     /locus_tag="Bsph_0003"
                     /db_xref="GeneID:6022196"
     CDS             913..1041
                     /gene="dnaA"
                     /locus_tag="Bsph_0003"
                     /note="Chromosomal replication initiator protein; ATPase
                     involved in DNA replication initiation"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA"
                     /protein_id="YP_001695779.1"
                     /db_xref="GI:169825621"
                     /db_xref="GeneID:6022196"
                     /translation="MTILDIQNAVGEHFSIRLEDFTAKKRTKLIAFPRQIAHVFIT"
     misc_feature    916..>1023
                     /gene="dnaA"
                     /locus_tag="Bsph_0003"
                     /note="Bacterial dnaA protein helix-turn-helix domain;
                     Region: Bac_DnaA_C; smart00760"
                     /db_xref="CDD:197863"
     gene            1025..1198
                     /gene="dnaA"
                     /locus_tag="Bsph_0004"
                     /db_xref="GeneID:6022197"
     CDS             1025..1198
                     /gene="dnaA"
                     /locus_tag="Bsph_0004"
                     /note="Chromosomal replication initiator protein; ATPase
                     involved in DNA replication initiation"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA"
                     /protein_id="YP_001695780.1"
                     /db_xref="GI:169825622"
                     /db_xref="GeneID:6022197"
                     /translation="MYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISSLLKNDVQL
                     QQDVKQIRSMLGK"
     misc_feature    <1025..1189
                     /gene="dnaA"
                     /locus_tag="Bsph_0004"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1037..1039,1055..1063,1088..1102,1109..1111,
                     1118..1123)
                     /gene="dnaA"
                     /locus_tag="Bsph_0004"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1369..2505
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /db_xref="GeneID:6022198"
     CDS             1369..2505
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /EC_number="2.7.7.7"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_001695781.1"
                     /db_xref="GI:169825623"
                     /db_xref="GeneID:6022198"
                     /translation="MKFDILRDRLLEGLNDVMKAVSSKTTIPILTGIKIDVTEEGIRL
                     TGSDADITIQTFIPVEEDGQQIIHIAETGSIVVQARMFNEIIRKLPTNDVEIQVTPGF
                     QTHIRSGKSEFHLIGSDAAEYPLLPELTEDQKFTIPADLLKTIIRETVFAVATSESRP
                     VLTGVNWQIKNETLICVATDSHRLARRKVQLENLPEVEHSVVIPGKSLNELNKVLEDS
                     TNLVQIVITSQQVLFKTGDVLFFSRLLEGNYPDTSRLIPEEYQTNVTINGKSLLQAID
                     RASLVARGDRNNVVRFEILGHQAVEVSSNSPEIGKVQEEIPVESLEGEGLKISFSAKY
                     MMEALKAIDGQDVVIQFTGAMRPFILRSVHDDAILQLILPVRTY"
     misc_feature    1369..2499
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1369..2496
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1438..1440,1606..1608,1627..1629,1984..1986)
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1609..1611,1618..1620,1696..1698,1702..1704,
                     2206..2208,2305..2310)
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1903..1905,1909..1920,2359..2361,2485..2496)
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(1903..1905,1909..1914,2131..2133,2239..2241,
                     2281..2286,2368..2370,2485..2496)
                     /gene="dnaN"
                     /locus_tag="Bsph_0005"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2617..2841
                     /locus_tag="Bsph_0006"
                     /db_xref="GeneID:6022548"
     CDS             2617..2841
                     /locus_tag="Bsph_0006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695782.1"
                     /db_xref="GI:169825624"
                     /db_xref="GeneID:6022548"
                     /translation="MQDIKIDEEFITLGQLLKISDAISSGGMAKWFLQENAVYVNGEV
                     DDRRGRKLRNGDVVNIPGCGRFQIVGPTGQ"
     misc_feature    2626..2799
                     /locus_tag="Bsph_0006"
                     /note="S4 domain protein YaaA; Region: YaaA_near_RecF;
                     TIGR02988"
                     /db_xref="CDD:132033"
     gene            2845..3960
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /db_xref="GeneID:6022549"
     CDS             2845..3960
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="Recombinational DNA repair ATPase (RecF pathway)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695783.1"
                     /db_xref="GI:169825625"
                     /db_xref="GeneID:6022549"
                     /translation="MHIEQIKLTNYRNYDALALNFSPKINVFIGENAQGKTNVMESIY
                     VLAMAKSHRTTNDKELIRWDSDYGKIEGAVQKRHGILPIELTITKKGKKGKINHIEQS
                     RLSHYIGQMNVVMFAPEDLNVVKGSPQIRRRFIDMEIGQISPVYLHDLLTFQKVLKQR
                     NHFLKMNQGKSMSNDVMYEVYNEQYIHAATQIIRKRFQFMDLLQEWAEPIHAGISQGK
                     ETLIIKYRTVAGIEKEHSSSEIENTLHQKLMEAREREFDRGVTLVGPHRDDLQFLVNG
                     YDVQTYGSQGQQRTTALSLKLAEIELIKQETNETPILLLDDVLSELDDYRQSHLLNTI
                     QGEVQTFVTTTSVEGIHHETMEQAQLFHVKQGAIEKS"
     misc_feature    2845..3951
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    2851..>3339
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="ATP-binding cassette domain of RecF; Region:
                     ABC_RecF; cd03242"
                     /db_xref="CDD:213209"
     misc_feature    2932..2955
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    order(2941..2946,2950..2958,3145..3147)
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213209"
     misc_feature    3136..3147
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213209"
     misc_feature    <3616..3951
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:247755"
     misc_feature    3691..3720
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    3778..3795
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    3802..3813
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    3868..3888
                     /gene="recF"
                     /locus_tag="Bsph_0007"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            4053..5987
                     /locus_tag="Bsph_0008"
                     /db_xref="GeneID:6022550"
     CDS             4053..5987
                     /locus_tag="Bsph_0008"
                     /EC_number="5.99.1.3"
                     /note="Type IIA topoisomerase (DNA gyrase/topo II,
                     topoisomerase IV), B subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_001695784.1"
                     /db_xref="GI:169825626"
                     /db_xref="GeneID:6022550"
                     /translation="MKAVAIENEGLQNQAYEADQIQVLEGLEAVRKRPGMYIGSTSSK
                     GLHHLVWEIVDNSIDEALAGFCTDIQVTIEKENWIRVEDNGRGIPVSIQEKMGKPAVE
                     VIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSVETIVQVHREGHIHEIKFQRGKT
                     IQELKIIGDTDRNGTTTRFKADPEIFKETTVYEYDILAHRIRELAYLNRGIKITIADE
                     REGEERSTTYHYEGGIRSYVEHLNQSKEPIHDPIDVLGEKDGISVEIAMQYNAGFSSN
                     IFSFANNINTYEGGTHESGFKTALTRVINDYARKGGLLKEADANLTGEDVREGLTAIV
                     SVKHPDPQFEGQTKTKLGNSEVSQITNSLFSDGFERFMLENPTVARKVVEKGLMAARA
                     RVAAKKAREFTRRKNALEVSSLPGKLADCSSTNPADCEIYIVEGDSAGGSAKSGRDRH
                     FQAILPLRGKILNVEKARLDKILSNAEIRAMITAFGTGIGEEFNLEKARYHKIIIMTD
                     ADVDGAHIRTLLLTFFFRFLRPLIEAGYIYIAQPPLYQVKQGKHVEYCYDDETLKEIL
                     ERLPKMPKPNVQRYKGLGEMNAEQLWDTTMDPEHRTLLQVELDDAIKANQAFERLMGD
                     EVEPRRQFIEENAVYANLDI"
     misc_feature    4086..5984
                     /locus_tag="Bsph_0008"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    4188..>4349
                     /locus_tag="Bsph_0008"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    4218..4220
                     /locus_tag="Bsph_0008"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4305..4307,4311..4313)
                     /locus_tag="Bsph_0008"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4746..5207
                     /locus_tag="Bsph_0008"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    4896..4898
                     /locus_tag="Bsph_0008"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5070..5072,5079..5084,5088..5090)
                     /locus_tag="Bsph_0008"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5088..5090,5094..5096)
                     /locus_tag="Bsph_0008"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5337..5678
                     /locus_tag="Bsph_0008"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5355..5360,5367..5369,5574..5576,5580..5582,
                     5586..5588)
                     /locus_tag="Bsph_0008"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5355..5357,5574..5576)
                     /locus_tag="Bsph_0008"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    5769..5954
                     /locus_tag="Bsph_0008"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:201537"
     gene            6013..8478
                     /locus_tag="Bsph_0009"
                     /db_xref="GeneID:6022551"
     CDS             6013..8478
                     /locus_tag="Bsph_0009"
                     /EC_number="5.99.1.3"
                     /note="Type IIA topoisomerase (DNA gyrase/topo II,
                     topoisomerase IV), A subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="YP_001695785.1"
                     /db_xref="GI:169825627"
                     /db_xref="GeneID:6022551"
                     /translation="MSEQERSGVKGINITEEIETSFLDYAMSVIVSRALPDVRDGLKP
                     VHRRILYGMQELGNTADKPYKKSARIVGDVMGKYHPHGDSSIYDAMVRMAQDFSYRYM
                     LVDGHGNFGSVDGDGAAAMRYTESRMSKIAMEMLRDINKDTIDYTDNYDGSEKEPIVL
                     PSRYPNLLVNGAAGIAVGMATNIPPHHLGETIDAVIALSENPAITTEELMEIIPGPDF
                     PTGGLILGRSGIRRAYESGRGSIIIRAKVEIEQKANGKETILVHELPYQVNKAKLIEK
                     IAELVRDKKIDGITNLRDESDRRGMRVVIEVRKDANANVVLNNLYKQTAMQSSFGINM
                     LSLVNGQPKVLGLKEMLYHYLEHQKVIIRRRTEFDLRKAEDRAHILEGLRIALDHIDE
                     IIAIIRGSRSGEEAKPQLMERFNLSERQAQAILDMRLVRLSGLEREKIEAEYQELQVL
                     IAELKAILADEAKIVDIIRTEILELKDRYSDTRRTEITSGGIEMIEDEDLIPVENSVV
                     TLTHNGYIKRLAANTYRSQKRGGRGVQGMGTNEDDFVEHLMNTSTHDTILFFTSKGKV
                     FRAKGYEIPEYGRTAKGLPIVNLLNIDKGEKVTAMIRVGSFDEDAYFIFTTKTGITKR
                     TPVSQFANIRTNGLIAISLREDDDLISVRLTDGDKQIIIGTRDGMLVRFQEDDIRSMG
                     RTAGGVRGIKLRDGDEVVGMEIVEPGQEILVVTEKGYGKRTSEDDYRLQSRGGVGLKT
                     MQITDKNGPMVAVKTVDGSEDIMLITINGMLIRMDVNDISLIGRSTQGVRLIRLGDDE
                     LVATVAKVEKEEELPEDEEEIEE"
     misc_feature    6025..8403
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase subunit A; Validated; Region: PRK05560"
                     /db_xref="CDD:235502"
     misc_feature    6103..7437
                     /locus_tag="Bsph_0009"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    order(6103..6186,6199..6348,6352..6408,6412..6483,
                     6490..6492)
                     /locus_tag="Bsph_0009"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    6379..6381
                     /locus_tag="Bsph_0009"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    order(7174..7182,7189..7200,7231..7236,7276..7326)
                     /locus_tag="Bsph_0009"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     misc_feature    7525..7668
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:217832"
     misc_feature    7675..7824
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:217832"
     misc_feature    7846..7980
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:217832"
     misc_feature    7987..8130
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:217832"
     misc_feature    8137..8283
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:217832"
     misc_feature    8290..>8403
                     /locus_tag="Bsph_0009"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:217832"
     gene            8620..9702
                     /locus_tag="Bsph_0010"
                     /db_xref="GeneID:6022552"
     CDS             8620..9702
                     /locus_tag="Bsph_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695786.1"
                     /db_xref="GI:169825628"
                     /db_xref="GeneID:6022552"
                     /translation="METIHVPISELGVGRVISEDIFANTQYPIIFKDTTISHVHLQVF
                     QAFNIFNVPVYKNQNDIHSEKREIDVEVVVEDIPTFRKSYNHSIEQFKKEFKNWEAGS
                     KVDIAKARTIILPLVEMVLEDRTIIFDLNEFSNPKDYLYHHCVATALISSVVAQKLGY
                     DRGTTIQIAIGGLLADCGMAKVHPRIRDKKTPLTEQEFDEIYKHPIYSYNMVKDLTIL
                     KETMKEAIFQHHERLNGSGYPKGEKIANISIFAQIIAVADVFHAMTCERVYRSKQSSF
                     KVIEMINESEFGKFDIKVVRALIDIVADLPIGTIVELSNLERGEVMFVNKFAPTRPLI
                     KLVHTGEIFDLGKNRSFYISRIITNL"
     misc_feature    <8860..9624
                     /locus_tag="Bsph_0010"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    9031..9459
                     /locus_tag="Bsph_0010"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(9046..9048,9142..9147,9391..9393)
                     /locus_tag="Bsph_0010"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    9145..9147
                     /locus_tag="Bsph_0010"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            10101..11641
                     /locus_tag="Bsph_rRNA0116S"
                     /db_xref="GeneID:6022553"
     rRNA            10101..11641
                     /locus_tag="Bsph_rRNA0116S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022553"
     gene            11736..11812
                     /locus_tag="Bsph_tRNA1"
                     /db_xref="GeneID:6021975"
     tRNA            11736..11812
                     /locus_tag="Bsph_tRNA1"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:6021975"
     gene            11825..11900
                     /locus_tag="Bsph_tRNA2"
                     /db_xref="GeneID:6021976"
     tRNA            11825..11900
                     /locus_tag="Bsph_tRNA2"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:6021976"
     gene            complement(12016..12153)
                     /locus_tag="Bsph_0012"
                     /db_xref="GeneID:6021977"
     CDS             complement(12016..12153)
                     /locus_tag="Bsph_0012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695787.1"
                     /db_xref="GI:169825629"
                     /db_xref="GeneID:6021977"
                     /translation="MPRHSPCALNNLTYQLSIHFTFRCQPHSFNQSRTEVRSFIYSIA
                     A"
     gene            12129..15045
                     /locus_tag="Bsph_rRNA0123S"
                     /db_xref="GeneID:6022017"
     rRNA            12129..15045
                     /locus_tag="Bsph_rRNA0123S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6022017"
     gene            15234..15340
                     /locus_tag="Bsph_rRNA015S"
                     /db_xref="GeneID:6022018"
     rRNA            15234..15340
                     /locus_tag="Bsph_rRNA015S"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:6022018"
     gene            15617..16510
                     /locus_tag="Bsph_0014"
                     /db_xref="GeneID:6022019"
     CDS             15617..16510
                     /locus_tag="Bsph_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695788.1"
                     /db_xref="GI:169825630"
                     /db_xref="GeneID:6022019"
                     /translation="MWIDGVFSGGGLKGFALVGAYQVLEDENFRFKRVAGTSAGAILA
                     AFIAAGYSGREIEMMLEELDVPSLLDSRRTILPFPFMKWINVYNHLGLYKGKALEKWF
                     FKKLAEKGVYTFGDLPKDSLKLVASDLTNGRMIVLPDDLHKYEIDAKNFSVACALRMS
                     CGIPFFFEPVTLKTGKGESIIVDGGVLSNFPLWIFDDREGRKVRPILGLKLSRRREEQ
                     CPHEIKNGLNLFEALFSTMKDAHDERYISRRHERDIIFIPVEDYSATQFDLNEETKET
                     LLEIGRNRTIQFLRNWPRLRL"
     misc_feature    15623..16492
                     /locus_tag="Bsph_0014"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    15626..16219
                     /locus_tag="Bsph_0014"
                     /note="ExoU and VipD-like proteins; homologus to patatin,
                     cPLA2, and iPLA2; Region: Pat_ExoU_VipD_like; cd07207"
                     /db_xref="CDD:132846"
     misc_feature    order(15644..15649,15653..15655,15728..15730,16163..16165)
                     /locus_tag="Bsph_0014"
                     /note="active site"
                     /db_xref="CDD:132846"
     misc_feature    15722..15736
                     /locus_tag="Bsph_0014"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132846"
     gene            16818..18361
                     /locus_tag="Bsph_rRNA0216S"
                     /db_xref="GeneID:6022020"
     rRNA            16818..18361
                     /locus_tag="Bsph_rRNA0216S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022020"
     gene            18456..18532
                     /locus_tag="Bsph_tRNA3"
                     /db_xref="GeneID:6022021"
     tRNA            18456..18532
                     /locus_tag="Bsph_tRNA3"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:6022021"
     gene            18545..18620
                     /locus_tag="Bsph_tRNA4"
                     /db_xref="GeneID:6022571"
     tRNA            18545..18620
                     /locus_tag="Bsph_tRNA4"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:6022571"
     gene            18849..21762
                     /locus_tag="Bsph_rRNA0223S"
                     /db_xref="GeneID:6022572"
     rRNA            18849..21762
                     /locus_tag="Bsph_rRNA0223S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6022572"
     gene            21954..22060
                     /locus_tag="Bsph_rRNA025S"
                     /db_xref="GeneID:6021890"
     rRNA            21954..22060
                     /locus_tag="Bsph_rRNA025S"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:6021890"
     gene            22358..23821
                     /locus_tag="Bsph_0017"
                     /db_xref="GeneID:6021891"
     CDS             22358..23821
                     /locus_tag="Bsph_0017"
                     /EC_number="1.1.1.205"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="YP_001695789.1"
                     /db_xref="GI:169825631"
                     /db_xref="GeneID:6021891"
                     /translation="MWETKFAKEGLTFDDVLLVPAHSEVLPKDVDLSVQLTPKIKLNI
                     PMISAGMDTVTESKMAIAMARQGGIGIIHKNMGIDEQAEQVEKVKRSENGVITNPFFL
                     TPTHQVFDAEHLMGKYRISGVPIVDSMENQKLVGIITNRDLRFISDYSLKIEDVMTKE
                     DLITAPVGTTLEDAEKILQQYKIEKLPIVDEEGRLTGLITIKDIEKVIEFPNAAKDTH
                     GRLLVGAAVGVSKDTMVRIEKLVEAQVDIVVIDTAHGHSEGVLQTIRSIRETYPELEI
                     IAGNVATAEGARALFEAGADVVKVGIGPGSICTTRVVAGVGVPQITAVYDCATVAREL
                     GKTIIADGGIKYSGDIVKALAAGGNVVMLGSLLAGTSESPGETEIFQGRRFKVYRGMG
                     SIGAMEKGSKDRYFQEDAKKLVPEGIEGRLPYKGPLADTIYQLIGGIRAGMGYCGAPH
                     LEYLRENAQFVKMTGAGLRESHPHDVQITKESPNYSM"
     misc_feature    22364..23818
                     /locus_tag="Bsph_0017"
                     /note="inosine 5'-monophosphate dehydrogenase; Reviewed;
                     Region: PRK05567"
                     /db_xref="CDD:235507"
     misc_feature    22385..>22624
                     /locus_tag="Bsph_0017"
                     /note="TIM barrel proteins share a structurally conserved
                     phosphate binding motif and in general share an eight
                     beta/alpha closed barrel structure. Specific for this
                     family is the conserved phosphate binding site at the
                     edges of strands 7 and 8. The phosphate...; Region:
                     TIM_phosphate_binding; cl17186"
                     /db_xref="CDD:247740"
     misc_feature    22643..22975
                     /locus_tag="Bsph_0017"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains in the
                     inosine 5' monophosphate dehydrogenase (IMPDH) protein.
                     IMPDH is an essential enzyme that catalyzes the first step
                     unique to GTP synthesis, playing a...; Region:
                     CBS_pair_IMPDH; cd04601"
                     /db_xref="CDD:239974"
     misc_feature    <23012..23746
                     /locus_tag="Bsph_0017"
                     /note="IMPDH: The catalytic domain of the inosine
                     monophosphate dehydrogenase. IMPDH catalyzes the
                     NAD-dependent oxidation of inosine 5'-monophosphate (IMP)
                     to xanthosine 5' monophosphate (XMP). It is a
                     rate-limiting step in the de novo synthesis of...; Region:
                     IMPDH; cd00381"
                     /db_xref="CDD:238223"
     misc_feature    order(23273..23281,23378..23380,23384..23386,23447..23452,
                     23519..23521,23525..23533,23603..23608)
                     /locus_tag="Bsph_0017"
                     /note="active site"
                     /db_xref="CDD:238223"
     gene            23963..25294
                     /locus_tag="Bsph_0018"
                     /db_xref="GeneID:6021892"
     CDS             23963..25294
                     /locus_tag="Bsph_0018"
                     /EC_number="3.4.16.4"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="YP_001695790.1"
                     /db_xref="GI:169825632"
                     /db_xref="GeneID:6021892"
                     /translation="MKKKMNTVLRLLLIPVLLIGIFAGIPAKASAETDLGLTVDAAIL
                     IDADSGKILYEQNADTSLGIASMTKMMTEYLLLDAIDAGTVKWDQEYHVTDYTYRMSQ
                     NRALSNVPLRRDGSYTIRELYEAMAIYSANAATVAIAETIAGTETEFLKLMNKKAEEL
                     GLEGYKFVNATGLNNADLFGMHPAGTGPEDENVMPAKYVAKLAYHLLKDHPKVLETSQ
                     ITKKTFREGTEDAIEMSNWNFMLPGLVFEYQGVDGLKTGTTNFAGHCFTGTAERNGTR
                     LIAVVMKAVDASGQGSYKARFDATAKLFNYGFSQFSKQEILPANYTFKDQKTVKVTKG
                     KEDKVEIAVKEPISFMIKSSDKDLYKPKLVLDKKSLEAGVKKDTVVGKVVIERTEGTD
                     YGFIDGKDISSDIVTTGSVERASGISLFFQGIGNFFGNLWSGISDFVGGLF"
     misc_feature    24026..24814
                     /locus_tag="Bsph_0018"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; cl17872"
                     /db_xref="CDD:248426"
     misc_feature    24038..25291
                     /locus_tag="Bsph_0018"
                     /note="D-alanyl-D-alanine carboxypeptidase [Cell envelope
                     biogenesis, outer membrane]; Region: DacC; COG1686"
                     /db_xref="CDD:224600"
     misc_feature    24893..25201
                     /locus_tag="Bsph_0018"
                     /note="Penicillin-binding protein 5, C-terminal domain;
                     Region: PBP5_C; smart00936"
                     /db_xref="CDD:198004"
     gene            25395..27230
                     /locus_tag="Bsph_0019"
                     /db_xref="GeneID:6022059"
     CDS             25395..27230
                     /locus_tag="Bsph_0019"
                     /EC_number="6.3.5.4"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthetase"
                     /protein_id="YP_001695791.1"
                     /db_xref="GI:169825633"
                     /db_xref="GeneID:6022059"
                     /translation="MCGITGWASFQKNLKASEKVLQAMTRTLNRRGPDDENIWCSEHI
                     AFGHRRLAVIDLIGGKQPMKKLHDGINYVITYNGELYNTEELRKELEKRGHTFTTHSD
                     TEVLLTAYIEWKEQCVDFLNGIFAFGIWDEQEQSLFLCRDRLGVKPLYFTEQQGGILF
                     ASEVKALLAHPMVQAAINTEGLASMMAVGPSRAPGKTLFQNIEELRPGFAMRFSREGL
                     RKWQYWQLQSRKHEETLEETIEQVRWLLTDAIERQLISDVPICTFLSGGLDSSIITGI
                     AADRFRQQNNQLHTYSIDYEDNERFFNPHAFQTSTDTYWIQKMTEAFKTTHHAEEITQ
                     QQLIDLLVESVIVRDSPGMADVDSSLLWFCREIKRDFTVALSGECADEIFGGYPWFKE
                     KTTGFPWIRSLAERNAILQEKWDKKLKIESYAQQLYTQTITEVPLLDGESPAEVKHRE
                     MFYLNMQWFMQTLLERKDRMSMGASLEVRVPFADHRLVEYAWNIPWEMKNLDGIEKGL
                     LRKSMAHLLPDEVLYRKKNPYPKTYHPVYTAGVQTWLREILKDKNSILHELFEYKKLT
                     ELIESGGSSFKIPWYGQLMAGPQLLAYLGQIHSWFEHYHIQLIES"
     misc_feature    25398..26069
                     /locus_tag="Bsph_0019"
                     /note="Glutamine amidotransferases class-II (GATase)
                     asparagine synthase_B type.  Asparagine synthetase B
                     catalyses the ATP-dependent conversion of aspartate to
                     asparagine. This enzyme is a homodimer, with each monomer
                     composed of a  glutaminase domain and a...; Region: AsnB;
                     cd00712"
                     /db_xref="CDD:238364"
     misc_feature    order(25398..25400,25542..25544,25623..25631,25698..25700)
                     /locus_tag="Bsph_0019"
                     /note="active site"
                     /db_xref="CDD:238364"
     misc_feature    25404..26981
                     /locus_tag="Bsph_0019"
                     /note="asparagine synthase (glutamine-hydrolyzing);
                     Region: asn_synth_AEB; TIGR01536"
                     /db_xref="CDD:233454"
     misc_feature    order(25446..25448,25470..25472,25479..25481,25488..25502,
                     25539..25541)
                     /locus_tag="Bsph_0019"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238364"
     misc_feature    26127..26984
                     /locus_tag="Bsph_0019"
                     /note="The C-terminal domain of Asparagine Synthase B.
                     This domain is always found associated n-terminal
                     amidotransferase domain. Family members that contain this
                     domain catalyse the conversion of aspartate to asparagine.
                     Asparagine synthetase B  catalyzes the...; Region:
                     Asn_Synthase_B_C; cd01991"
                     /db_xref="CDD:238949"
     misc_feature    order(26181..26189,26271..26279,26481..26483,26520..26528)
                     /locus_tag="Bsph_0019"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238949"
     misc_feature    order(26181..26189,26271..26279,26481..26483,26520..26528)
                     /locus_tag="Bsph_0019"
                     /note="Molecular Tunnel; other site"
                     /db_xref="CDD:238949"
     gene            complement(27248..28675)
                     /locus_tag="Bsph_0020"
                     /db_xref="GeneID:6022060"
     CDS             complement(27248..28675)
                     /locus_tag="Bsph_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_001695792.1"
                     /db_xref="GI:169825634"
                     /db_xref="GeneID:6022060"
                     /translation="MDMLLFQLERNGDKPLYDQLYNGIKEAIISKKIAVGEKLPSKRK
                     LADFLNISQTTIEIAYAQLLAEGYIMSKSRVGYFVEEIDELPYIQQDIVIPFNEHVKK
                     KSYKIDFNPGSIDIDAFPFQIWRKYAKELFDEASKNLLLTGEPQGELSLRTEIANYLY
                     QSRGVICNPEQIVVGSGTEQLLPMILRLFRDDTCFALENPGYPAVHRMFSQHKRKVYP
                     IAVDEEGIVIHELERTQANVVYITPSHQFPTGAVLSATRRAQALNWAAQSSSRYIIED
                     DYDSEFRYTGKPIPALHALDRNDKVIYMSTFTKSLMPSLRVAYFVLPPQLLATYNDVF
                     NYYSSTVPRFDQHIVANFMHDGHFAKHLNRMRKVYRKKHDQLTSILEKYSSSIKITGE
                     QAGMHILLDVKHELPEKQLQQLAFYAGIGIYPLSDYRLDHGESSQAQFLLGFGGIPVH
                     VIEQSIEQLMDCWGIQKNNPSTTTK"
     misc_feature    complement(27287..28642)
                     /locus_tag="Bsph_0020"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(28439..28633)
                     /locus_tag="Bsph_0020"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(28445..28456,28460..28465,28493..28495,
                     28502..28507,28511..28525,28547..28552,28556..28558,
                     28625..28627,28631..28633))
                     /locus_tag="Bsph_0020"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(27299..28357)
                     /locus_tag="Bsph_0020"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(27728..27730,27749..27754,27758..27760,
                     27839..27841,27935..27937,28070..28072,28139..28147))
                     /locus_tag="Bsph_0020"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(27632..27634,27641..27643,27728..27736,
                     27860..27862,28040..28042,28136..28138))
                     /locus_tag="Bsph_0020"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(27749..27751)
                     /locus_tag="Bsph_0020"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            28779..29663
                     /locus_tag="Bsph_0021"
                     /db_xref="GeneID:6022061"
     CDS             28779..29663
                     /locus_tag="Bsph_0021"
                     /note="with PdxT forms pyridoxal 5'-phosphate from
                     glutamine, either ribose 5-phosphate or ribulose
                     5-phosphate, and either glyceraldehyde 3-phosphate or
                     dihydroxyacetone phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal biosynthesis lyase PdxS"
                     /protein_id="YP_001695793.1"
                     /db_xref="GI:169825635"
                     /db_xref="GeneID:6022061"
                     /translation="MKQTGTNLVKRGMAEMQKGGVIMDVINAEQAKIAEAAGAVAVMA
                     LERVPSDIRKAGGVARMADPRIVEEVLGAVSIPVMAKARIGHIVEARVLEAMGVDYID
                     ESEVLTPADEEYHLLKSNYTVPFVCGCRDLGEAARRIGEGAAMLRTKGEPGTGNIVEA
                     VRHIRKVNAQVRKVVGMTEDELMTEAKLLGAPFELLREIKRLGRLPVVNFAAGGVATP
                     ADAALMMELGADGVFVGSGIFKSDNPEKFAHAIVEATTHYKDYKLIAEISKELGVPMK
                     GIDIAQLGLNERMQERGW"
     misc_feature    28782..29660
                     /locus_tag="Bsph_0021"
                     /note="pyridoxal biosynthesis lyase PdxS; Provisional;
                     Region: PRK04180"
                     /db_xref="CDD:179769"
     misc_feature    28803..29660
                     /locus_tag="Bsph_0021"
                     /note="pyridoxal 5'-phosphate synthase, synthase subunit
                     Pdx1; Region: TIGR00343"
                     /db_xref="CDD:129443"
     misc_feature    order(29415..29420,29481..29486)
                     /locus_tag="Bsph_0021"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:240073"
     gene            29665..30228
                     /gene="pdxT"
                     /locus_tag="Bsph_0022"
                     /db_xref="GeneID:6022062"
     CDS             29665..30228
                     /gene="pdxT"
                     /locus_tag="Bsph_0022"
                     /EC_number="2.6.-.-"
                     /note="Predicted glutamine amidotransferase involved in
                     pyridoxine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase subunit"
                     /protein_id="YP_001695794.1"
                     /db_xref="GI:169825636"
                     /db_xref="GeneID:6022062"
                     /translation="MKRIGVLALQGAVREHVQMLESLGCEAVEVKHKQDLVKLDGLVL
                     PGGESTTMRKLLDRFELLEPIREIAQRGLPMFGTCAGLILMATTLVNDEPHLAVMDVT
                     VARNSYGRQVDSFEVMLDIPKIGEAIPAVFIRAPHIVKVGKDVEILAEHEGKIILAQD
                     RHLLGCSFHPELTSDTRILEYFVASMV"
     misc_feature    29674..30213
                     /gene="pdxT"
                     /locus_tag="Bsph_0022"
                     /note="Glutamine Amidotransferase (GATase_I) involved in
                     pyridoxine biosynthesis; Region: GATase1_PB; cd01749"
                     /db_xref="CDD:153220"
     misc_feature    29713..30213
                     /gene="pdxT"
                     /locus_tag="Bsph_0022"
                     /note="Glutamine amidotransferase class-I; Region: GATase;
                     pfam00117"
                     /db_xref="CDD:215729"
     misc_feature    order(29800..29808,29899..29901,29977..29979,30061..30066,
                     30169..30171,30175..30177)
                     /gene="pdxT"
                     /locus_tag="Bsph_0022"
                     /note="predicted active site [active]"
                     /db_xref="CDD:153220"
     misc_feature    order(29899..29901,30169..30171,30175..30177)
                     /gene="pdxT"
                     /locus_tag="Bsph_0022"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153220"
     gene            30638..31918
                     /locus_tag="Bsph_0023"
                     /db_xref="GeneID:6022063"
     CDS             30638..31918
                     /locus_tag="Bsph_0023"
                     /EC_number="6.1.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="YP_001695795.1"
                     /db_xref="GI:169825637"
                     /db_xref="GeneID:6022063"
                     /translation="MLDIKRVRDNFAEIKEMLLTRNEDLGNLDDFENLDAKRRELIAK
                     TEELKAERNKVSEQISVMKRNKENADEVIARMRQVGDEIKELDIQLNDVEDRFKDMMM
                     RLPNVPHESVPVGTTEDDNVEEYTWGEIPAFDFEIKAHWDLATDLKIVDFERGAKVTG
                     SRFLFYRGLGARLERALMTFMMDLHAEEHGYEEMLPPVIVNRESLTGTGQLPKFEEDV
                     FKLAETDYFMIPTAEVPVTNFYRDEILTAEALPQGFAAYSACFRSEAGSAGRDTRGLI
                     RQHQFNKVELVRFVKPEESYEQLELLTGHAEKVLQLLGLPYRKLKMCTADLGFTAAKK
                     YDLEVWIPAQNMYREISSCSNFEDFQARRANIRFRREPNAKPEYVHTLNGSGLAIGRT
                     VAAILENYQQADGSVVIPEVLRPYMGGKEVIAPK"
     misc_feature    30638..31915
                     /locus_tag="Bsph_0023"
                     /note="seryl-tRNA synthetase; Provisional; Region:
                     PRK05431"
                     /db_xref="CDD:235461"
     misc_feature    30638..30961
                     /locus_tag="Bsph_0023"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:217020"
     misc_feature    30995..31888
                     /locus_tag="Bsph_0023"
                     /note="Seryl-tRNA synthetase (SerRS) class II core
                     catalytic domain. SerRS is responsible for the attachment
                     of serine to the 3' OH group of ribose of the appropriate
                     tRNA. This domain It is primarily responsible for
                     ATP-dependent formation of the enzyme...; Region:
                     SerRS_core; cd00770"
                     /db_xref="CDD:238393"
     misc_feature    order(31097..31114,31121..31141,31151..31153,31157..31159,
                     31163..31165,31172..31174,31211..31222,31226..31234,
                     31238..31240,31292..31297,31301..31303,31313..31315,
                     31340..31342,31352..31354,31364..31366,31412..31414,
                     31475..31477,31883..31888)
                     /locus_tag="Bsph_0023"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238393"
     misc_feature    order(31118..31120,31328..31330,31334..31336,31421..31423,
                     31427..31429,31445..31447,31454..31456,31463..31465,
                     31469..31471,31478..31480,31484..31486,31490..31492,
                     31682..31693,31784..31786,31790..31792,31808..31810)
                     /locus_tag="Bsph_0023"
                     /note="active site"
                     /db_xref="CDD:238393"
     misc_feature    31211..31234
                     /locus_tag="Bsph_0023"
                     /note="motif 1; other site"
                     /db_xref="CDD:238393"
     misc_feature    31418..31429
                     /locus_tag="Bsph_0023"
                     /note="motif 2; other site"
                     /db_xref="CDD:238393"
     misc_feature    order(31793..31801,31808..31810)
                     /locus_tag="Bsph_0023"
                     /note="motif 3; other site"
                     /db_xref="CDD:238393"
     gene            complement(32373..32885)
                     /locus_tag="Bsph_0024"
                     /db_xref="GeneID:6022342"
     CDS             complement(32373..32885)
                     /locus_tag="Bsph_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695796.1"
                     /db_xref="GI:169825638"
                     /db_xref="GeneID:6022342"
                     /translation="MDIFETDRLFMKQALEEAKKAAILGEVPIGAVLVYDGEIIARAH
                     NLRETTQNATTHAELMVIQEACQKIGSWRLEKTTLYVTLEPCPMCAGAILQSRVPRVV
                     YGARDIKAGCVDSLYRILNDARFNHECEVSEGILADECGQILTDFFRALRERKKAEKK
                     TRQAAMTEKN"
     misc_feature    complement(32532..32855)
                     /locus_tag="Bsph_0024"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(32619..32621,32628..32630,32712..32720,
                     32751..32753,32799..32801))
                     /locus_tag="Bsph_0024"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(32598..32603,32610..32615,32622..32627,
                     32697..32699,32709..32711,32724..32726))
                     /locus_tag="Bsph_0024"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(32619..32621,32628..32633,32712..32720))
                     /locus_tag="Bsph_0024"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            33070..33399
                     /gene="yozA"
                     /locus_tag="Bsph_0025"
                     /db_xref="GeneID:6022343"
     CDS             33070..33399
                     /gene="yozA"
                     /locus_tag="Bsph_0025"
                     /note="Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695797.1"
                     /db_xref="GI:169825639"
                     /db_xref="GeneID:6022343"
                     /translation="MDEEIKITKMENSQHLDDETLFVVSQTFKALSDPTRIRILNLLC
                     ADEHSVNDIAEILDLGQSTVSHQLRFLKNLRLVKFRREGTTLFYSKDDDHIMNLLKQA
                     IEHAAHN"
     misc_feature    33151..33381
                     /gene="yozA"
                     /locus_tag="Bsph_0025"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(33151..33156,33160..33162,33169..33171,33178..33183,
                     33190..33195,33202..33204,33292..33294,33349..33354,
                     33358..33366,33370..33378)
                     /gene="yozA"
                     /locus_tag="Bsph_0025"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(33154..33159,33169..33177,33214..33222,33247..33258,
                     33262..33267,33274..33279,33283..33288,33304..33312,
                     33325..33333)
                     /gene="yozA"
                     /locus_tag="Bsph_0025"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(33214..33216,33223..33225,33349..33351)
                     /gene="yozA"
                     /locus_tag="Bsph_0025"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            33418..34365
                     /gene="czcD"
                     /locus_tag="Bsph_0026"
                     /db_xref="GeneID:6022344"
     CDS             33418..34365
                     /gene="czcD"
                     /locus_tag="Bsph_0026"
                     /codon_start=1
                     /transl_table=11
                     /product="cation efflux system protein"
                     /protein_id="YP_001695798.1"
                     /db_xref="GI:169825640"
                     /db_xref="GeneID:6022344"
                     /translation="MGHNHDHGHDHTHGANKKVLIVSFIIITSYMVVEAIGGFLTNSL
                     ALLSDAGHMLSDSISLAIALLAFVFGEKAASYSKTYGYKRFEILAAVLNGVTLIGIAL
                     FIFYEAIERFANPPEVATTGMLIISTIGLLVNILVAWIMMRGSDTKDNLNMRGAFLHV
                     LSDMLGSVGAIVAALLIMFFGWGWADPLASVIVALLVIRSGYYVTKSAIHVLMEGTPS
                     NVDVQEIIQLIEQTDGVESIHDLHIWTITSGTNALSCHAVVNKYLKIVDGEHILRKIE
                     HNLEHKGIKHVTIQLETASHPHESSILCQLKNVHEHHHE"
     misc_feature    33463..34305
                     /gene="czcD"
                     /locus_tag="Bsph_0026"
                     /note="Co/Zn/Cd efflux system component [Inorganic ion
                     transport and metabolism]; Region: CzcD; COG1230"
                     /db_xref="CDD:224151"
     misc_feature    33466..34302
                     /gene="czcD"
                     /locus_tag="Bsph_0026"
                     /note="Predicted Co/Zn/Cd cation transporters [Inorganic
                     ion transport and metabolism]; Region: MMT1; COG0053"
                     /db_xref="CDD:223131"
     gene            34435..34767
                     /locus_tag="Bsph_0027"
                     /db_xref="GeneID:6022345"
     CDS             34435..34767
                     /locus_tag="Bsph_0027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695799.1"
                     /db_xref="GI:169825641"
                     /db_xref="GeneID:6022345"
                     /translation="MEDIVKEDACHTEGATSCRKSHHPERVKKDLTTRLNRIEGQIRG
                     IKGMIEKDVYCDDVITQLSATQSALNSVAKILLEGHLKGCVVDRLSEGDDAVLDELVV
                     TIQKLMKK"
     misc_feature    34516..34761
                     /locus_tag="Bsph_0027"
                     /note="Staphylococcus aureus copper-sensitive operon
                     repressor (CsoR), and related domains; this family was
                     previously known as part of DUF156; Region:
                     SaCsoR-like_DUF156; cd10152"
                     /db_xref="CDD:197387"
     misc_feature    order(34516..34518,34525..34530,34537..34542,34549..34551,
                     34558..34563,34567..34572,34579..34590,34594..34602,
                     34606..34614,34618..34623,34627..34632,34639..34644,
                     34651..34656,34660..34668,34672..34680,34687..34689,
                     34711..34716,34720..34749)
                     /locus_tag="Bsph_0027"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197387"
     misc_feature    order(34516..34518,34525..34530,34537..34542,34549..34551,
                     34558..34563,34567..34572,34579..34590,34594..34602,
                     34606..34614,34618..34623,34627..34632,34639..34644,
                     34651..34653,34660..34662,34672..34674,34729..34731,
                     34738..34749)
                     /locus_tag="Bsph_0027"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197387"
     misc_feature    order(34594..34596,34672..34674,34729..34731)
                     /locus_tag="Bsph_0027"
                     /note="allosteric switch controlling residues; other site"
                     /db_xref="CDD:197387"
     misc_feature    order(34597..34599,34672..34674,34684..34686)
                     /locus_tag="Bsph_0027"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197387"
     misc_feature    order(34654..34656,34663..34668,34675..34680,34684..34689,
                     34711..34716,34720..34728,34732..34737)
                     /locus_tag="Bsph_0027"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197387"
     gene            34802..35008
                     /gene="copZ"
                     /locus_tag="Bsph_0028"
                     /db_xref="GeneID:6022346"
     CDS             34802..35008
                     /gene="copZ"
                     /locus_tag="Bsph_0028"
                     /codon_start=1
                     /transl_table=11
                     /product="copper chaperone copper-ion-binding protein
                     CopZ"
                     /protein_id="YP_001695800.1"
                     /db_xref="GI:169825642"
                     /db_xref="GeneID:6022346"
                     /translation="MQNVTLNVQGMSCGHCVNAVEKNVGALTGVEQVKVNLAEGLVDV
                     AFDDAQVSLDQIKETIDDQGYEVK"
     misc_feature    34802..>35005
                     /gene="copZ"
                     /locus_tag="Bsph_0028"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    34814..35005
                     /gene="copZ"
                     /locus_tag="Bsph_0028"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(34832..34840,34847..34849)
                     /gene="copZ"
                     /locus_tag="Bsph_0028"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            35090..37501
                     /locus_tag="Bsph_0029"
                     /db_xref="GeneID:6022625"
     CDS             35090..37501
                     /locus_tag="Bsph_0029"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-transporting P-type ATPase copA"
                     /protein_id="YP_001695801.1"
                     /db_xref="GI:169825643"
                     /db_xref="GeneID:6022625"
                     /translation="MSSDHKEANLQITGMTCAACATRIEKGLNKMDGVEQATVNLALE
                     KSSIKYDPAKLSEADFEKKIEALGYGVVKQKTELDITGMTCAACATRIEKRLNKMSGV
                     SSANVNLALEKAMIEFNPSEVNIADIIAKVEKLGYGAHQKADEQETEDHREKVIKQQQ
                     QKFILSAILSLPLLWTMVGHFSFTSFLYVPEFLMNPWVQMVLATPVQFIIGKQFYVGA
                     YKALRNGSANMDVLVVMGTSAAYFYSVYQAIVTIGTHHGPHLYFETSAVLITLILLGK
                     LFEAKAKGRSSEAIKKLMGLQAKTAIVVRDGMEREVPLEEVMIGDVILVKPGEKIPVD
                     GEVLEGTTAVDESMLTGESLPVDKKQGDQLFGSTINKNGFIKMTATKVGRDTALAQII
                     KVVEDAQGSKAPIQRLADQISGVFVPIVVGIAIVTFIVWIIWVRPGEFTPALEVLIAV
                     LVIACPCALGLATPTSIMAGSGRAAEFGILFKGGEHLEQTQSIDTVVVDKTGTVTHGK
                     PVLTDVLLAPDQEETHFLSLIGAAEKQSEHPLAEAIVHGIEERGIALGDVQFFEAIPG
                     YGVQATVSGQGVIIGTRKLMQQYGIQLDNILPKMEELERNGKTAMLAAINGQYAGVVA
                     VADTVKDTSKEAIHRLQDMGITVIMMTGDNERTAQAIGTEVGVNQVIAEVLPEGKADE
                     VKKLQAQGKNVAMVGDGINDAPALATANIGMAIGTGTDVAMEAADITLIRGDLNSIAD
                     AILMSRKTMRNIKQNLFWAFAYNTLGIPIAAIGLLAPWVAGAAMAFSSVSVVLNALRL
                     QRVKL"
     misc_feature    35102..>35302
                     /locus_tag="Bsph_0029"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    35117..35302
                     /locus_tag="Bsph_0029"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(35132..35140,35147..35149)
                     /locus_tag="Bsph_0029"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    35306..37489
                     /locus_tag="Bsph_0029"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    35318..35509
                     /locus_tag="Bsph_0029"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(35336..35344,35351..35353)
                     /locus_tag="Bsph_0029"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    35888..36556
                     /locus_tag="Bsph_0029"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:215733"
     misc_feature    36938..37279
                     /locus_tag="Bsph_0029"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     gene            37652..38323
                     /locus_tag="Bsph_0030"
                     /db_xref="GeneID:6022626"
     CDS             37652..38323
                     /locus_tag="Bsph_0030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695802.1"
                     /db_xref="GI:169825644"
                     /db_xref="GeneID:6022626"
                     /translation="MIESIEQKEELLVTVPFVTVEGPIGVGKTSLSKEIAATFNYHLL
                     KEIVDENPFLNKFYENIEEWSFQTEMFFLCNRYKQLTDIKKFRLAHAKPVVADYHIFK
                     NLIFAKRTLASTEYEKYEEIYKILTKDMPVPNVVVYLHASVETLMKRIAMRGRDFEKM
                     ISRDYMEQLVIDYHSFIEHFEKMHPEIPVIRFNGDQLDFVKNPDDLNYVLKIIKDTLQ
                     KRSLQ"
     misc_feature    37697..38305
                     /locus_tag="Bsph_0030"
                     /note="Deoxynucleoside kinases [Nucleotide transport and
                     metabolism]; Region: COG1428"
                     /db_xref="CDD:224345"
     misc_feature    37700..38260
                     /locus_tag="Bsph_0030"
                     /note="Deoxyribonucleoside kinase (dNK) catalyzes the
                     phosphorylation of deoxyribonucleosides to yield
                     corresponding monophosphates (dNMPs). This family consists
                     of various deoxynucleoside kinases including deoxyribo-
                     cytidine (EC 2.7.1.74), guanosine (EC 2.7.1; Region: dNK;
                     cd01673"
                     /db_xref="CDD:238836"
     misc_feature    order(37727..37729,37733..37738,37823..37825,37853..37858,
                     37970..37972,38108..38110,38123..38125)
                     /locus_tag="Bsph_0030"
                     /note="Substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     misc_feature    37877..37879
                     /locus_tag="Bsph_0030"
                     /note="Substrate specificity [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     gene            38323..38991
                     /locus_tag="Bsph_0031"
                     /db_xref="GeneID:6022627"
     CDS             38323..38991
                     /locus_tag="Bsph_0031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695803.1"
                     /db_xref="GI:169825645"
                     /db_xref="GeneID:6022627"
                     /translation="MNLREKYDIPPQTVITIAGTVGVGKSTMTKALAEALNFRTSFEK
                     VDTNPYLDKFYEDFEKWSFHLQVYFLAERFKEQKRIFEYGGGFIQDRSIYEDTGIFAK
                     MHYDKGTMSPTDYETYTNLFDAMVMTPYFPHPDLLVYLEGPIDAVIGRIQERGRAMEQ
                     QTPNDYWIEMHERYENWINNFNSCPVLRLDINDYDLLKNPDAIESIVSRIGHMLKQTS
                     HLRK"
     misc_feature    38347..38970
                     /locus_tag="Bsph_0031"
                     /note="Deoxynucleoside kinases [Nucleotide transport and
                     metabolism]; Region: COG1428"
                     /db_xref="CDD:224345"
     misc_feature    38362..38922
                     /locus_tag="Bsph_0031"
                     /note="Deoxyribonucleoside kinase (dNK) catalyzes the
                     phosphorylation of deoxyribonucleosides to yield
                     corresponding monophosphates (dNMPs). This family consists
                     of various deoxynucleoside kinases including deoxyribo-
                     cytidine (EC 2.7.1.74), guanosine (EC 2.7.1; Region: dNK;
                     cd01673"
                     /db_xref="CDD:238836"
     misc_feature    order(38389..38391,38395..38400,38485..38487,38515..38520,
                     38620..38622,38782..38784,38797..38799)
                     /locus_tag="Bsph_0031"
                     /note="Substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     misc_feature    38539..38541
                     /locus_tag="Bsph_0031"
                     /note="Substrate specificity [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     gene            39081..39608
                     /locus_tag="Bsph_0032"
                     /db_xref="GeneID:6022628"
     CDS             39081..39608
                     /locus_tag="Bsph_0032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695804.1"
                     /db_xref="GI:169825646"
                     /db_xref="GeneID:6022628"
                     /translation="MYCGSGIGRSPVYGEKAAELGAVLAKHGHGVVYGGSKTGLMGKV
                     ADAVLAAGGEVIGVMPTHLQKRELAHASLTEIHFVESMHIRKAKMAELADAFIALPGG
                     AGTLDEYFEVFTWAQIGLHEKPVILYNVNGFYDALLQHFKIMLEEGFIRSEQKSFFRI
                     ANTADDILRLLKKHG"
     misc_feature    39084..39587
                     /locus_tag="Bsph_0032"
                     /note="Possible lysine decarboxylase; Region:
                     Lysine_decarbox; cl00695"
                     /db_xref="CDD:242034"
     gene            39673..40581
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /db_xref="GeneID:6022629"
     CDS             39673..40581
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm dispersion protein bdlA"
                     /protein_id="YP_001695805.1"
                     /db_xref="GI:169825647"
                     /db_xref="GeneID:6022629"
                     /translation="MQGADTQVTDDLVVQAIERNIAIIRFDMDRRVAYVNELFAKTLG
                     YTVQELLGKNHKDFCLPNFVHSPAYEQFWRNLVAGNSYQDKIERIDANGHRVWLEATY
                     MPVFANHSNKVIGVSKIATNITERQNEITNVADQLKEMSNGLHQRSETGIQNSQELLS
                     TIQEVSQESKENVSNLTQLQNQADSIKGIVKTIQEIAAQTNLLALNAAIEAARAGEYG
                     RGFDVVAKEVRKLSVRVEQSISEVKDNIEGIEREISQVTDSITKIAEKVEKTHEQITI
                     TTKDFSEIATAAEALDEQSKQFIEII"
     misc_feature    39730..40041
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    39751..40047
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:222120"
     misc_feature    order(39775..39777,39787..39789,39805..39807,39844..39855,
                     39934..39936,39949..39951)
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(39835..39837,39847..39849,39874..39876,39883..39888,
                     39970..39972,39976..39978)
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    <40018..40563
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    40057..40563
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(40057..40062,40069..40074,40081..40083,40090..40095,
                     40099..40104,40111..40113,40120..40125,40132..40134,
                     40141..40146,40153..40158,40165..40167,40174..40179,
                     40183..40188,40198..40200,40204..40209,40216..40218,
                     40225..40230,40237..40242,40249..40251,40258..40260,
                     40267..40272,40279..40281,40291..40293,40300..40302,
                     40321..40323,40333..40335,40342..40344,40351..40356,
                     40363..40365,40372..40377,40384..40389,40393..40398,
                     40405..40410,40447..40452,40459..40461,40468..40473,
                     40480..40482,40489..40494,40498..40503,40510..40515,
                     40522..40524,40531..40536,40543..40545,40552..40557,
                     40561..40563)
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    40267..40368
                     /gene="bdlA"
                     /locus_tag="Bsph_0033"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            40667..41296
                     /locus_tag="Bsph_0034"
                     /db_xref="GeneID:6022592"
     CDS             40667..41296
                     /locus_tag="Bsph_0034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695806.1"
                     /db_xref="GI:169825648"
                     /db_xref="GeneID:6022592"
                     /translation="MLWMTKVEVSFQHVPTTAISDATGGHTNLCSTIKPLADHFKIAG
                     RAVTVRLPDGENGAVLEAIRAANEGDILVIDAKGNTNRAVAGDFVVSLAKGVGVQGFV
                     VDGVIRDIAAIRELDFPVFSLGTTVAAGNKNGGGKVNVPIAIGGVTVHPGDYIIGDVD
                     GVIVVPQQDAEKVIEAAEEKMLKDEKRAQEAHANGKESILAYLDKVLGN"
     misc_feature    40697..41278
                     /locus_tag="Bsph_0034"
                     /note="Demethylmenaquinone methyltransferase [Coenzyme
                     metabolism]; Region: MenG; COG0684"
                     /db_xref="CDD:223756"
     gene            complement(41342..42616)
                     /gene="gltT"
                     /locus_tag="Bsph_0035"
                     /db_xref="GeneID:6022593"
     CDS             complement(41342..42616)
                     /gene="gltT"
                     /locus_tag="Bsph_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="proton/sodium-glutamate symport protein"
                     /protein_id="YP_001695807.1"
                     /db_xref="GI:169825649"
                     /db_xref="GeneID:6022593"
                     /translation="MKKKFKISLAAQILIGLILGIIVGGIFYGNPKIETYLQPLGDIF
                     LHLIKMIVVPIIISTLIVGVAGTGDMKQLGRLGGKSIIYFEIITTVAILVGLLSANIF
                     QPGAGINMSELSQGDISKYVTTTEEVQHEGPFDIIVGIVPTNIIQSMAEGNMLAIIFF
                     SVIFGLGVAAVGERGKPVLDFFQGVADAMFWVTNLVMKFAPIGVFGLIGVTVSKYGFA
                     SLVPLAKLAILVYATMLFFIFVVLGLVAKFAGISIFYLIKVLKDELILAFSTASSEAV
                     LPRIMLKMEKLGAPKDIVSFVIPTGYSFNLDGSTLYQAIAALFIAQMYGIHLSIGEQI
                     TLMLVLMVTSKGIAGVPGVSFVVLLATLGTVGIPLEGLAFIAGIDRILDMGRTVVNVI
                     GNSLASLVMAKWEGRFDREKMKNYFNENENLA"
     misc_feature    complement(41360..42610)
                     /gene="gltT"
                     /locus_tag="Bsph_0035"
                     /note="Sodium:dicarboxylate symporter family; Region: SDF;
                     cl00573"
                     /db_xref="CDD:241958"
     misc_feature    complement(41399..42538)
                     /gene="gltT"
                     /locus_tag="Bsph_0035"
                     /note="Na+/H+-dicarboxylate symporters [Energy production
                     and conversion]; Region: GltP; COG1301"
                     /db_xref="CDD:224220"
     gene            complement(42707..43585)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /db_xref="GeneID:6022594"
     CDS             complement(42707..43585)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory transduction protein"
                     /protein_id="YP_001695808.1"
                     /db_xref="GI:169825650"
                     /db_xref="GeneID:6022594"
                     /translation="MRYFIVDDDRASRVMLKQIIEDSGLGTVIGEARNGEDAIPQILM
                     TQPEFVLIDLLMPKLDGIATVEHLIQNRFEGQFIMISQVVNKEMVGEAYEQGIEFFIH
                     KPINRIEVENVLKKTTEQFRLKNSLLVIRQSLTNIELSEQKANKATSRDHIQSILNDM
                     GIVGEIGSEDIIAIIETLLAHQHKIAPLPPLKELYEEIAAVTKATPDEILKESKAIEQ
                     RVRRTILAAMINLANLGVVDYTNSEFEYYAPRYFDFKEIRQLMTQIEDHDNRKAKVNI
                     KKFIQVLYSDILTKVN"
     misc_feature    complement(43238..43576)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(43241..43576)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="Response regulator receiver domain; Region:
                     Response_reg; pfam00072"
                     /db_xref="CDD:200976"
     misc_feature    complement(order(43274..43279,43286..43288,43343..43345,
                     43403..43405,43427..43429,43562..43567))
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(43427..43429)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(43403..43411,43415..43420))
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(43271..43279)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(42737..43135)
                     /gene="glnL"
                     /locus_tag="Bsph_0036"
                     /note="YcbB domain; Region: YcbB; pfam08664"
                     /db_xref="CDD:149650"
     gene            complement(44973..45062)
                     /locus_tag="Bsph_tRNA85"
                     /db_xref="GeneID:6022595"
     tRNA            complement(44973..45062)
                     /locus_tag="Bsph_tRNA85"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:6022595"
     gene            45697..47433
                     /locus_tag="Bsph_0038"
                     /db_xref="GeneID:6022596"
     CDS             45697..47433
                     /locus_tag="Bsph_0038"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="YP_001695809.1"
                     /db_xref="GI:169825651"
                     /db_xref="GeneID:6022596"
                     /translation="MSGQAHVKRTLQNALLANKTTHAYLFSGPRGTGKTSTAKIFAKA
                     LNCEHAPSEEPCNECATCLSITDGSHPDVIEFDAASNSRVEEIRDIIEKVRFAPASSR
                     YKVYIIDEVHMLSTSAFNALLKTLEEPPPHAVFILATTEPHKLPATIISRCQRFDFKR
                     LSTNDIIERMKVVLEDIELPYEEQGLKVIAQSAAGGMRDALSLLDQVVSFSGEKLKLE
                     DTLLVTGSISQEVFYDLANALKAKDVAQMLALLEQLITDGKDPLRLSEDLITFFRDLL
                     LLQTSEDLAELLELVSPEERVLSLAHEFAPDMLYGYIDILAKTQQEMRFSHHTKIYLE
                     TALLKMVQFSGGSTNQAISPTSDTVISPDLAQKIVALEQMVQQLSLQLQSGAPAQASQ
                     APKEQRPRAKNPNGYKAPTGRIQEVLKDATKQDVQRIKSIWAQALNQLQKSQSALLAE
                     AEPVAASSSAFVLKFKYDIHCQMVADNQSLKAHFTQLIAGQTGIMYEMLCIPEESWLK
                     MREEFIRDHSMQHKKISAASENGEELLEPPPAEISDEPFIDDAQPLASQDPLVTEAEK
                     LFGKDFVEIMED"
     misc_feature    45697..47427
                     /locus_tag="Bsph_0038"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK05563"
                     /db_xref="CDD:235505"
     misc_feature    45703..46161
                     /locus_tag="Bsph_0038"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    45778..45801
                     /locus_tag="Bsph_0038"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(45781..45804,46021..46023,46114..46116)
                     /locus_tag="Bsph_0038"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    46009..46026
                     /locus_tag="Bsph_0038"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    46150..46152
                     /locus_tag="Bsph_0038"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    46369..46728
                     /locus_tag="Bsph_0038"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:152604"
     gene            47455..47769
                     /locus_tag="Bsph_0039"
                     /db_xref="GeneID:6022142"
     CDS             47455..47769
                     /locus_tag="Bsph_0039"
                     /note="Uncharacterized protein conserved in bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695810.1"
                     /db_xref="GI:169825652"
                     /db_xref="GeneID:6022142"
                     /translation="MRGMGNMQGMMKKMQKMQKEMMEAQEALNAEQFEGVAGGGMVKV
                     TVSGQREVVSVNLDESVVDPEDIEMLQDLIVIATNEALKKVEEKTNSTMGKFTQGLNL
                     PF"
     misc_feature    <47536..47763
                     /locus_tag="Bsph_0039"
                     /note="hypothetical protein; Validated; Region: PRK00153"
                     /db_xref="CDD:234669"
     gene            47823..48377
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /db_xref="GeneID:6022143"
     CDS             47823..48377
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="YP_001695811.1"
                     /db_xref="GI:169825653"
                     /db_xref="GeneID:6022143"
                     /translation="MKLPGIGPKTAARLAFFVLSMKEEDVLSFSKALIDAKRNLSYCS
                     VCGNITDVDPCHICTDKQRDHSIICVVQDTKDVIAMEKMRDYNGMYHVLQGAISPMDG
                     IGPEDINVASLLVRLHDESVQELILATNSTIEGEATAMYISRLVKPSGIRTTRIAHGL
                     PVGGDLEYADEVTLSKAMEGRREL"
     misc_feature    47823..48374
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /note="recombination protein RecR; Reviewed; Region: recR;
                     PRK00076"
                     /db_xref="CDD:234616"
     misc_feature    47892..48014
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /note="RecR protein; Region: RecR; pfam02132"
                     /db_xref="CDD:202123"
     misc_feature    48018..48353
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /note="TOPRIM_recR: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in Escherichia coli RecR.  RecR participates in the RecFOR
                     pathway of homologous recombinational repair in
                     prokaryotes. This pathway provides a...; Region:
                     TOPRIM_recR; cd01025"
                     /db_xref="CDD:173775"
     misc_feature    order(48036..48041,48048..48050,48210..48212,48216..48218,
                     48222..48224)
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /note="putative active site [active]"
                     /db_xref="CDD:173775"
     misc_feature    order(48036..48038,48210..48212)
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173775"
     misc_feature    order(48054..48062,48066..48071,48192..48194,48198..48200,
                     48204..48206,48213..48215,48249..48251,48279..48314,
                     48318..48320,48333..48335,48339..48341,48345..48353)
                     /gene="recR"
                     /locus_tag="Bsph_0040"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173775"
     gene            48391..48606
                     /locus_tag="Bsph_0041"
                     /db_xref="GeneID:6022144"
     CDS             48391..48606
                     /locus_tag="Bsph_0041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695812.1"
                     /db_xref="GI:169825654"
                     /db_xref="GeneID:6022144"
                     /translation="MFFRSKGKLKKEFDDRLVNLIKETKEDLQQAKIIEELMDDYDLG
                     AIAQRKAAESIHFYLFKEARIRRVLIK"
     misc_feature    48391..48603
                     /locus_tag="Bsph_0041"
                     /note="Protein of unknown function (DUF2508); Region:
                     DUF2508; pfam10704"
                     /db_xref="CDD:220854"
     gene            48680..48952
                     /locus_tag="Bsph_0042"
                     /db_xref="GeneID:6022145"
     CDS             48680..48952
                     /locus_tag="Bsph_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695813.1"
                     /db_xref="GI:169825655"
                     /db_xref="GeneID:6022145"
                     /translation="MSWLVIMSICVPVGLLFLYVIIRHAKLGKILEGLSVFWFRFAFA
                     FLLLFMIHLGIGYIGYNVPINLFSVLTIAVLGIPGVLGITALIFIL"
     gene            49243..50787
                     /locus_tag="Bsph_rRNA0316S"
                     /db_xref="GeneID:6022180"
     rRNA            49243..50787
                     /locus_tag="Bsph_rRNA0316S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022180"
     gene            50882..50958
                     /locus_tag="Bsph_tRNA5"
                     /db_xref="GeneID:6022181"
     tRNA            50882..50958
                     /locus_tag="Bsph_tRNA5"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:6022181"
     gene            50971..51046
                     /locus_tag="Bsph_tRNA6"
                     /db_xref="GeneID:6022182"
     tRNA            50971..51046
                     /locus_tag="Bsph_tRNA6"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:6022182"
     gene            51274..54186
                     /locus_tag="Bsph_rRNA0323S"
                     /db_xref="GeneID:6022831"
     rRNA            51274..54186
                     /locus_tag="Bsph_rRNA0323S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6022831"
     gene            54378..54484
                     /locus_tag="Bsph_rRNA035S"
                     /db_xref="GeneID:6022832"
     rRNA            54378..54484
                     /locus_tag="Bsph_rRNA035S"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:6022832"
     gene            54601..55041
                     /locus_tag="Bsph_0046"
                     /db_xref="GeneID:6022833"
     CDS             54601..55041
                     /locus_tag="Bsph_0046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695814.1"
                     /db_xref="GI:169825656"
                     /db_xref="GeneID:6022833"
                     /translation="MATGLYTSEAINIQREKLESFIQNREKWAVLIPGYLHHELLNEN
                     NMIWVFQGDFGIIQKAVKVELQMKSLEPHQVLFDLVGLSDPINGDGLFEIKQHQDESL
                     QLTGSLTMKASGFLSGMMNPVLEKFVPQLVEQLVRQMAVTVAKE"
     misc_feature    54631..55020
                     /locus_tag="Bsph_0046"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cd07812"
                     /db_xref="CDD:176854"
     misc_feature    order(54652..54660,54664..54669,54712..54714,54730..54732,
                     54736..54738,54742..54744,54748..54750,54787..54789,
                     54793..54795,54802..54804,54823..54825,54829..54831,
                     54874..54879,54883..54885,54889..54891,54910..54912,
                     54916..54918,54922..54924,54928..54930,54970..54984,
                     54988..54993,55000..55008,55015..55017)
                     /locus_tag="Bsph_0046"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            55227..56660
                     /locus_tag="Bsph_0047"
                     /db_xref="GeneID:6021801"
     CDS             55227..56660
                     /locus_tag="Bsph_0047"
                     /note="Arginine/lysine/ornithine decarboxylases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695815.1"
                     /db_xref="GI:169825657"
                     /db_xref="GeneID:6021801"
                     /translation="MFVLQKKKPIIEGLERFRQQQNISFHVPGHKHGELSHLPQAFKD
                     VMRYDVTELSGLDDLHYPEEMILEAEHLLADTYGAMKSFFLVGGSTVGNLAMIYATCQ
                     KGDTIIVQRNAHKSIFHAIELVGAKPIFVSPIWDERTLTATHVTFLDLKEAVENYSEA
                     KAVVLTYPTYYGVTSNEIQQQITYCHEKGIPVLVDEAHGAHFQACSLFQPSALSLGAD
                     VVVQSAHKTLPAMTMASFMHVRSELIGADKIHHYLRMLQSSSPSYVLLASLDDARYYV
                     QTYMESDGAYIIEKRNQWIEALRSISSLDVIEVDDPLKLLLRVKGYSGFQLQEALEAK
                     QVYGELADRNQVLFILPLLKQGHTYPFAEIRVRIKEAVTLLLEAAKTDNIKASQTAYK
                     FVQLTEPVYTFDEMASLNKEWLPYMRTIGRISASMIIPYPPGIPLLVPGERITVAKLS
                     QLEELLAAGATFQGNHRLTEKMIQVIK"
     misc_feature    55236..56657
                     /locus_tag="Bsph_0047"
                     /note="Arginine/lysine/ornithine decarboxylases [Amino
                     acid transport and metabolism]; Region: LdcC; COG1982"
                     /db_xref="CDD:224893"
     misc_feature    55251..56063
                     /locus_tag="Bsph_0047"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl00321"
                     /db_xref="CDD:241782"
     misc_feature    order(55491..55496,55503..55505,55722..55724,55809..55811,
                     55818..55820,55893..55895,55902..55904)
                     /locus_tag="Bsph_0047"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    55902..55904
                     /locus_tag="Bsph_0047"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     misc_feature    56319..56600
                     /locus_tag="Bsph_0047"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            56661..57308
                     /locus_tag="Bsph_0048"
                     /db_xref="GeneID:6021802"
     CDS             56661..57308
                     /locus_tag="Bsph_0048"
                     /EC_number="2.7.4.9"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="YP_001695816.1"
                     /db_xref="GI:169825658"
                     /db_xref="GeneID:6021802"
                     /translation="MEAINSMNSNLFITFEGPEGAGKTTVIQKIAERLAEKNIDVLAT
                     REPGGIEIAEKIRTIILNPAHTAMDERTEALLYAAARSQHYFEKVRPALDAGKLVICD
                     RFIDSSLAYQGYARGIGIDEVLSINEFAIGKKLPDMTILFDIAPEVGLARIYATGNRE
                     VNRLDVESLPFHQKVHEGYLLLVERYPERIRMVNADQDIDSVVEEVWSLLLKAIQ"
     misc_feature    56679..57305
                     /locus_tag="Bsph_0048"
                     /note="thymidylate kinase; Validated; Region: tmk;
                     PRK00698"
                     /db_xref="CDD:234814"
     misc_feature    56691..57296
                     /locus_tag="Bsph_0048"
                     /note="Thymidine monophosphate kinase (TMPK), also known
                     as thymidylate kinase, catalyzes the phosphorylation of
                     thymidine monophosphate (TMP) to thymidine diphosphate
                     (TDP) utilizing ATP as its preferred phophoryl donor. TMPK
                     represents the rate-limiting step...; Region: TMPK;
                     cd01672"
                     /db_xref="CDD:238835"
     misc_feature    order(56730..56732,56889..56891,56901..56903,56964..56969,
                     56991..56993,57126..57128)
                     /locus_tag="Bsph_0048"
                     /note="TMP-binding site; other site"
                     /db_xref="CDD:238835"
     misc_feature    order(56733..56735,57114..57116,57243..57245)
                     /locus_tag="Bsph_0048"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238835"
     gene            57678..57800
                     /locus_tag="Bsph_0049"
                     /db_xref="GeneID:6021803"
     CDS             57678..57800
                     /locus_tag="Bsph_0049"
                     /note="Uncharacterized protein conserved in bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="YaaQ"
                     /protein_id="YP_001695817.1"
                     /db_xref="GI:169825659"
                     /db_xref="GeneID:6021803"
                     /translation="MVAPVSPLGGNADSYIPYPVEVEVGGATVFVLPIEQFHHF"
     misc_feature    <57678..57797
                     /locus_tag="Bsph_0049"
                     /note="Protein of unknown function (DUF970); Region:
                     DUF970; cl17525"
                     /db_xref="CDD:248079"
     gene            58145..58372
                     /gene="yaaR"
                     /locus_tag="Bsph_0050"
                     /db_xref="GeneID:6021804"
     CDS             58145..58372
                     /gene="yaaR"
                     /locus_tag="Bsph_0050"
                     /note="Uncharacterized protein conserved in bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="YaaR"
                     /protein_id="YP_001695818.1"
                     /db_xref="GI:169825660"
                     /db_xref="GeneID:6021804"
                     /translation="MLVKRFLQETVEHGMELKQSHTWNRFGEGRRLKIIDTIDTRLVE
                     LAQDILDEEKEAIDLLDKIGEIKGLLINLYM"
     misc_feature    <58148..58369
                     /gene="yaaR"
                     /locus_tag="Bsph_0050"
                     /note="Protein of unknown function (DUF327); Region:
                     DUF327; pfam03885"
                     /db_xref="CDD:217779"
     gene            58669..59673
                     /locus_tag="Bsph_0051"
                     /db_xref="GeneID:6021885"
     CDS             58669..59673
                     /locus_tag="Bsph_0051"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="YP_001695819.1"
                     /db_xref="GI:169825661"
                     /db_xref="GeneID:6021885"
                     /translation="MAKNVEELFVLQPVVMKQLQTIFDKNRLAHAYIFDGEKGTGKAD
                     IMHFFVKLMLCEHPNENVPCETCRNCRRVDSGNHPNIHQIYPEGQFIKIDQMRELIGE
                     MKMMGVEEGRKIYVLHHADRLNTASANMILKFLEEPDGEVTAILITEQMQSILPTIRS
                     RCQHIKFQKMPRHVLLQHLQGNNISHSMASTVSMMTNELEMAISLASDEQFALARKTV
                     LKLVEAIRQNVHEAMLIVHEEWLPHFKEKSEMEQALDLLLFAYRDIVSIKANPEAACT
                     YPDMLPLFKEIALYSTYEQLSKQMESILQARASLQRNMNRTLLMEQLMLNLQEGYTFV
                     "
     misc_feature    58684..59613
                     /locus_tag="Bsph_0051"
                     /note="DNA polymerase III subunit delta'; Validated;
                     Region: PRK08058"
                     /db_xref="CDD:181214"
     misc_feature    58942..>59175
                     /locus_tag="Bsph_0051"
                     /note="DNA polymerase III subunit delta'; Validated;
                     Region: PRK08485"
                     /db_xref="CDD:236274"
     gene            59666..60481
                     /gene="yaaT"
                     /locus_tag="Bsph_0052"
                     /db_xref="GeneID:6021886"
     CDS             59666..60481
                     /gene="yaaT"
                     /locus_tag="Bsph_0052"
                     /note="signal peptidase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stage 0 sporulation protein YaaT"
                     /protein_id="YP_001695820.1"
                     /db_xref="GI:169825662"
                     /db_xref="GeneID:6021886"
                     /translation="MYNVVGVRFKKAGKIYYFDPASFLLEDSQYVIVETARGVEYGKV
                     VVPQKVVGDNDVVLPLKQVLRPADDRDRIQVEENAAESKRAFELASTKIIEHNLEMKL
                     VDVEYTFDRNKIIFYFTAEGRVDFRDLVKDLASVFRTRIELRQIGVRDEAKLLGGIGP
                     CGRMLCCSTFLGDFEPVSIKMAKDQNLSLNPSKISGLCGRLMCCLKYENDEYEEAKEG
                     MPDLGEVAMTPDGRGKVVGLNVLERLVQVYLQEQERTVEYTLEELLACEKNLI"
     misc_feature    59666..60460
                     /gene="yaaT"
                     /locus_tag="Bsph_0052"
                     /note="Uncharacterized homolog of PSP1 [Function unknown];
                     Region: COG1774"
                     /db_xref="CDD:224688"
     gene            60500..60865
                     /gene="yabA"
                     /locus_tag="Bsph_0053"
                     /db_xref="GeneID:6021887"
     CDS             60500..60865
                     /gene="yabA"
                     /locus_tag="Bsph_0053"
                     /note="in Bacillus subtilis this protein is involved in
                     the negative regulation of DNA replication initiation;
                     interacts with DnaN and DnaA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication intiation control protein YabA"
                     /protein_id="YP_001695821.1"
                     /db_xref="GI:169825663"
                     /db_xref="GeneID:6021887"
                     /translation="MAWVKDRNFLDTVMEFEQQLEAMQEQFGALKQFVALMMEEHKAL
                     ETENHHLRTRLEELLSNTHSVQAAEVKKESPLDIGEGYDNLARLYQEGFHVCHVHFGS
                     SRKGEDCLFCLSFLNKQNV"
     misc_feature    60509..60856
                     /gene="yabA"
                     /locus_tag="Bsph_0053"
                     /note="DNA replication intiation control protein YabA;
                     Reviewed; Region: PRK13169"
                     /db_xref="CDD:183876"
     gene            60929..61678
                     /locus_tag="Bsph_0054"
                     /db_xref="GeneID:6021888"
     CDS             60929..61678
                     /locus_tag="Bsph_0054"
                     /note="methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695822.1"
                     /db_xref="GI:169825664"
                     /db_xref="GeneID:6021888"
                     /translation="MEKWLKDDERLDYLLAENLRIIQSPSVFSFSLDAVLLSKFVNIP
                     YHKGNIVDLCSGNGVIPLFLSVRTKGQITGVELQPRLLDMAERSIRYNQLENQIQMIL
                     GDVKEIPKQLGIEKYDVVTCNPPYFLAHEASDKNLSEHHAIARHELYLTLEEAIQSAS
                     KLLKQGGKAAFVHRPGRLLDIVTAMRANRLEPKRMQLIYPKEGKEANTLLIEGIKDGK
                     PDLKILPPLYVYKNNNEYTAEVREILYGKEQ"
     misc_feature    60941..61669
                     /locus_tag="Bsph_0054"
                     /note="Predicted O-methyltransferase [General function
                     prediction only]; Region: COG4123"
                     /db_xref="CDD:226608"
     misc_feature    61073..61444
                     /locus_tag="Bsph_0054"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(61085..61105,61154..61159,61235..61243,61295..61297)
                     /locus_tag="Bsph_0054"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            61716..61925
                     /locus_tag="Bsph_0055"
                     /db_xref="GeneID:6021889"
     CDS             61716..61925
                     /locus_tag="Bsph_0055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695823.1"
                     /db_xref="GI:169825665"
                     /db_xref="GeneID:6021889"
                     /translation="MYAGYTNNVEKRVAVHNAGKGAKYTRARGPVKCIYKEEYETKEE
                     AMRAEYAFKQLTRTQKIMYIRRGES"
     misc_feature    61719..61883
                     /locus_tag="Bsph_0055"
                     /note="The GIY-YIG domain of uncharacterized protein
                     family UPF0213 related to structure-specific endonuclease
                     SLX1; Region: GIY-YIG_UPF0213; cd10456"
                     /db_xref="CDD:198403"
     misc_feature    order(61719..61721,61725..61727,61749..61751,61761..61763,
                     61860..61862)
                     /locus_tag="Bsph_0055"
                     /note="putative active site [active]"
                     /db_xref="CDD:198403"
     misc_feature    61719..61727
                     /locus_tag="Bsph_0055"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198403"
     misc_feature    61860..61862
                     /locus_tag="Bsph_0055"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:198403"
     gene            61922..62797
                     /gene="yabC"
                     /locus_tag="Bsph_0056"
                     /db_xref="GeneID:6022765"
     CDS             61922..62797
                     /gene="yabC"
                     /locus_tag="Bsph_0056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695824.1"
                     /db_xref="GI:169825666"
                     /db_xref="GeneID:6022765"
                     /translation="MKSQKSTIHDQTGCLYLVGTPIGNLEDISVRALRILKEVDIIAA
                     EDTRNTRKLCNYFEIETPLMSYHEHNLAVGGEKLLTFLQEGKTIALVSDAGLPCISDP
                     GADIVEKAIAQNFPVVPIPGPNAAITALIASGLTPQPFFFYGFLNRGKKERRQQLELL
                     KKRQETILLYEAPHRIKETLKDMEAILGNRRIVLARELTKKFEEFLRGTLAEAVEWSQ
                     AEEIRGEFCIVIEGNQQVEEEDSEEAYWHTLSIIEHVDYIIEQTDVSSKEAIKEVAKQ
                     RQLAKRDVYNEYHKQ"
     misc_feature    61946..62794
                     /gene="yabC"
                     /locus_tag="Bsph_0056"
                     /note="Predicted methyltransferases [General function
                     prediction only]; Region: COG0313"
                     /db_xref="CDD:223390"
     misc_feature    61964..62617
                     /gene="yabC"
                     /locus_tag="Bsph_0056"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(61985..61987,62201..62209,62216..62221,62291..62296,
                     62429..62431,62504..62506,62510..62515,62594..62602)
                     /gene="yabC"
                     /locus_tag="Bsph_0056"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(62003..62014,62018..62020,62207..62224,62231..62236,
                     62240..62245,62276..62278,62282..62293,62297..62302,
                     62309..62314,62339..62353)
                     /gene="yabC"
                     /locus_tag="Bsph_0056"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            complement(62984..63262)
                     /gene="abrB"
                     /locus_tag="Bsph_0057"
                     /db_xref="GeneID:6022766"
     CDS             complement(62984..63262)
                     /gene="abrB"
                     /locus_tag="Bsph_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="transition state regulatory protein"
                     /protein_id="YP_001695825.1"
                     /db_xref="GI:169825667"
                     /db_xref="GeneID:6022766"
                     /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALKIYVDDDKII
                     LKKYMPNMTCAVTGEVSDDNFRLVGGKLILSPEGAEMLVKEIQSNLKK"
     misc_feature    complement(62990..63262)
                     /gene="abrB"
                     /locus_tag="Bsph_0057"
                     /note="Regulators of stationary/sporulation gene
                     expression [Transcription]; Region: AbrB; COG2002"
                     /db_xref="CDD:224913"
     misc_feature    complement(63122..63241)
                     /gene="abrB"
                     /locus_tag="Bsph_0057"
                     /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
                     smart00966"
                     /db_xref="CDD:198034"
     gene            63597..65588
                     /locus_tag="Bsph_0058"
                     /db_xref="GeneID:6022767"
     CDS             63597..65588
                     /locus_tag="Bsph_0058"
                     /EC_number="6.1.1.10"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA synthetase"
                     /protein_id="YP_001695826.1"
                     /db_xref="GI:169825668"
                     /db_xref="GeneID:6022767"
                     /translation="MEAVLVSEQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYK
                     RLRGYDVRFLTGMDEHGQKIQEKAAEAGKHPQDYVNEIAESAKKLWALMDITYDDFIQ
                     TTQERHTKAVEKIFQKFLDNGDIYKGEYEGWYCTPCESFFTETQLVDGNCPDCGRPVH
                     KVKEESYFFNMKKYADRLLAYYEENLEFIEPESRKNEMINNFIKPGLEDLSVSRTSFD
                     WGIKVPGDAKHVIYVWVDALTNYITSLGYLSDDETLFNKYWPADVHVVGKDIVRFHTI
                     YWPIFLMALDLPLPKKVFAHGFIMMKDGKMSKSKGNVIYPEMLIERYGLDATRYFLLR
                     ELPFGSDGVFSPESFIERTNFDLANDLGNLLNRTISMINKYFDGIIPSENLQSTEFDA
                     ALKEQAESVRIKYEESMEKMQFSVVLADLWTLVSRTNKYIDETQPWVLAKEEADKPKL
                     GTVMRNLAESLHQIAVMLQPFMTTTPKRMMEQLGLDDKFLAWDTIETFGNTIPANIKV
                     VEKGIPIFPRLESEVEIAYIREEMRGSVKTSQEEEVNSGTKSDENPEIPEITIDDFMK
                     IDLRVATVTACETVPKADKLLKLQVDLGYEQRQVVSGIAKFYSPDELIGQKVIVVANL
                     KPVKLRGELSQGMILAGEKDGILKLASVDSKLENGAKVK"
     misc_feature    63624..65585
                     /locus_tag="Bsph_0058"
                     /note="methionyl-tRNA synthetase; Reviewed; Region:
                     PRK12267"
                     /db_xref="CDD:237028"
     misc_feature    63630..64628
                     /locus_tag="Bsph_0058"
                     /note="catalytic core domain of methioninyl-tRNA
                     synthetases; Region: MetRS_core; cd00814"
                     /db_xref="CDD:173907"
     misc_feature    order(63648..63653,63657..63659,63768..63770,64296..64298,
                     64305..64310,64317..64319,64404..64406,64416..64418)
                     /locus_tag="Bsph_0058"
                     /note="active site"
                     /db_xref="CDD:173907"
     misc_feature    63675..63686
                     /locus_tag="Bsph_0058"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    64509..64523
                     /locus_tag="Bsph_0058"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    64656..65045
                     /locus_tag="Bsph_0058"
                     /note="Anticodon-binding domain of methionyl tRNA
                     synthetases; Region: Anticodon_Ia_Met; cd07957"
                     /db_xref="CDD:153411"
     misc_feature    order(64656..64658,64677..64682,64689..64694,64701..64706,
                     64713..64718,64725..64730,64881..64886,64890..64895,
                     64908..64910)
                     /locus_tag="Bsph_0058"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153411"
     misc_feature    order(64677..64679,64689..64694,64701..64706,64713..64718,
                     64725..64730,64890..64892,64908..64910)
                     /locus_tag="Bsph_0058"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153411"
     misc_feature    65271..65585
                     /locus_tag="Bsph_0058"
                     /note="tRNA-binding-domain-containing Escherichia coli
                     methionyl-tRNA synthetase (EcMetRS)-like proteins.  This
                     family includes EcMetRS and Aquifex aeolicus Trbp111
                     (AaTrbp111). This domain has general tRNA binding
                     properties.  MetRS aminoacylates methionine...; Region:
                     tRNA_bind_EcMetRS_like; cd02800"
                     /db_xref="CDD:239199"
     misc_feature    order(65274..65276,65415..65417,65463..65471,65478..65480,
                     65514..65525,65541..65543,65547..65549,65553..65555,
                     65562..65564,65574..65585)
                     /locus_tag="Bsph_0058"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239199"
     misc_feature    order(65349..65351,65385..65387,65463..65465,65475..65477,
                     65496..65498,65505..65507)
                     /locus_tag="Bsph_0058"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239199"
     gene            65842..66612
                     /locus_tag="Bsph_0059"
                     /db_xref="GeneID:6022768"
     CDS             65842..66612
                     /locus_tag="Bsph_0059"
                     /EC_number="3.1.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease yabD"
                     /protein_id="YP_001695827.1"
                     /db_xref="GI:169825669"
                     /db_xref="GeneID:6022768"
                     /translation="MFIDTHVHLNADQYEEDLQEVINRALEAKVEKMVVIGFDRKTIE
                     RTMELIEQFDFIYGVIGWHPVDAIDCTQEDLEWIEELAAHPKIVGIGETGLDYYWDKS
                     PKDVQQVIFRKQIQLAQKINLPIIIHNRDATGDVVKILREENAASVGGVMHCFSGSVE
                     TARECIAMNFMISLGGPVTFINARLPKEVATEIPLEHLMIETDAPYLAPHPYRGKRNE
                     PAFVPLVAEEIARLKGLTIEEIAQATTDNAKIFFGIDS"
     misc_feature    65842..66606
                     /locus_tag="Bsph_0059"
                     /note="Predicted metal-dependent hydrolases with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1099"
                     /db_xref="CDD:224024"
     misc_feature    65845..66600
                     /locus_tag="Bsph_0059"
                     /note="TatD like proteins;  E.coli TatD is a cytoplasmic
                     protein, shown to have magnesium dependent DNase activity;
                     Region: TatD_DNAse; cd01310"
                     /db_xref="CDD:238635"
     misc_feature    order(65857..65859,65863..65865,66223..66225,66298..66300,
                     66448..66450)
                     /locus_tag="Bsph_0059"
                     /note="active site"
                     /db_xref="CDD:238635"
     gene            66853..67959
                     /locus_tag="Bsph_0060"
                     /db_xref="GeneID:6022769"
     CDS             66853..67959
                     /locus_tag="Bsph_0060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695828.1"
                     /db_xref="GI:169825670"
                     /db_xref="GeneID:6022769"
                     /translation="MLYQGTKKAVKLEANGETIEVSTHAKTVEQLLQDQNIDVAEHDK
                     ISPSLNTKIVNGLAIQWEQAKEVTISVDGNQSKVWTTETLVKDILKEANIEVSKHDTL
                     AQGLDTELGAENKIDIQRAFQLTLVDGVNKRQVWSTSTTVANFLKQQGIQLNEFDRVE
                     NNLEDVITPASKITVVRVEKVIDVVEDSLDFAVEKKRDASLQKGKEKVVATGEKGSVS
                     RTYEVVKENGKVVAKNLQSEAVLKEPKKQVVAVGTKTVVASAATVSRGSAEPASGKEF
                     YVTATAYTPYCNGCSGTSATGINLRSNSNLKVVAVDPSVIKLGSKVWVEGYGTAIAGD
                     TGGAIKGNKIDILVQTDAQARNWGRKKVRIKVLN"
     misc_feature    66880..67005
                     /locus_tag="Bsph_0060"
                     /note="Domain of unknown function (DUF348); Region:
                     DUF348; pfam03990"
                     /db_xref="CDD:202844"
     misc_feature    67048..67176
                     /locus_tag="Bsph_0060"
                     /note="Domain of unknown function (DUF348); Region:
                     DUF348; pfam03990"
                     /db_xref="CDD:202844"
     misc_feature    67219..67344
                     /locus_tag="Bsph_0060"
                     /note="Domain of unknown function (DUF348); Region:
                     DUF348; pfam03990"
                     /db_xref="CDD:202844"
     misc_feature    67417..67617
                     /locus_tag="Bsph_0060"
                     /note="G5 domain; Region: G5; pfam07501"
                     /db_xref="CDD:219434"
     misc_feature    67651..67950
                     /locus_tag="Bsph_0060"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3584"
                     /db_xref="CDD:226112"
     gene            68154..68720
                     /locus_tag="Bsph_0061"
                     /db_xref="GeneID:6022331"
     CDS             68154..68720
                     /locus_tag="Bsph_0061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695829.1"
                     /db_xref="GI:169825671"
                     /db_xref="GeneID:6022331"
                     /translation="MQIKEIIVVEGKDDTTAIKRAVQADTIETNGSAISEETLKRIQH
                     AQEKRGVIVFTDPDYPGRRIRAIIEERVKGVKHAFLPKAKTIAKNGKGLGIEHAADDD
                     IREALRLVYTPHLEEPNEDDITLEDLMTARLIGHPQSKHRRDRLGELLNIGATNGKQL
                     HKRLKMFQITEKQFGAAVAQLDQEENDA"
     misc_feature    68157..68690
                     /locus_tag="Bsph_0061"
                     /note="ribonuclease M5; Region: 5S_RNA_mat_M5; TIGR00334"
                     /db_xref="CDD:232924"
     misc_feature    68160..68393
                     /locus_tag="Bsph_0061"
                     /note="TOPRIM_ RNase M5_like: The topoisomerase-primase
                     (TOPRIM) nucleotidyl transferase/hydrolase domain found in
                     Ribonuclease M5: (RNase M5) and other small primase-like
                     proteins from bacteria and archaea.  RNase M5 catalyzes
                     the maturation of 5S rRNA in low...; Region:
                     TOPRIM_RNase_M5_like; cd01027"
                     /db_xref="CDD:173777"
     misc_feature    order(68181..68186,68193..68195,68319..68321,68325..68327,
                     68331..68333)
                     /locus_tag="Bsph_0061"
                     /note="putative active site [active]"
                     /db_xref="CDD:173777"
     misc_feature    order(68181..68183,68319..68321)
                     /locus_tag="Bsph_0061"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173777"
     misc_feature    68427..68690
                     /locus_tag="Bsph_0061"
                     /note="Domain of unknown function (DUF4093); Region:
                     DUF4093; pfam13331"
                     /db_xref="CDD:205511"
     gene            68713..69594
                     /gene="ksgA"
                     /locus_tag="Bsph_0062"
                     /db_xref="GeneID:6022332"
     CDS             68713..69594
                     /gene="ksgA"
                     /locus_tag="Bsph_0062"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="YP_001695830.1"
                     /db_xref="GI:169825672"
                     /db_xref="GeneID:6022332"
                     /translation="MHKDIATPIRTQEILKKYGFSFKKSLGQNFLIDPNILRNIVSHA
                     KLTENSGAIEVGPGIGALTEHLARSAKKVVSFEIDQRLLPVLEDTLSPYNNVSIVHSD
                     ILKADVAKVIAEEMPGIEDIMVVANLPYYVTTPILMKLLNDRLPIRGFVVMMQKEVAD
                     RITAKPGTKEYGSLSIAIQYYVKADIAMTVPKTVFMPQPNVDSAVIRLIKHDEPPVKV
                     INEDFLFVVTRASFVQRRKTIYNNLQAGLPNGKTQKDFILEALAAANIEPTRRGETLT
                     IQEFGKLADALYPVFAK"
     misc_feature    68731..69579
                     /gene="ksgA"
                     /locus_tag="Bsph_0062"
                     /note="16S ribosomal RNA methyltransferase KsgA/Dim1
                     family protein; Reviewed; Region: ksgA; PRK00274"
                     /db_xref="CDD:234708"
     misc_feature    68869..>69033
                     /gene="ksgA"
                     /locus_tag="Bsph_0062"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(68875..68895,68941..68946,69013..69021)
                     /gene="ksgA"
                     /locus_tag="Bsph_0062"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            69751..70011
                     /locus_tag="Bsph_0063"
                     /db_xref="GeneID:6022333"
     CDS             69751..70011
                     /locus_tag="Bsph_0063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695831.1"
                     /db_xref="GI:169825673"
                     /db_xref="GeneID:6022333"
                     /translation="MPKTLADIKKSLDCHLGKRLQLKANGGRKKTVECAGILRETYRA
                     IFVVELDQEDNTCKRVSYSYTDILTEAVEITFLDEAKAAVAK"
     misc_feature    69751..69978
                     /locus_tag="Bsph_0063"
                     /note="Protein of unknown function (DUF1021); Region:
                     DUF1021; pfam06257"
                     /db_xref="CDD:218961"
     gene            70145..70306
                     /gene="sspF"
                     /locus_tag="Bsph_0064"
                     /db_xref="GeneID:6022334"
     CDS             70145..70306
                     /gene="sspF"
                     /locus_tag="Bsph_0064"
                     /codon_start=1
                     /transl_table=11
                     /product="small acid-soluble spore protein"
                     /protein_id="YP_001695832.1"
                     /db_xref="GI:169825674"
                     /db_xref="GeneID:6022334"
                     /translation="MSPRLKEEIAKELGFYDVVQKEGWGGIKARDAGNMVKRAIEMAE
                     RASNEQERK"
     misc_feature    <70154..70279
                     /gene="sspF"
                     /locus_tag="Bsph_0064"
                     /note="Small, acid-soluble spore proteins, alpha/beta
                     type; Region: SASP; pfam00269"
                     /db_xref="CDD:215831"
     gene            70466..71392
                     /gene="ipk"
                     /locus_tag="Bsph_0065"
                     /db_xref="GeneID:6022335"
     CDS             70466..71392
                     /gene="ipk"
                     /locus_tag="Bsph_0065"
                     /EC_number="2.7.1.148"
                     /note="An essential enzyme in the nonmevalonate pathway of
                     isopentenyl diphosphate and dimethylallyl diphosphate
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="YP_001695833.1"
                     /db_xref="GI:169825675"
                     /db_xref="GeneID:6022335"
                     /translation="MNKLVRKGIVYMCSYKGGRKMLYVKAPAKINLTLDVLYKRPDNF
                     HEVEMVMTTVDLADRISLESREDGVIQIISTDNFVPNDHRNFAYQAARLIKDTYGIKQ
                     GVSITIEKEIPIAAGLAGGSSDAAATLKGLNELWNLGLSIDELAELGAKIGSDVSFCV
                     YGGTALATGRGEKIKEIPAPPNCWVVLAKPKIGVSTAEVYGGLKVEGLEHPNTKQMIQ
                     AIETKDYELLCSSLGNVLETVTFKLHPEVIMLKEQMKRFGADATLMSGSGPTVFGLVD
                     SEARVSRIYNGLRGFCEEVYAVRILGERNTLA"
     misc_feature    70523..71380
                     /gene="ipk"
                     /locus_tag="Bsph_0065"
                     /note="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;
                     Provisional; Region: ipk; PRK00128"
                     /db_xref="CDD:234652"
     misc_feature    70778..70954
                     /gene="ipk"
                     /locus_tag="Bsph_0065"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:215839"
     misc_feature    71111..71347
                     /gene="ipk"
                     /locus_tag="Bsph_0065"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:219894"
     gene            71449..72282
                     /locus_tag="Bsph_0066"
                     /db_xref="GeneID:6024055"
     CDS             71449..72282
                     /locus_tag="Bsph_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="pur operon repressor"
                     /protein_id="YP_001695834.1"
                     /db_xref="GI:169825676"
                     /db_xref="GeneID:6024055"
                     /translation="MKWKRSERLVDMTYYLLEHPHQLIPLTYFSELYQSAKSSISEDL
                     TIVKETFEEKGIGLLMTVPGAAGGVKYIPKMSEAEVRSVIQDLKAELEHSDRLLPGGY
                     LFMTDLLGNPDLINRVGKVFASAFADQQIDVIMTVATKGISIAHAIARHLNVPVVVVR
                     RDSKVTEGSTVSINYVSGSSRRIQTMVLSKRSMKSGQRVLITDDFMKVGGTMNGMKNL
                     LEEFDCQLAGIAVLVEAEHADETLVDDYYSLVKLHEVNEKDRTIALSEGNYFSKRGHD
                     K"
     misc_feature    71449..72261
                     /locus_tag="Bsph_0066"
                     /note="pur operon repressor; Provisional; Region:
                     PRK09213"
                     /db_xref="CDD:236414"
     misc_feature    71458..71667
                     /locus_tag="Bsph_0066"
                     /note="Bacterial purine repressor, N-terminal; Region:
                     PuR_N; pfam09182"
                     /db_xref="CDD:150015"
     misc_feature    71800..72168
                     /locus_tag="Bsph_0066"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(71860..71862,71866..71868,72055..72063,72067..72081,
                     72151..72153)
                     /locus_tag="Bsph_0066"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            72279..72653
                     /gene="yabJ"
                     /locus_tag="Bsph_0067"
                     /db_xref="GeneID:6024056"
     CDS             72279..72653
                     /gene="yabJ"
                     /locus_tag="Bsph_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695835.1"
                     /db_xref="GI:169825677"
                     /db_xref="GeneID:6024056"
                     /translation="MKVVATSNAPAAIGPYSQGISVNGIFYSSGQIPLTATGELVEGD
                     ITVQTNQVFANVKAVLEAAGTSLENVVKTTVFMKDMNDFVAMNEVYASHFGEHKPARS
                     AVEVARLPKDVKVEIEVIAIVK"
     misc_feature    72324..72614
                     /gene="yabJ"
                     /locus_tag="Bsph_0067"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    order(72324..72329,72336..72338,72342..72344,72351..72353,
                     72357..72359,72363..72368,72483..72485,72489..72494,
                     72498..72500,72504..72506,72537..72539,72546..72548,
                     72573..72596)
                     /gene="yabJ"
                     /locus_tag="Bsph_0067"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    order(72324..72326,72525..72527,72537..72539,72579..72581)
                     /gene="yabJ"
                     /locus_tag="Bsph_0067"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            72926..73180
                     /gene="spoVG"
                     /locus_tag="Bsph_0068"
                     /db_xref="GeneID:6024057"
     CDS             72926..73180
                     /gene="spoVG"
                     /locus_tag="Bsph_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="septation protein spoVG"
                     /protein_id="YP_001695836.1"
                     /db_xref="GI:169825678"
                     /db_xref="GeneID:6024057"
                     /translation="MRAIASITLDNEFVVHDIRVIDGNTGLFVAMPSKRTPDGEFRDI
                     AHPINSDTRNKIQEIILNAYHNSSELEETDKEEELESMGV"
     misc_feature    72926..73120
                     /gene="spoVG"
                     /locus_tag="Bsph_0068"
                     /note="SpoVG; Region: SpoVG; cl00915"
                     /db_xref="CDD:242190"
     gene            73284..73400
                     /locus_tag="Bsph_0069"
                     /db_xref="GeneID:6024058"
     CDS             73284..73400
                     /locus_tag="Bsph_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695837.1"
                     /db_xref="GI:169825679"
                     /db_xref="GeneID:6024058"
                     /translation="MIKRENQQFYDILHDIRAEGAVDFGIHLFVNSTCLENR"
     gene            73427..74821
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /db_xref="GeneID:6024059"
     CDS             73427..74821
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /EC_number="2.3.1.157"
                     /EC_number="2.7.7.23"
                     /note="Includes: UDP-N-acetylglucosamine pyrophosphorylase
                     (N-acetylglucosamine-1-phosphate uridyltransferase);
                     Glucosamine-1-phosphate N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase / glucosamine-1-phosphate
                     N-acetyltransferase"
                     /protein_id="YP_001695838.1"
                     /db_xref="GI:169825680"
                     /db_xref="GeneID:6024059"
                     /translation="MSVLEDLQMSNIFAVILAAGQGTRMKSKLYKVLHPVCGKPMVQH
                     VVDHIQTLDVNRIVTVVGHGAEKVQQQLGDKSEYVLQAEQLGTAHAVQQAEGILGNEE
                     GTTLVVCGDTPLIRPETMQALFEHHQAKKAKATILTAIAENPTGYGRILRSENGQVEQ
                     IVEQKDASAAQQLVKEINTGTYCFDNKLLFETLKLVKNDNAQGEYYLPDVIEILQKQG
                     DIVEAYVTDDFEETLGVNDRVALSQAETLMRARINEKHMRNGVTIIHPETTYISAEAV
                     IGSDTVIQPGCMIEGATVIGEDCNIGPNTQIADSRIGDRTTVHSSVVRESAIAEDTAI
                     GPFAHIRPLSDIGSHVKIGNFVEVKKSKLGNDTKVSHLSYIGDAEIGSNVNVGCGSIT
                     VNYDGKNKFKTIIEDDVFVGCNTNLVAPVKVGKGSFIAAGSTITKEVPEDALAIARAR
                     QENKPNYVSKLNSK"
     misc_feature    73463..74818
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase; Provisional; Region: glmU; PRK14354"
                     /db_xref="CDD:184643"
     misc_feature    73466..74149
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    order(73475..73483,73604..73606,73685..73687,73694..73696,
                     73751..73753,73757..73759)
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    order(73757..73759,74132..74134)
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    74204..74779
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="N-acetyl-glucosamine-1-phosphate uridyltransferase
                     (GlmU), C-terminal left-handed beta-helix (LbH)
                     acetyltransferase domain: GlmU is also known as
                     UDP-N-acetylglucosamine pyrophosphorylase. It is a
                     bifunctional bacterial enzyme that catalyzes two...;
                     Region: LbH_GlmU_C; cd03353"
                     /db_xref="CDD:100044"
     misc_feature    order(74447..74449,74495..74497,74501..74503,74537..74539,
                     74546..74548,74579..74590,74603..74611,74624..74626,
                     74654..74656,74660..74665,74714..74719,74768..74770)
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="active site"
                     /db_xref="CDD:100044"
     misc_feature    order(74447..74449,74495..74497,74501..74503,74537..74539,
                     74546..74548,74579..74587,74606..74608,74624..74626)
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100044"
     misc_feature    order(74588..74590,74603..74605,74609..74611,74660..74665,
                     74714..74719,74768..74770)
                     /gene="glmU"
                     /locus_tag="Bsph_0070"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100044"
     gene            74846..75805
                     /locus_tag="Bsph_0071"
                     /db_xref="GeneID:6024280"
     CDS             74846..75805
                     /locus_tag="Bsph_0071"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="YP_001695839.1"
                     /db_xref="GI:169825681"
                     /db_xref="GeneID:6024280"
                     /translation="MPYHYANSQLKIFSLNSNNPLAQEIAQEMGVELGKSSVKHFSDG
                     EVQISIEESIRGCDVFIVQSTSAPVNEHLMELLIMVDAVKRASARTVNVVMPYYGYAR
                     QDRKAKAREPITAKLVANLLETAGATRVIVLDLHAPQIQGFFDILIDHLMAVPLLSDY
                     FKSKGIPEDEIVIVSPDHGGVTRARKMAERLKAPIAIIDKRRPKPNVAEVMNIVGNVD
                     GKVAILIDDIIDTAGTITIGADALRAAGAKEVYACCSHPVLSGPAIERIENSSIKELV
                     VTNTIQLAEDKKSPKITELSVAKLMADAISRVYENKSVSTLFD"
     misc_feature    74873..75802
                     /locus_tag="Bsph_0071"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK01259"
                     /db_xref="CDD:234929"
     misc_feature    74873..75223
                     /locus_tag="Bsph_0071"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:222383"
     misc_feature    75302..75685
                     /locus_tag="Bsph_0071"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(75374..75376,75380..75382,75521..75529,75533..75547,
                     75617..75619)
                     /locus_tag="Bsph_0071"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            76069..76665
                     /locus_tag="Bsph_0072"
                     /db_xref="GeneID:6024281"
     CDS             76069..76665
                     /locus_tag="Bsph_0072"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="YP_001695840.1"
                     /db_xref="GI:169825682"
                     /db_xref="GeneID:6024281"
                     /translation="MSTVLSVTKRETGHRSTLTQLRKGGAIPAVIYGYKLDSTPISIS
                     AKEFKKSIQKNGQNSVFSLDLEGKKVNVVVSEVQQCSLKDEVNHVDFLAINMAEELEV
                     DVPIKLIGQSVGVSEGGILMQPNLELKVKVKPAELPDSIEVDISSLKVGESLTVAEIR
                     HQTPVEIISEDDYLLVTIVAPVSAEQEEVSASVEEEQV"
     misc_feature    76069..76602
                     /locus_tag="Bsph_0072"
                     /note="50S ribosomal protein L25/general stress protein
                     Ctc; Reviewed; Region: PRK05618"
                     /db_xref="CDD:235534"
     misc_feature    76078..76347
                     /locus_tag="Bsph_0072"
                     /note="Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding
                     domain; Region: Ribosomal_L25_TL5_CTC; cd00495"
                     /db_xref="CDD:198379"
     misc_feature    order(76096..76098,76120..76128,76132..76134,76162..76170,
                     76180..76182,76291..76296,76300..76302,76330..76332,
                     76336..76338,76342..76344)
                     /locus_tag="Bsph_0072"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:198379"
     misc_feature    order(76168..76170,76243..76245,76279..76281,76291..76293,
                     76342..76347)
                     /locus_tag="Bsph_0072"
                     /note="CTC domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198379"
     misc_feature    order(76285..76290,76297..76299,76318..76320,76342..76344)
                     /locus_tag="Bsph_0072"
                     /note="L16 interface [polypeptide binding]; other site"
                     /db_xref="CDD:198379"
     gene            76767..77378
                     /locus_tag="Bsph_0073"
                     /db_xref="GeneID:6024282"
     CDS             76767..77378
                     /locus_tag="Bsph_0073"
                     /EC_number="3.1.1.29"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="YP_001695841.1"
                     /db_xref="GI:169825683"
                     /db_xref="GeneID:6024282"
                     /translation="MWYGKIMTIRFERREVLMKIIVGLGNPGKPYEHTRHNIGFDVID
                     ALAEKWGTPLTNSKFNGMYTTVHRPEGKVLLVKPLTYMNLSGECVGPLMDYFDIDVED
                     LIVIYDDLDLETGKLRLRQKGSAGGHNGIKSLIQHLGTQEFNRIRVGISRPPAGMKVA
                     DYVLGKFSKEDQVSMNEAIEKSVNAVEVSLSKPFLDVMNHFNK"
     misc_feature    76824..77336
                     /locus_tag="Bsph_0073"
                     /note="Peptidyl-tRNA hydrolase (PTH) is a monomeric
                     protein that cleaves the ester bond linking the nascent
                     peptide and tRNA when peptidyl-tRNA is released
                     prematurely from the ribosome. This ensures the recycling
                     of peptidyl-tRNAs into tRNAs produced through...; Region:
                     PTH; cd00462"
                     /db_xref="CDD:238259"
     misc_feature    order(76842..76844,76872..76874,77007..77012,77088..77090,
                     77148..77150)
                     /locus_tag="Bsph_0073"
                     /note="putative active site [active]"
                     /db_xref="CDD:238259"
     misc_feature    76872..76874
                     /locus_tag="Bsph_0073"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238259"
     gene            77582..77809
                     /locus_tag="Bsph_0074"
                     /db_xref="GeneID:6024283"
     CDS             77582..77809
                     /locus_tag="Bsph_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695842.1"
                     /db_xref="GI:169825684"
                     /db_xref="GeneID:6024283"
                     /translation="MSVRYRCRHCEVEIGTLPFDADDTIRKLHIFELGEADDYVEKDQ
                     HGHTTVHCICEQCEDSLRQYPDYHALNKWIQ"
     misc_feature    77582..77806
                     /locus_tag="Bsph_0074"
                     /note="Protein of unknown function (DUF2757); Region:
                     DUF2757; pfam10955"
                     /db_xref="CDD:151402"
     gene            77952..81461
                     /locus_tag="Bsph_0075"
                     /db_xref="GeneID:6024284"
     CDS             77952..81461
                     /locus_tag="Bsph_0075"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="YP_001695843.1"
                     /db_xref="GI:169825685"
                     /db_xref="GeneID:6024284"
                     /translation="MEVLRQLVSRDKHITSFLQDIQSGQTASQLITGLTGSARPVMVD
                     ALFEYVKKPIYIVSPNLLQAQRMVDELAGLLGEENVHYYPADEFIAADLSVASPELRA
                     ERIATLDCLARGEKAVYVIPVAGLRKIMQPKEHWLHYFLQTTVGDEIEVDAWLQTLVE
                     MGYVRNSMVTTPGEFALRGGILDIYPPYLASPIRIELFDTEVDSIRTFSADDQRSINK
                     LQKIRILPASEVILTKSERQTLAERLEKALGASLKKVKRQETKELLYQHIQYDIELLQ
                     QGNLPDYVNKYGSLLYDKSAYLGDYFAQDGIVLFDELGRIQEVMDAWEREEEEWFLSL
                     IEEGKMVHDVKPAFTLKEIVAMLSQQKLSFSLFSRTFSGITFNKTTNFSCKPMQQFHG
                     QMALLQSEIERWLLGKFTVLIVARDKERVKRVQQMLEEYDIHAAIGEPTEPGIYIVDG
                     ALSSGFELPLQRMAIVTEDELFKQQAKKKARTQKMTNAERIKSYTEIKPGDYVVHVHH
                     GIGKYIGVETLEVNGTHKDYLHIRYRADDKLYVPVEQIDLIQKYVASEDREPKLHKLG
                     GAEWKKAKAKVSSAVQDIADDLIKLYAKREAEKGHAFTPDNDDQRNFEAMFAYEETED
                     QLRSIVEVKRDMERERPMDRLVCGDVGYGKTEVAIRAAFKAIQDGKQVAFLVPTTILA
                     QQHYETIRERFQDFAINVGLLSRFRSKKEQTATLKGLKEGQVDIVIGTHRILSKDLIF
                     QDLGLLIVDEEQRFGVTHKEKIKQLKTNVDVLTLTATPIPRTLHMSMVGVRDLSVIET
                     PPANRFPVQTYVMEHSGALVREAIEREMARGGQVFYLYNRVEDMARKVEEIQVLVPEA
                     RIGHAHGKMSETELESVILSFLEGDYDVLVTTTIIETGVDIPNVNTLIVHDADRMGLA
                     QLYQLRGRVGRSNRVAYAYFMYQRDKVLTDVAEQRLQAIKEFTELGSGFKIAMRDLSI
                     RGAGNLLGAQQHGFIDSVGFDLYSQMLQEAIAERQTGVKKEEKPEIEILLSVDAYIPD
                     VYIPDGYQKIQMYKRIKAMDQVEEYGEIMEELEDRFGDLPIETERLLRVARMKVWGLG
                     AGVISVKEKQKLITILLSEQGTANVDGSKIIEESMKFERAVGFGMDGMQLKLTIDERK
                     CGKYQPFDILEELMQIIDKAKKL"
     misc_feature    78012..81431
                     /locus_tag="Bsph_0075"
                     /note="Transcription-repair coupling factor (superfamily
                     II helicase) [DNA replication, recombination, and repair /
                     Transcription]; Region: Mfd; COG1197"
                     /db_xref="CDD:224118"
     misc_feature    79437..79730
                     /locus_tag="Bsph_0075"
                     /note="CarD-like/TRCF domain; Region: CarD_TRCF;
                     smart01058"
                     /db_xref="CDD:215001"
     misc_feature    79875..80285
                     /locus_tag="Bsph_0075"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    79902..79916
                     /locus_tag="Bsph_0075"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    80196..80207
                     /locus_tag="Bsph_0075"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    80364..80756
                     /locus_tag="Bsph_0075"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(80460..80471,80535..80540,80613..80621)
                     /locus_tag="Bsph_0075"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(80637..80639,80703..80705,80715..80717,80724..80726)
                     /locus_tag="Bsph_0075"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    81015..81308
                     /locus_tag="Bsph_0075"
                     /note="TRCF domain; Region: TRCF; pfam03461"
                     /db_xref="CDD:202647"
     gene            81709..82245
                     /locus_tag="Bsph_0076"
                     /db_xref="GeneID:6024349"
     CDS             81709..82245
                     /locus_tag="Bsph_0076"
                     /codon_start=1
                     /transl_table=11
                     /product="stage V sporulation protein T"
                     /protein_id="YP_001695844.1"
                     /db_xref="GI:169825686"
                     /db_xref="GeneID:6024349"
                     /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIYTDREGEV
                     ILKKYSPINDLGEFAREYVETLYETLGTPAFVTDRDEVIAVAGIGKKEYINRRITSFA
                     EGFMEERSTKIEKMETSIEIVPGQYEQVKSYCATPIMVNGDPIGCIIVLSKVHFVGEV
                     EVKVVETAANFLAKQMNS"
     misc_feature    81712..82236
                     /locus_tag="Bsph_0076"
                     /note="stage V sporulation protein T; Region: spore_V_T;
                     TIGR02851"
                     /db_xref="CDD:131898"
     misc_feature    81730..81858
                     /locus_tag="Bsph_0076"
                     /note="looped-hinge helix DNA binding domain, AbrB family;
                     Region: lp_hng_hel_AbrB; TIGR01439"
                     /db_xref="CDD:200102"
     gene            82405..84027
                     /locus_tag="Bsph_0077"
                     /db_xref="GeneID:6024350"
     CDS             82405..84027
                     /locus_tag="Bsph_0077"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-spanning protein"
                     /protein_id="YP_001695845.1"
                     /db_xref="GI:169825687"
                     /db_xref="GeneID:6024350"
                     /translation="MSQRFGMKSYMKGAALLTIAALIVKVLSAIYRVPFQNLVGDEGF
                     YIYQQVYPVISIFVVWTSSGFAIAISKMLADNDCIVDTIERNEKRSMIMRVVFRYLTV
                     LSLLFFAVLFGGADKIAQLMGDTQLAPLIRTGSLVVLVMPALAILKGGFQSRGIMEPI
                     AYAQVVEQAIRVTVILTGTFVIMTTTKSLYAAGKMAVIGTVVGEIIAFVLLAYIFSKR
                     FGLFRVHLRLHKAKSLPIMKEVTWLSLSVSMSGLLLLGYQLVDSFTIYSLLIDHGMDS
                     TVAKETKGIYDRGQPLVQLGVVIASSLSLAIVPLVAHLSKKQEGRSAIPFIQLTYKAS
                     ILFGWAASLGLMLVMPYLNEMLFKTNALSEVLIVYVFQIVPLSIILTFTAILQGYGKL
                     KKPALFLMIGFVLKIILNVRLIGWLGVLGAAIANDIGLLVTAFLLIVYLKTITGIQLA
                     SKEFYKKVGLASISMAVVVLVWLQLVSAFLGHLLSPRSVAVIAGFTAVGLGAFVMLTM
                     IAKKRVLVEKEWYLLPFGRRMAVYQLWLNSKK"
     misc_feature    82432..83787
                     /locus_tag="Bsph_0077"
                     /note="stage V sporulation protein B; Region: spore_V_B;
                     TIGR02900"
                     /db_xref="CDD:234052"
     misc_feature    82447..83745
                     /locus_tag="Bsph_0077"
                     /note="Stage V sporulation protein B, also known as Stage
                     III sporulation protein F, and related proteins; Region:
                     MATE_SpoVB_like; cd13124"
                     /db_xref="CDD:240529"
     gene            84028..85506
                     /locus_tag="Bsph_0078"
                     /db_xref="GeneID:6024351"
     CDS             84028..85506
                     /locus_tag="Bsph_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695846.1"
                     /db_xref="GI:169825688"
                     /db_xref="GeneID:6024351"
                     /translation="MEILNTLTIIGLGAGDFNQLQMGVYKKLKAAKKLFVRTVDHPVL
                     EELAAEGITFESFDKVYEKHDAFQPVYAEIAESLIAATAIEDIMYAVPGHPLVAEQTV
                     QLLIEAANEGTFNLVIEGGQSFLDPIFGALKIDPIEGFQLLDGTSFSMHDINMRQHIL
                     IAQVYDTFSASEVKLTLMEKYDDEYPVTVVTAAGSSEEKIVTVPLYELDQSVEVNNLT
                     TVYVPPVNSQEEALRDWTTFRTIIATLRGPNGCPWDQKQTHESLKKYLLEEAHEYLAA
                     VDAEDDFAMIEELGDVLLQVFLHAQIGEDQGYFKLEDVLASISEKMIRRHPHVFGDVA
                     VEDADGVVANWEAIKAEEKGMTDKPLLDGEYRASSALQTAFNYQNRAAKVGFDWPDVE
                     GAWDKFAEEWQEFRHEVTNGSSISRLDELGDVLFTLVNLARFYKLSPEEAILHANEKF
                     ARRFGYVEAQVKASGKSFADFTLDQLDRFWNEAKQLEREKEL"
     misc_feature    84043..85491
                     /locus_tag="Bsph_0078"
                     /note="Protein containing tetrapyrrole methyltransferase
                     domain and MazG-like (predicted pyrophosphatase) domain
                     [General function prediction only]; Region: COG3956"
                     /db_xref="CDD:226465"
     misc_feature    84043..84702
                     /locus_tag="Bsph_0078"
                     /note="N-terminal S-AdoMet dependent methylase domain of
                     Bacillus subtilis YabN and related proteins; Region:
                     YabN_N; cd11723"
                     /db_xref="CDD:212509"
     misc_feature    order(84067..84069,84301..84309,84316..84321,84394..84399,
                     84511..84513,84595..84597,84601..84606,84676..84684)
                     /locus_tag="Bsph_0078"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212509"
     misc_feature    order(84085..84096,84100..84102,84307..84324,84334..84339,
                     84343..84348,84379..84381,84385..84396,84400..84405,
                     84412..84417,84451..84465)
                     /locus_tag="Bsph_0078"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212509"
     misc_feature    84748..85074
                     /locus_tag="Bsph_0078"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) N-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs; Region:
                     NTP-PPase_MazG_Nterm; cd11528"
                     /db_xref="CDD:212135"
     misc_feature    order(84748..84750,84802..84807,84814..84816,84823..84828,
                     84835..84840,84847..84849,84856..84858,84871..84873,
                     84880..84885,84892..84909,84913..84915,84922..84924,
                     84949..84951,84958..84972,84976..84984,84988..84993)
                     /locus_tag="Bsph_0078"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212135"
     misc_feature    order(84832..84834,84841..84843,84889..84891,84898..84900)
                     /locus_tag="Bsph_0078"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212135"
     misc_feature    85135..85479
                     /locus_tag="Bsph_0078"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) C-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs'; Region:
                     NTP-PPase_MazG_Cterm; cd11529"
                     /db_xref="CDD:212136"
     misc_feature    order(85135..85140,85144..85149,85156..85158,85168..85170,
                     85177..85185,85219..85224,85240..85245,85276..85284,
                     85288..85296,85300..85305,85309..85311,85330..85338,
                     85345..85347,85351..85380,85387..85392,85399..85401,
                     85444..85446,85453..85455,85465..85467)
                     /locus_tag="Bsph_0078"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212136"
     misc_feature    order(85183..85191,85216..85218,85228..85230,85237..85239,
                     85273..85275,85282..85287,85294..85296)
                     /locus_tag="Bsph_0078"
                     /note="active site"
                     /db_xref="CDD:212136"
     misc_feature    order(85225..85230,85237..85239,85282..85287,85294..85296)
                     /locus_tag="Bsph_0078"
                     /note="putative chemical substrate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:212136"
     misc_feature    order(85228..85230,85237..85239,85285..85287,85294..85296)
                     /locus_tag="Bsph_0078"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212136"
     gene            85503..85793
                     /locus_tag="Bsph_0079"
                     /db_xref="GeneID:6024352"
     CDS             85503..85793
                     /locus_tag="Bsph_0079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695847.1"
                     /db_xref="GI:169825689"
                     /db_xref="GeneID:6024352"
                     /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRITINEKVAKASSSVKAG
                     DELAIRFGQKIVTARVEEIRETVKKEDAAKMFTILKEERLEKIEPEFIDDEE"
     misc_feature    85503..85670
                     /locus_tag="Bsph_0079"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(85506..85508,85542..85547,85551..85556,85560..85565,
                     85572..85577,85581..85583,85599..85622,85626..85628)
                     /locus_tag="Bsph_0079"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            85933..86232
                     /locus_tag="Bsph_0080"
                     /db_xref="GeneID:6024353"
     CDS             85933..86232
                     /locus_tag="Bsph_0080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695848.1"
                     /db_xref="GI:169825690"
                     /db_xref="GeneID:6024353"
                     /translation="MTLHQESNRYTIPSGEHILTIRNRKRMDMTSVKSIERFDQEEFF
                     IKTSQGHLLIRGEELHIVHLDVDKGLLTLEGTVKTLQYDEEESGFSKGFLHKLFG"
     misc_feature    85981..86226
                     /locus_tag="Bsph_0080"
                     /note="YabP family; Region: YabP; cl06766"
                     /db_xref="CDD:244496"
     gene            86229..86720
                     /locus_tag="Bsph_0081"
                     /db_xref="GeneID:6024198"
     CDS             86229..86720
                     /locus_tag="Bsph_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695849.1"
                     /db_xref="GI:169825691"
                     /db_xref="GeneID:6024198"
                     /translation="MIVSEQFFQLIVMVVSGIAVGFIIDSVRLIVFSTPKRSSLRKWM
                     MVFELLTWILLGGLTYYLLFWLKDGAWRAYDPLAQIAGIFLYQSFFQTILRFIARVLV
                     NITWRPFWFIVRFIVSVIRHILQFLLNIVMIVIRPFVKIYSYLSYTFLKKLRYLKYNK
                     KQQ"
     misc_feature    86256..86501
                     /locus_tag="Bsph_0081"
                     /note="Spore cortex protein YabQ (Spore_YabQ); Region:
                     Spore_YabQ; pfam09578"
                     /db_xref="CDD:204269"
     gene            86738..87142
                     /locus_tag="Bsph_0082"
                     /db_xref="GeneID:6024199"
     CDS             86738..87142
                     /locus_tag="Bsph_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein DivIC"
                     /protein_id="YP_001695850.1"
                     /db_xref="GI:169825692"
                     /db_xref="GeneID:6024199"
                     /translation="MTRRHSSNDEQQNFTKLDNDYVRNTDKAINRKQQARKRKLRRIV
                     FFAIVPVIIIALLLNVLSNQHETLAIKEKSKEEAKQHLSELKEEQDSLNLKIKQLQDD
                     EYIAKLLRKEYYLSEKGEIIFIIPDKEDKKDD"
     misc_feature    86924..87121
                     /locus_tag="Bsph_0082"
                     /note="Septum formation initiator; Region: DivIC;
                     pfam04977"
                     /db_xref="CDD:203138"
     misc_feature    <86951..87130
                     /locus_tag="Bsph_0082"
                     /note="Septum formation initiator [Cell division and
                     chromosome partitioning]; Region: COG2919"
                     /db_xref="CDD:225471"
     gene            87277..87714
                     /locus_tag="Bsph_0083"
                     /db_xref="GeneID:6024200"
     CDS             87277..87714
                     /locus_tag="Bsph_0083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695851.1"
                     /db_xref="GI:169825693"
                     /db_xref="GeneID:6024200"
                     /translation="MSIEVGSKVQGKVTGITTFGAFVELPDGKTGLVHISEVADNYVK
                     DINEHLKVGDEVEVKVMNVEADGKIGLSIRKAKPQAERPERPERPARPRRDNRSNDRN
                     DRHQPKENFEQKMARFLKDSDERLATLKRATESKRGGRGARRG"
     misc_feature    87277..87711
                     /locus_tag="Bsph_0083"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08582"
                     /db_xref="CDD:236305"
     misc_feature    87292..87498
                     /locus_tag="Bsph_0083"
                     /note="S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_hs4; cd05692"
                     /db_xref="CDD:240197"
     misc_feature    order(87316..87318,87340..87342,87370..87372,87376..87378)
                     /locus_tag="Bsph_0083"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240197"
     gene            complement(87805..88056)
                     /locus_tag="Bsph_0084"
                     /db_xref="GeneID:6024201"
     CDS             complement(87805..88056)
                     /locus_tag="Bsph_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695852.1"
                     /db_xref="GI:169825694"
                     /db_xref="GeneID:6024201"
                     /translation="MSALTKAALICGSGSMIILISILINLPFVIQIMLLLCGLAVSVY
                     GVFLLVKMVVHPAEKVSIAPADEKVVTPIKKKKGPSSTL"
     gene            complement(88201..88272)
                     /locus_tag="Bsph_tRNA84"
                     /db_xref="GeneID:6024202"
     tRNA            complement(88201..88272)
                     /locus_tag="Bsph_tRNA84"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:6024202"
     gene            complement(88278..88354)
                     /locus_tag="Bsph_tRNA83"
                     /db_xref="GeneID:6024790"
     tRNA            complement(88278..88354)
                     /locus_tag="Bsph_tRNA83"
                     /product="tRNA-Met"
                     /db_xref="GeneID:6024790"
     gene            complement(88364..88438)
                     /locus_tag="Bsph_tRNA82"
                     /db_xref="GeneID:6024791"
     tRNA            complement(88364..88438)
                     /locus_tag="Bsph_tRNA82"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:6024791"
     gene            88875..91259
                     /locus_tag="Bsph_0085"
                     /db_xref="GeneID:6024792"
     CDS             88875..91259
                     /locus_tag="Bsph_0085"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein E"
                     /protein_id="YP_001695853.1"
                     /db_xref="GI:169825695"
                     /db_xref="GeneID:6024792"
                     /translation="MTSIDWYNTADVDDRKLGIKKKQIFIGSLFFLTSFFLAQSVVFE
                     AAVPFSVPFWAIIRTKYREYAKFVLFGSLAGCFFLGFGQVVILALQIIMYECIMRFRY
                     WRLPQSIAVSLAVLLVQFMWQGAMYQGLPPVLVQFYVGCEAALALIMTLFMQVLFVNS
                     YEWFTSHWTYEKLGSGLVVFAAMLTGMQAVVFSYFSLPIFLLQLFICFGALVGSVPLA
                     TVIGAVLGTLIGVAKLSFTGMLSVATLTGLCAGMGAKGGRFGVAIGSILPSVFFLFYD
                     ATLPLDSVYFTSIAIGSVLFLTIPRKYSDKVRDKLFPQREEVLIARQNWLTEHVTYKL
                     EHFQHFVQFMKELVFERFMTAPVEEAKEVSPMNTCLSCFRYDHCWGAQNNGMDKLMTD
                     WFHMKGVGKESAIHRVEEQMRYKCVKSTKIFEELDTELYRERINGQYFHGKKMIALQL
                     RDMSNHLNQLIAEMKEDTVSFVSVEKDIIERLKDAHIECFQLDVLNNKPGARKIVCAL
                     APARVDWEKDTTLAERMILPILYEIFNEPFEIEKVVACEIPFRHIQICFRSAISFEVE
                     YDIYSMSKDATLYSGDSHALFQLHPGLFAILLSDGMGQSKEAQHESRKLIHLMRECLN
                     YNMNPETAMHTLHYVMSLKQQDDMYATLDFALVDLQHGDLWSWKAGGMSTYILRGKEI
                     IKVESNAAPVGFLSISAVEAEKRKLKAGDVILMHSDGLFSSVADWDEQEETFLAYAQQ
                     VASTNNTIQEKLTTIMQSFQDYFEIEDDCTVLMLEVTHVVPTWAVFRPAQYSVS"
     misc_feature    88959..91202
                     /locus_tag="Bsph_0085"
                     /note="stage II sporulation protein E; Region: spore_II_E;
                     TIGR02865"
                     /db_xref="CDD:234038"
     misc_feature    <89403..89768
                     /locus_tag="Bsph_0085"
                     /note="CLC voltage-gated chloride channel. The ClC
                     chloride channels catalyse the selective flow of Cl- ions
                     across cell membranes, thereby regulating electrical
                     excitation in skeletal muscle and the flow of salt and
                     water across epithelial barriers. This...; Region:
                     Voltage_gated_ClC; cl02915"
                     /db_xref="CDD:243238"
     misc_feature    90645..91205
                     /locus_tag="Bsph_0085"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:219343"
     gene            91297..92703
                     /locus_tag="Bsph_0086"
                     /db_xref="GeneID:6022890"
     CDS             91297..92703
                     /locus_tag="Bsph_0086"
                     /EC_number="6.3.4.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthase"
                     /protein_id="YP_001695854.1"
                     /db_xref="GI:169825696"
                     /db_xref="GeneID:6022890"
                     /translation="MSFELKIKTFIEKEQLLQQGDHLLIAVSGGVDSMALLHYFVQTK
                     EHWNIRVEAVHVDHMLRGEASAEDRAFVQKYCDDNGVYLHATAISIPTILAKENGNIQ
                     LICRRERYRYFKEVLYETNANKLVTAHHADDQLESVLMALTKNATMNSMQGIRPQRNF
                     EGKTLIRPFLTVTKTEIGEYLLRKGLNYREDASNSKDTYVRNRFRHHVVPLLEAENPR
                     VTEQVTHFTSQLQEDNAFLMTLAQDVFSKTITRSNENTYSMEIEAFQLVPLALQRRLI
                     LILLNYLYKDSNTIQSYALLTSILKLCDTTAGYAEIHLPEDFLAVRRYGKLIIRKNSS
                     TEDHASSEKIIISAANGWTTLMNGERLCVVKLHDLSSELITDTAQLFYFNASKLHLPL
                     YIRARKDGDRMLLKGMDQPKRLSRLFIDEKIPLNERNSWPLLISQSDEVVAVIGVRMG
                     MFFSTTPQPNDDTVLIVD"
     misc_feature    91297..92037
                     /locus_tag="Bsph_0086"
                     /note="tRNA(Ile)-lysidine synthase MesJ [Cell cycle
                     control, cell division, chromosome partitioning]; Region:
                     MesJ; COG0037"
                     /db_xref="CDD:223115"
     misc_feature    91360..91926
                     /locus_tag="Bsph_0086"
                     /note="N-terminal domain of predicted ATPase of the
                     PP-loop faimly implicated in cell cycle control [Cell
                     division and chromosome partitioning]. This is a subfamily
                     of Adenine nucleotide alpha hydrolases
                     superfamily.Adeninosine nucleotide alpha hydrolases...;
                     Region: PP-ATPase; cd01992"
                     /db_xref="CDD:238950"
     misc_feature    order(91372..91380,91384..91395,91459..91461,91465..91467)
                     /locus_tag="Bsph_0086"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238950"
     misc_feature    92470..>92640
                     /locus_tag="Bsph_0086"
                     /note="TilS substrate C-terminal domain; Region: TilS_C;
                     smart00977"
                     /db_xref="CDD:198045"
     gene            92771..93313
                     /locus_tag="Bsph_0087"
                     /db_xref="GeneID:6022891"
     CDS             92771..93313
                     /locus_tag="Bsph_0087"
                     /EC_number="2.4.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="YP_001695855.1"
                     /db_xref="GI:169825697"
                     /db_xref="GeneID:6022891"
                     /translation="MLQNDIEKVMITEEQLQERIADLGAQLTEEYKDAFPLAVGVLKG
                     AMPFMTDLMKRFDSFIELDFMDVSSYGNATVSSGEVKILKDLNTSVEGRDVLIIEDII
                     DSGLTLSYLVDLFKYRKAKSIKIVTLLDKPSGRKVNLSADYVGFEVPDGFVVGYGLDY
                     AEKYRNLPYIGILKPEVYSF"
     misc_feature    92837..93211
                     /locus_tag="Bsph_0087"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(92894..92896,92900..92902,93065..93073,93077..93091,
                     93161..93163)
                     /locus_tag="Bsph_0087"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            93643..95619
                     /locus_tag="Bsph_0088"
                     /db_xref="GeneID:6022892"
     CDS             93643..95619
                     /locus_tag="Bsph_0088"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protease ftsH-like protein"
                     /protein_id="YP_001695856.1"
                     /db_xref="GI:169825698"
                     /db_xref="GeneID:6022892"
                     /translation="MIIGIFGTFNGGKSPTKELTYHEFQQALDKKEITSATIQPDKSV
                     YVVEGTLKGYEKGQSFTVNIPRDNQSLMDRIDEAAKEKNSNIKYLAAPETSGWIQFFT
                     GIIPFIIIIFLFFFLMSQSQGGGNKVMSFGKSKAKLYDDQKKKVRFTDVAGADEEKAE
                     LVEVVDFLKDHRKFTEIGARIPKGILLVGPPGTGKTLLARAVAGEAGVPFFSISGSDF
                     VEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQLL
                     VEMDGFGANEGIIIIAATNRPDILDKALLRPGRFDRQITVGHPDVKGREAILKVHARN
                     KPLADTVDLAAVAQRTPGFSGADLENLLNEAALVAARKSKRTINMADIDEASDRVIAG
                     PAKASRVYSAKEKKLVSFHEAGHVVVGLELDEADTVHKVTIVPRGQAGGYAIMLPKEE
                     RFFTTRQELLDRIAGLLGGRVAEEIVLGEVSTGAHNDFQKVTSIARAMVTEYGMSENL
                     GAMQFGSSQGGNVFLGRDFNSDQNYSDSIAYEIDKEMQKIIDTQYERTKRILTEKREL
                     LDLIANTLMEKETLNAQEIEHLRDHGVLPEPEAIVEGNNTPKVEAKPTLDTIGEPVVE
                     KELLSKDPNPTTLDLAKEGKESNDTPKGIDEKRE"
     misc_feature    93646..93891
                     /locus_tag="Bsph_0088"
                     /note="FtsH Extracellular; Region: FtsH_ext; pfam06480"
                     /db_xref="CDD:219052"
     misc_feature    93991..95406
                     /locus_tag="Bsph_0088"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    94096..94593
                     /locus_tag="Bsph_0088"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    94207..94230
                     /locus_tag="Bsph_0088"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(94210..94233,94384..94386,94525..94527)
                     /locus_tag="Bsph_0088"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    94372..94389
                     /locus_tag="Bsph_0088"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    94567..94569
                     /locus_tag="Bsph_0088"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    94774..95406
                     /locus_tag="Bsph_0088"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:216502"
     gene            95782..96615
                     /gene="ytbE"
                     /locus_tag="Bsph_0089"
                     /db_xref="GeneID:6022893"
     CDS             95782..96615
                     /gene="ytbE"
                     /locus_tag="Bsph_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695857.1"
                     /db_xref="GI:169825699"
                     /db_xref="GeneID:6022893"
                     /translation="MGTVTLNNGLKMPLVGYGVFRVPEGEDLAEAVKTAIAKGYRSID
                     TAQVYRNEESVGRGIRAAIEEGLVTREELFITSKVWNDGLSYDETLAAYDSSLEKIGL
                     DYLDLYLVHWPGIDTNYLDVYKALEKIYQDGRVRSIGVSNFHVHHLEYLLKEATVVPV
                     INQIEFHPHLTQEEVRAYCTDKGIQVEAWSPLMNGALLEEALIQELASKYGKTPAQIV
                     LRYDVQHNVVTIPKTMTETRMIENLDIFDFALTDDEMTQLDALNDGLRCGPDPEKFNF
                     K"
     misc_feature    95788..96564
                     /gene="ytbE"
                     /locus_tag="Bsph_0089"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    95824..96570
                     /gene="ytbE"
                     /locus_tag="Bsph_0089"
                     /note="Aldo/keto reductase family; Region: Aldo_ket_red;
                     pfam00248"
                     /db_xref="CDD:215817"
     misc_feature    order(95833..95841,95911..95913,95926..95928,96013..96015,
                     96112..96117,96202..96207,96268..96270,96346..96363,
                     96424..96426,96469..96480,96493..96495,96502..96507)
                     /gene="ytbE"
                     /locus_tag="Bsph_0089"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(95911..95913,95926..95928,96013..96015,96112..96114)
                     /gene="ytbE"
                     /locus_tag="Bsph_0089"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            96779..97561
                     /locus_tag="Bsph_0090"
                     /db_xref="GeneID:6022826"
     CDS             96779..97561
                     /locus_tag="Bsph_0090"
                     /EC_number="2.7.1.33"
                     /codon_start=1
                     /transl_table=11
                     /product="Type III pantothenate kinase"
                     /protein_id="YP_001695858.1"
                     /db_xref="GI:169825700"
                     /db_xref="GeneID:6022826"
                     /translation="MGVSTLILVLDAGNSNIVLGVYDDKEQLAFHWRMVTDLYKTEDE
                     YAMQVLSFFNHAGISFEQVTGIIISSVVPPIMYSLEAMCQKYFRKKPLVVGPGVKTGL
                     NIKYENPREVGSDRIVNAIAALDLYKAPCIIVDFGTATTYCYLNEKGDYMGGAIAPGI
                     TISTEALYTQAARLPRIEIVRPAHIVGKTTVSAMQAGIFYGFVGQVEGIVNRMKGQSK
                     EEPLVIATGGLANLIAGETQIIDVVDPFLTLKGLYKLYKRNQ"
     misc_feature    96800..>97228
                     /locus_tag="Bsph_0090"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(96809..96820,96824..96826,96830..96832,97121..97123,
                     97181..97192)
                     /locus_tag="Bsph_0090"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     misc_feature    <97115..97534
                     /locus_tag="Bsph_0090"
                     /note="Type III pantothenate kinase; Region: Pan_kinase;
                     cl17198"
                     /db_xref="CDD:247752"
     gene            97565..98464
                     /locus_tag="Bsph_0091"
                     /db_xref="GeneID:6022827"
     CDS             97565..98464
                     /locus_tag="Bsph_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin HSP33"
                     /protein_id="YP_001695859.1"
                     /db_xref="GI:169825701"
                     /db_xref="GeneID:6022827"
                     /translation="MRDISFMKDYLVRGLGFNGQVRVFAARTTATVAEAQRRHDTWPV
                     VSAALGRSMTAAVMMGAMLKGEEKITIKIEGNGPIGPMVIDSNAHGEVRGFVTNPHVH
                     FDLNEQGKLDVRAGVGTEGALTIVKDLGLRDMFSGQTPIVSGEIAEDFTYYFATSEQV
                     PSSVGLGVLVNPDNTILAAGGFILQLMPGCEEETINEIEQHLATIEPVSKMIEKGFTP
                     EQILEAVLGNGHLQILDSMPVEFKCQCSKERFGAAILGLGIAEIKEMIEEDGSADAQC
                     HFCLETYHFSKEELEGFIDELKS"
     misc_feature    97583..98458
                     /locus_tag="Bsph_0091"
                     /note="Hsp33-like chaperonin; Reviewed; Region: hslO;
                     PRK00114"
                     /db_xref="CDD:234643"
     misc_feature    97679..98422
                     /locus_tag="Bsph_0091"
                     /note="Heat shock protein 33 (Hsp33):  Cytosolic protein
                     that acts as a molecular chaperone under oxidative
                     conditions.  In normal (reducing) cytosolic conditions,
                     four conserved Cys residues are coordinated by a Zn ion.
                     Under oxidative stress (such as heat...; Region: Hsp33;
                     cd00498"
                     /db_xref="CDD:238278"
     misc_feature    order(98021..98023,98033..98041,98117..98119,98291..98293)
                     /locus_tag="Bsph_0091"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238278"
     misc_feature    order(98099..98101,98105..98107,98117..98128)
                     /locus_tag="Bsph_0091"
                     /note="domain crossover interface; other site"
                     /db_xref="CDD:238278"
     misc_feature    order(98291..98293,98297..98299,98390..98392,98399..98401)
                     /locus_tag="Bsph_0091"
                     /note="redox-dependent activation switch; other site"
                     /db_xref="CDD:238278"
     gene            98448..99419
                     /locus_tag="Bsph_0092"
                     /db_xref="GeneID:6022828"
     CDS             98448..99419
                     /locus_tag="Bsph_0092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695860.1"
                     /db_xref="GI:169825702"
                     /db_xref="GeneID:6022828"
                     /translation="MSSNRNRRPSATATTNQTPLLQRRLKTKPALAVIAVLLLGNILW
                     FIGWVIPNKGQEIGSDEQVAAIDGDVITRQEWMIAMEERYGKETLQSLVNETVMEKAA
                     KTYKIKVTDQEIDLELALMRSAQDKFDTAMQNLTAEQLRQKIRSQLILDKVLTKDVVI
                     NEESIEKYYEENQGLYNTKTSYRTNFIEVDAKKAADEALGELKNGSDFSVLAREISLD
                     SASASLGGDVGFLTENQENVDPAIINAVKSTKVNEVSKAFKLDNGHYGIVQVQEILEG
                     QSFTYDDVKEHIERELALEQLPQSVTPEAFWSEFNATWYYGESKKEK"
     misc_feature    98544..98909
                     /locus_tag="Bsph_0092"
                     /note="SurA N-terminal domain; Region: SurA_N_3; cl07813"
                     /db_xref="CDD:244798"
     misc_feature    99015..99263
                     /locus_tag="Bsph_0092"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:216038"
     gene            99695..100624
                     /locus_tag="Bsph_0093"
                     /db_xref="GeneID:6022829"
     CDS             99695..100624
                     /locus_tag="Bsph_0093"
                     /EC_number="2.5.1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="YP_001695861.1"
                     /db_xref="GI:169825703"
                     /db_xref="GeneID:6022829"
                     /translation="MSRLANSIAELVGKTPIVKLNHATSENEGTVYVKLEYFNPGSSV
                     KDRLALAMIEAAEKDGTLQPGGTIIEPTSGNTGIGLAMIAAAKGYKAILVMPETMSLE
                     RRNLLRAYGAELVLTPGPAGMKGAIAKAEELSAEHGYFLPQQFTNPANAVIHRLTTGP
                     EIVEAFDGLTLDAFVAGVGTGGTITGAGSVLKEKYPTIEIIAVEPKDSPVLSGGQPGP
                     HKIQGIGAGFVPTVLDTDIYSSVFPVENEVAFEVARKVAREEGILCGISSGAAIYAAI
                     EAAKRLGKGSNVLAIVPSNGERYLSTPLYQFED"
     misc_feature    99704..100600
                     /locus_tag="Bsph_0093"
                     /note="Cysteine synthase [Amino acid transport and
                     metabolism]; Region: CysK; COG0031"
                     /db_xref="CDD:223110"
     misc_feature    99731..100597
                     /locus_tag="Bsph_0093"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    order(99743..99751,99788..99790,99806..99808,99812..99814,
                     99938..99940,99947..99949,99995..100000,100007..100012,
                     100019..100024,100184..100189,100463..100471,
                     100475..100483,100553..100555,100583..100585,
                     100592..100594)
                     /locus_tag="Bsph_0093"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    order(99827..99829,99917..99919,100226..100243,
                     100361..100363,100493..100495,100571..100576)
                     /locus_tag="Bsph_0093"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    99827..99829
                     /locus_tag="Bsph_0093"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            100805..102184
                     /locus_tag="Bsph_0094"
                     /db_xref="GeneID:6022830"
     CDS             100805..102184
                     /locus_tag="Bsph_0094"
                     /codon_start=1
                     /transl_table=11
                     /product="Para-aminobenzoate synthase component 1"
                     /protein_id="YP_001695862.1"
                     /db_xref="GI:169825704"
                     /db_xref="GeneID:6022830"
                     /translation="MDADSFFYSYKKQTETQHSHVFLESGRGGHFTIAAWNPLATAQA
                     VENGLLVNWRNGRSEVLPGESLALLEELVADYQVSYNVELPIFQGGAIGFVTYDYARN
                     IEVLPNTAIDDLHIPDIFFYLFDCWAVHDVKSNTVTLMKLEDCVVDLDEWATNWQVAA
                     QDGLATRKFEKTNAIEVDNDESELLVSFAGTEFEAAVKKIQTYIAEGDVFQVNLSVRQ
                     SKNLSATAMDVYEALRAFNPSPYMAYMEAPDFAVVSGSPELLVKRQGKELSTRPIAGT
                     RPRGKSEAEDLALAQELIDNDKERAEHVMLVDLERNDLGRVSTYGTVEVDEFMVIERY
                     SHVMHIVSNVRGEIAEGKTNADVIRAMFPGGTITGAPKIRTMEIIEELEPVRRGLYTG
                     SIGWLGYTGDMEFNIVIRTAFIKDGVAHIQAGAGIVIDSVPAREYQESLNKAKAMWQA
                     KAMAEERAK"
     misc_feature    100808..102130
                     /locus_tag="Bsph_0094"
                     /note="Anthranilate/para-aminobenzoate synthases component
                     I [Amino acid transport and metabolism / Coenzyme
                     metabolism]; Region: TrpE; COG0147"
                     /db_xref="CDD:223225"
     misc_feature    100865..101221
                     /locus_tag="Bsph_0094"
                     /note="Anthranilate synthase component I, N terminal
                     region; Region: Anth_synt_I_N; pfam04715"
                     /db_xref="CDD:218224"
     misc_feature    101375..102130
                     /locus_tag="Bsph_0094"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     pfam00425"
                     /db_xref="CDD:215913"
     gene            102181..102762
                     /locus_tag="Bsph_0095"
                     /db_xref="GeneID:6025057"
     CDS             102181..102762
                     /locus_tag="Bsph_0095"
                     /EC_number="4.1.3.27"
                     /note="Includes: Para-aminobenzoate synthase glutamine
                     amidotransferase component II (ADC synthase); Anthranilate
                     synthase component II"
                     /codon_start=1
                     /transl_table=11
                     /product="Para-aminobenzoate/anthranilate synthase
                     glutamine amidotransferase component II"
                     /protein_id="YP_001695863.1"
                     /db_xref="GI:169825705"
                     /db_xref="GeneID:6025057"
                     /translation="MILMIDNYDSFIYNIVQYLGEFGHEIIVKRNDVLTIEDIEQLAP
                     DMIVISPGPCSPNEAGESLNIIRYFAGNIPILGVCLGHQAIAQVFGGQVIRAERLMHG
                     KTSPVLHAEVGLHKAMPNPFQATRYHSLIVEKETLPTCLEVTAWTEEGEIMGLRHKDY
                     PIEGVQYHPESIMTEQGKKLLRQFIEMYVEGVK"
     misc_feature    102181..102735
                     /locus_tag="Bsph_0095"
                     /note="para-aminobenzoate synthase component II;
                     Provisional; Region: PRK08857"
                     /db_xref="CDD:181566"
     misc_feature    102184..102735
                     /locus_tag="Bsph_0095"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Anthranilate synthase; Region:
                     GATase1_Anthranilate_Synthase; cd01743"
                     /db_xref="CDD:153214"
     misc_feature    order(102331..102336,102340..102342,102415..102420,
                     102427..102429,102559..102570)
                     /locus_tag="Bsph_0095"
                     /note="glutamine binding [chemical binding]; other site"
                     /db_xref="CDD:153214"
     misc_feature    order(102415..102417,102682..102684,102688..102690)
                     /locus_tag="Bsph_0095"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153214"
     gene            102790..103602
                     /locus_tag="Bsph_0096"
                     /db_xref="GeneID:6025058"
     CDS             102790..103602
                     /locus_tag="Bsph_0096"
                     /EC_number="4.1.3.38"
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate lyase"
                     /protein_id="YP_001695864.1"
                     /db_xref="GI:169825706"
                     /db_xref="GeneID:6025058"
                     /translation="MAEKDLRISPFDHGFLYGLGFFETFRTYKGQVFGWDAHMERLQQ
                     ALSQYRIHLTYPESVLLEVVQQLNQQARGQDGYFRLNVSAGEHNIGLQPTEYTTPNVI
                     LFRKELQDTPRGTEKTAQWLTTPRNSPEQGLRVKSHHFGNNVLGRFELPSLAEQEGFF
                     LTEAGYVAEGVTSNVFWVKNDILYTPSLETGILPGIVRAWVIKKANALGIEVSEGFYR
                     KEDLQQSTECFITNSVQELVPIINVENQQLLGNRGPVYMRLHDAFAQEVEQR"
     misc_feature    102790..103599
                     /locus_tag="Bsph_0096"
                     /note="Branched-chain amino acid
                     aminotransferase/4-amino-4-deoxychorismate lyase [Amino
                     acid transport and metabolism / Coenzyme metabolism];
                     Region: IlvE; COG0115"
                     /db_xref="CDD:223193"
     misc_feature    102823..103578
                     /locus_tag="Bsph_0096"
                     /note="PyridoxaL 5'-Phosphate Dependent Enzymes class IV
                     (PLPDE_IV). This D-amino acid superfamily, one of five
                     classes of PLPDE, consists of branched-chain amino acid
                     aminotransferases (BCAT), D-amino acid transferases
                     (DAAT), and...; Region: PLPDE_IV; cd00449"
                     /db_xref="CDD:238254"
     misc_feature    order(102829..102834,102838..102843,102847..102849,
                     102853..102855,102931..102933,103024..103026,
                     103030..103032,103093..103095,103201..103203,
                     103213..103215,103219..103221,103231..103233,
                     103273..103275)
                     /locus_tag="Bsph_0096"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238254"
     misc_feature    order(102853..102855,102910..102912,103195..103197,
                     103294..103296,103375..103380,103486..103488)
                     /locus_tag="Bsph_0096"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    order(102910..102912,103195..103197,103294..103296)
                     /locus_tag="Bsph_0096"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    103195..103197
                     /locus_tag="Bsph_0096"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            103616..104470
                     /locus_tag="Bsph_0097"
                     /db_xref="GeneID:6025059"
     CDS             103616..104470
                     /locus_tag="Bsph_0097"
                     /EC_number="2.5.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="YP_001695865.1"
                     /db_xref="GI:169825707"
                     /db_xref="GeneID:6025059"
                     /translation="MLEKYMKPLTINGIPLDFTKETFVMGILNVTPDSFSDGGKFNSV
                     EAAVAQAKKMVADGAKIIDVGGESTRPGYERISDEKEIARIVPVIQALLKEVDAIISV
                     DTYKANVARAAIEAGAHMINDIWGAKAEPEIAQVAADLHVPIILMHNRENLDYGVDFW
                     ASAKADIEKSIVIAHQAGVPDHHIILDPGIGFAKNTEHNIAMMQHLEDLVEMGYPVLL
                     ATSRKSMIGNVLKLPVDERLEGTGATVVYGIEKGCHMIRVHDVKEMARAAHMADVLVG
                     KRLYKEEA"
     misc_feature    103679..104431
                     /locus_tag="Bsph_0097"
                     /note="DHPS subgroup of Pterin binding enzymes. DHPS
                     (dihydropteroate synthase), a functional homodimer,
                     catalyzes the condensation of p-aminobenzoic acid (pABA)
                     in the de novo biosynthesis of folate, which is an
                     essential cofactor in both nucleic acid and...; Region:
                     DHPS; cd00739"
                     /db_xref="CDD:238380"
     misc_feature    103685..104437
                     /locus_tag="Bsph_0097"
                     /note="dihydropteroate synthase; Region: DHPS; TIGR01496"
                     /db_xref="CDD:233439"
     misc_feature    order(103700..103702,103922..103924,103979..103981,
                     103985..103987,104054..104056,104174..104176,
                     104270..104272,104282..104284,104384..104386,
                     104390..104392)
                     /locus_tag="Bsph_0097"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238380"
     misc_feature    order(104213..104215,104225..104230,104342..104344,
                     104354..104356,104366..104368,104411..104416)
                     /locus_tag="Bsph_0097"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238380"
     misc_feature    104276..104284
                     /locus_tag="Bsph_0097"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238380"
     gene            104470..104835
                     /locus_tag="Bsph_0098"
                     /db_xref="GeneID:6025060"
     CDS             104470..104835
                     /locus_tag="Bsph_0098"
                     /EC_number="4.1.2.25"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="YP_001695866.1"
                     /db_xref="GI:169825708"
                     /db_xref="GeneID:6025060"
                     /translation="MDYIHLKDMQFYGYHGVLAAETTLGQRFRANVSLAVDMTMAGET
                     DDLAYTVNYAEVYAVCRDIVEGEPFKLIEALVVKIANVILTTYPEKVKGVRVELIKPD
                     PPIHGYYKEVSVEVTRGDF"
     misc_feature    104470..104826
                     /locus_tag="Bsph_0098"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(104473..104505,104521..104547,104773..104778,
                     104791..104817)
                     /locus_tag="Bsph_0098"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(104515..104523,104530..104532,104677..104688,
                     104767..104769,104809..104811)
                     /locus_tag="Bsph_0098"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            104835..105347
                     /locus_tag="Bsph_0099"
                     /db_xref="GeneID:6025061"
     CDS             104835..105347
                     /locus_tag="Bsph_0099"
                     /EC_number="2.7.6.3"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="YP_001695867.1"
                     /db_xref="GI:169825709"
                     /db_xref="GeneID:6025061"
                     /translation="MKDVYLSIGTNMGERYENLQKAIALLREKVNIEVVRVSSVYETA
                     AVGYTDQADFLNIAVHLKTDASSTEMLKICQSIEQELGRVREFRWGPRIIDLDILLYN
                     HENIETENLIVPHPRMYERAFVLVPLVEITPTPFGGQLQQAHHLLQQMDCESEGISLW
                     KPTNEPLTVN"
     misc_feature    104844..105227
                     /locus_tag="Bsph_0099"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK). Folate derivatives are essential cofactors in the
                     biosynthesis of purines, pyrimidines, and amino acids as
                     well as formyl-tRNA. Mammalian cells are able to utilize
                     pre-formed folates after...; Region: HPPK; cd00483"
                     /db_xref="CDD:238269"
     misc_feature    order(104859..104861,104961..104966,104970..104972,
                     104994..104996,105000..105002,105045..105047,
                     105057..105059,105066..105068,105081..105083,
                     105087..105089,105099..105101,105108..105110,
                     105117..105119,105123..105128,105168..105170,
                     105177..105182,105195..105197,105201..105203)
                     /locus_tag="Bsph_0099"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    order(105045..105047,105057..105059,105066..105068,
                     105081..105083,105087..105089,105108..105110,
                     105123..105128,105168..105170,105177..105182,
                     105195..105197)
                     /locus_tag="Bsph_0099"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            105417..106457
                     /locus_tag="Bsph_0100"
                     /db_xref="GeneID:6022868"
     CDS             105417..106457
                     /locus_tag="Bsph_0100"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase 1"
                     /protein_id="YP_001695868.1"
                     /db_xref="GI:169825710"
                     /db_xref="GeneID:6022868"
                     /translation="MSQTTEKPFRIGDIVMDNRVVLAPMAGICNSAFRLTVKEFGAGL
                     VYAEMISDKGIVQKNEKTLGMLYIDERENPLSLQIFGGDKETLVEAAKYVDQNTTADI
                     IDINMGCPVNKIIKCEAGARLLLDPNKVYEMVAAVVDAVKKPISVKMRIGWDDEHIFA
                     IENAQAVERAGASAVAVHGRTRVQMYEGKANWDIIRQVKENVKIPVLGNGDVETPQDA
                     KRMLETTGVDAVMIGRAALGNPWMIYRTVQYLETGELKEEPSVREKMDVCLLHFERLL
                     QLKGEGIAVREMRKHASWYLKGIRGNGKARNAINQTETAAELRALLNGLVREYEESES
                     NFFIPEAKEFII"
     misc_feature    105447..106391
                     /locus_tag="Bsph_0100"
                     /note="putative TIM-barrel protein, nifR3 family; Region:
                     nifR3_yhdG; TIGR00737"
                     /db_xref="CDD:129820"
     misc_feature    105471..106169
                     /locus_tag="Bsph_0100"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    order(105483..105491,105561..105563,105648..105650,
                     105732..105734,105858..105860,105948..105950,
                     106041..106043,106047..106049,106113..106118)
                     /locus_tag="Bsph_0100"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(105648..105650,105741..105746,105858..105860,
                     105864..105866,105945..105950,105954..105959,
                     106044..106049,106116..106118)
                     /locus_tag="Bsph_0100"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(105741..105743,105864..105866,105948..105950,
                     105954..105956)
                     /locus_tag="Bsph_0100"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(105744..105746,105858..105860,105945..105947,
                     105957..105959,106044..106049)
                     /locus_tag="Bsph_0100"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            106636..108138
                     /locus_tag="Bsph_0101"
                     /db_xref="GeneID:6022869"
     CDS             106636..108138
                     /locus_tag="Bsph_0101"
                     /EC_number="6.1.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="YP_001695869.1"
                     /db_xref="GI:169825711"
                     /db_xref="GeneID:6022869"
                     /translation="MKQVSNIEELNDQLLVRRQKMTTILENGQDPFGSRFERTHLSTE
                     VKEQFADQTKEQLEENLQEVIIAGRIMTKRGKGKAGFAHIQDLGGQIQIYVRQDHVGE
                     EAYELFKQADLGDIVGIRGNVFRTQVGELSVKAEEFTFLTKALRPMPEKFHGLQDVEQ
                     RYRQRYLDLMTNEDSKLTFIARSKIIRAIRNYLDNAGYLEVETPMLHTIAGGAAARPF
                     ITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELY
                     EAYADYQDIMSLTENLIAHVAQEVLGTTTVQYGEDEINLAVGWKRVHMVDAVKEATGV
                     DFWQPMTKEQAQALAKEHGVEVKDVHEVGHIINEFFEQKIEETLVQPTFVYGHPVEIS
                     PLAKKNPEDERFTDRFELFIVRREHANAFTELNDPIDQRQRFEAQLAEKAAGNDEAHE
                     MDNDFIEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPTMRHITK"
     misc_feature    106657..108126
                     /locus_tag="Bsph_0101"
                     /note="lysyl-tRNA synthetase; Reviewed; Region: lysS;
                     PRK00484"
                     /db_xref="CDD:234778"
     misc_feature    106822..107142
                     /locus_tag="Bsph_0101"
                     /note="LysRS_N: N-terminal, anticodon recognition domain
                     of lysyl-tRNA synthetases (LysRS). These enzymes are
                     homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs).
                     This domain is a beta-barrel domain (OB fold) involved in
                     binding the tRNA anticodon stem-loop; Region: LysRS_N;
                     cd04322"
                     /db_xref="CDD:239817"
     misc_feature    order(106837..106842,106891..106896,106981..106983,
                     107059..107061,107068..107076)
                     /locus_tag="Bsph_0101"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239817"
     misc_feature    order(106849..106851,106855..106860,106876..106878,
                     106909..106911,106915..106917,106969..106971,
                     107011..107013,107029..107031)
                     /locus_tag="Bsph_0101"
                     /note="putative anticodon binding site; other site"
                     /db_xref="CDD:239817"
     misc_feature    107149..108123
                     /locus_tag="Bsph_0101"
                     /note="Lys_tRNA synthetase (LysRS) class II core domain.
                     Class II LysRS is a dimer which attaches a lysine to the
                     3' OH group of ribose of the appropriate tRNA. Its
                     assignment to class II aaRS is based upon its structure
                     and the presence of three...; Region: LysRS_core; cd00775"
                     /db_xref="CDD:238398"
     misc_feature    107245..107259
                     /locus_tag="Bsph_0101"
                     /note="motif 1; other site"
                     /db_xref="CDD:238398"
     misc_feature    order(107341..107343,107407..107409,107413..107415,
                     107431..107433,107443..107445,107860..107862,
                     107881..107883,107890..107892,107902..107904,
                     108058..108060)
                     /locus_tag="Bsph_0101"
                     /note="active site"
                     /db_xref="CDD:238398"
     misc_feature    107404..107415
                     /locus_tag="Bsph_0101"
                     /note="motif 2; other site"
                     /db_xref="CDD:238398"
     misc_feature    108049..108060
                     /locus_tag="Bsph_0101"
                     /note="motif 3; other site"
                     /db_xref="CDD:238398"
     gene            108330..108611
                     /locus_tag="Bsph_0102"
                     /db_xref="GeneID:6022870"
     CDS             108330..108611
                     /locus_tag="Bsph_0102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695870.1"
                     /db_xref="GI:169825712"
                     /db_xref="GeneID:6022870"
                     /translation="MNYKIINKQVFEQAQLRSVSDVPFTEEELEHGMKLVVAKKDENL
                     TLYLVEVDGHKKFDVRWDDSSEIFSGWYSAWDNFLWCLNIVDPQDDGLK"
     gene            109241..110783
                     /locus_tag="Bsph_rRNA0416S"
                     /db_xref="GeneID:6022871"
     rRNA            109241..110783
                     /locus_tag="Bsph_rRNA0416S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022871"
     gene            110878..110954
                     /locus_tag="Bsph_tRNA7"
                     /db_xref="GeneID:6022872"
     tRNA            110878..110954
                     /locus_tag="Bsph_tRNA7"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:6022872"
     gene            110967..111042
                     /locus_tag="Bsph_tRNA8"
                     /db_xref="GeneID:6024544"
     tRNA            110967..111042
                     /locus_tag="Bsph_tRNA8"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:6024544"
     gene            111270..114181
                     /locus_tag="Bsph_rRNA0423S"
                     /db_xref="GeneID:6024545"
     rRNA            111270..114181
                     /locus_tag="Bsph_rRNA0423S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6024545"
     gene            114373..114479
                     /locus_tag="Bsph_rRNA045S"
                     /db_xref="GeneID:6022589"
     rRNA            114373..114479
                     /locus_tag="Bsph_rRNA045S"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:6022589"
     gene            complement(114523..115974)
                     /locus_tag="Bsph_0105"
                     /db_xref="GeneID:6022590"
     CDS             complement(114523..115974)
                     /locus_tag="Bsph_0105"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid carrier protein"
                     /protein_id="YP_001695871.1"
                     /db_xref="GI:169825713"
                     /db_xref="GeneID:6022590"
                     /translation="METIVNTLVDYIWGNALVYLALGVGLYFTVLTKAVQFRYIPEMI
                     RLLRERKESKEGISSFQAFCMALSGRVGVGNIAGVATAIAAGGPGAVFWMGIMAFLGG
                     ASAFIESTLAQLYKEKADDQYRGGSPYYIEKGLRLKGFAIFVACVICLSYGVLVPGIQ
                     ANTIATSFNTAFHIPPFITGALIVILLGLIIFGGVKRIARVADKVVPIMALAYVILTL
                     IILGANVSEIPGMVKLIITSAFGTNAIFGGIVGTAIAWGVRRSVFSNVAGAGEATFSS
                     AAAEVSHPAKQGLVQGFSIYIDTIIVCTATALMILITGMYNVTPSGTTTPLVENIPGV
                     VAGTAYTQAAVSTVFNDFGSGFVATAIFLFAFTTLMAYYYIAETTIVYLDNKLRLPIL
                     KLVLKMVFLLVVYVGSVQSVSLMWGLGDIGFGSMSYLNFIAIVLLTKPAIRVLQDYDR
                     QKKAGLDPIFDPREVGIKNAEFWIEYSNMHKKN"
     misc_feature    complement(114604..115974)
                     /locus_tag="Bsph_0105"
                     /note="Na+/alanine symporter [Amino acid transport and
                     metabolism]; Region: AlsT; COG1115"
                     /db_xref="CDD:224040"
     misc_feature    complement(114631..115938)
                     /locus_tag="Bsph_0105"
                     /note="Sodium:alanine symporter family; Region:
                     Na_Ala_symp; cl00548"
                     /db_xref="CDD:241939"
     gene            complement(116243..117463)
                     /locus_tag="Bsph_0106"
                     /db_xref="GeneID:6022591"
     CDS             complement(116243..117463)
                     /locus_tag="Bsph_0106"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="opine oxidase subunit A"
                     /protein_id="YP_001695872.1"
                     /db_xref="GI:169825714"
                     /db_xref="GeneID:6022591"
                     /translation="MNNKVIIIGAGPAGLAAAITLAEKNIAVLVIDEYLYAGGRLLGQ
                     LYEEKPGTWWNGIVESERLVERAKAVHVEFLLQTSVSDLEKIGQMWVIHTTKGAFRTQ
                     HLLLATGAAESPFPIPGWTLPGVMSVGAAQVMTNVHRVKPGKRGVIVGVNVLSSAIAM
                     ELQLAGVHVAAITLPPTNLLTEGYSNPLEVMTSLLHVAHMAPSPLVKIGSKLMKNDFM
                     KKLGITFYPKNGVKMWDIPIMLRKAVIEIVGKNQVEGVILATVNTDGSIVKGSEQHIK
                     ADFICIAGGLYPLAELASLAGCPFHYIEQLGGFIPLHNEQMETNLEGLYVAGNITGIE
                     GAKVALAQGEVAALTIAQHLNGGASNHDIKLAIQAVEKTRATAHIQFHPEILAGRQQM
                     KQIWNESVGSLSIH"
     misc_feature    complement(<117122..>117277)
                     /locus_tag="Bsph_0106"
                     /note="flavoprotein, HI0933 family; Region: TIGR00275"
                     /db_xref="CDD:232901"
     misc_feature    complement(<116408..>117166)
                     /locus_tag="Bsph_0106"
                     /note="sarcosine oxidase, alpha subunit family,
                     heterotetrameric form; Region: soxA; TIGR01372"
                     /db_xref="CDD:233382"
     gene            complement(117453..117794)
                     /locus_tag="Bsph_0107"
                     /db_xref="GeneID:6024506"
     CDS             complement(117453..117794)
                     /locus_tag="Bsph_0107"
                     /EC_number="1.5.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha"
                     /protein_id="YP_001695873.1"
                     /db_xref="GI:169825715"
                     /db_xref="GeneID:6024506"
                     /translation="MTERIINHPVLGALTQKEKVTFTYDDHLFEGYKGESLAAALLAQ
                     GIRTLRLHEETGQPRGIYCNIGHCFECRVNVNGLEGGRACLTPLSDGMAVKSGQTLPT
                     TVRDWRKNDEQ"
     misc_feature    complement(117507..117743)
                     /locus_tag="Bsph_0107"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_4; pfam13510"
                     /db_xref="CDD:205688"
     gene            complement(117791..118060)
                     /locus_tag="Bsph_0108"
                     /db_xref="GeneID:6024507"
     CDS             complement(117791..118060)
                     /locus_tag="Bsph_0108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695874.1"
                     /db_xref="GI:169825716"
                     /db_xref="GeneID:6024507"
                     /translation="MQNKSMIVCRCEEISYDELVESASKYKCSARELKLRTRAGMGYC
                     GGRTCRTMVDSIAHLHHPRKNDEVSLKHQAPIRPVRFSNLGEVKS"
     misc_feature    complement(117893..118045)
                     /locus_tag="Bsph_0108"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     pfam04324"
                     /db_xref="CDD:218027"
     gene            complement(118199..119884)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /db_xref="GeneID:6024508"
     CDS             complement(118199..119884)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma L-dependent transcriptional regulator"
                     /protein_id="YP_001695875.1"
                     /db_xref="GI:169825717"
                     /db_xref="GeneID:6024508"
                     /translation="MNKILKRNFAITSTDDIVSKINDASKQYFVIENHKPYGAVRGKR
                     KNDVHYVACHTIQLDCPLKNAIEYMKEYEFLLVCNEEKKYLGYLRRESLAYDLAYELE
                     CGNAYLQTILNTINESCTVINAEQNVVYWTKGAESIFSVSGENIIGKPITHFFKEDQL
                     EILHTLQHRKSVYQQQHFPREDLVVMINSNPVMLHNKTIGAVVAETDITHVKKLNEEL
                     HITSEKLLNLEKQMSTNGLAFDPFTLIRGNSPKLKEVLEKVKKVAETEANILIYGESG
                     VGKELFARAVHAIREKSEAPFVAINCGAIPSGLFESEIFGYEKGAFSGAHQKGKKGKV
                     ELARGGTLFLDEIGEMPLEMQVKILRLLQEKTFYTVGGTKEMDVEFNLVAATNRDLKQ
                     LVTEGKFREDLYYRLNVVNFTVPPLRERASDILEISNYFLYEKSIKYNRPIQGIPTEI
                     ANALLKYHWPGNVRELSNVIERLVVFSDEGAIHMEDLPTDILAVMPKDKAMDVKIDFP
                     LGTELNNQLEHYEREIILDQLAKVNGNKKTCAKNLGITRATLYNRLKKLNIDV"
     misc_feature    complement(119381..119569)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    complement(119258..119530)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:222120"
     misc_feature    complement(118217..119146)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    complement(118655..119086)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(119045..119068)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(118724..118726,118850..118852,
                     119042..119065))
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(118847..118864)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(118667..118669)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(118214..118336)
                     /gene="yqiR"
                     /locus_tag="Bsph_0109"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:202485"
     gene            120035..121240
                     /locus_tag="Bsph_0110"
                     /db_xref="GeneID:6024509"
     CDS             120035..121240
                     /locus_tag="Bsph_0110"
                     /EC_number="1.4.3.19"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine oxidase"
                     /protein_id="YP_001695876.1"
                     /db_xref="GI:169825718"
                     /db_xref="GeneID:6024509"
                     /translation="MNRKEEGDMKNSHHDIVIIGGGIIGGAIAYYCAKAGLDITVLEK
                     NELASGTSSRCDGNILAIDKDPGFDSQMSLVSQRLVHELNRELDMSFEYRNPGSILVC
                     ESELEMEAAQQWVNRQQEAGLDFTMLDREDLRNESKYFADDLYGGLECKTDSTVNPYM
                     LTFSMFHSAEKLGAKIKKHTEVKNIKKQPDDTFSLETNEGWITANKVINACGIWAPFI
                     GQMLSVDIPIKPRKGHILVASRQEPVGLRKVMEFGYLISKFGGERKVDADIEKYGVAL
                     VFEPTEAQNFLIGSSREFVGFDTKVNHDVAKMIARRAVRFYPKIADMSIIRTYAGLRP
                     WTEDHLPIICEVEEVPGFYIAAGHEGDGISLAAVTGKLIQELLQHKDSCIPTEPVHLS
                     RFQKGVLHE"
     misc_feature    120065..121225
                     /locus_tag="Bsph_0110"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    <120494..>120670
                     /locus_tag="Bsph_0110"
                     /note="Malate:quinone oxidoreductase (Mqo); Region: Mqo;
                     cl17341"
                     /db_xref="CDD:247895"
     gene            121237..122256
                     /locus_tag="Bsph_0111"
                     /db_xref="GeneID:6024510"
     CDS             121237..122256
                     /locus_tag="Bsph_0111"
                     /EC_number="5.1.1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="proline racemase"
                     /protein_id="YP_001695877.1"
                     /db_xref="GI:169825719"
                     /db_xref="GeneID:6024510"
                     /translation="MNFQKLFTTIDTHTGGNPTRSLISGMPKLEGKTMSEKMLFMQEN
                     YDWIRKFLMNEPRGHSVMSGVIITEPCQPEADFGVIYIETGGYLPMCGHDTIGVCTAL
                     IEANLIEVTTPFTNIKLDTPAGLIDVQIKVTDGVAKEVTFKNVPSFLLKTIEINDSEL
                     GVVECEIAYGGNFYGIIDARKINLDLAVDNSTKIINTAIRLRNAVNAVEDIVHPEYSF
                     IHGLTHIEFYTDPVNPLADLKNTVVVPPGGIDRSPCGTGTSAKIATLYLKNKLVLNES
                     FVYESIVGTMFKARVLEEVTISGLTAVIPEVTGSAWIMGMHRFFYNDQDPLKEGYLMI
                     PPMDH"
     misc_feature    121246..122238
                     /locus_tag="Bsph_0111"
                     /note="hydroxyproline-2-epimerase; Provisional; Region:
                     PRK13971"
                     /db_xref="CDD:184428"
     misc_feature    121264..122232
                     /locus_tag="Bsph_0111"
                     /note="Proline racemase; Region: Pro_racemase; pfam05544"
                     /db_xref="CDD:203272"
     gene            122269..123141
                     /locus_tag="Bsph_0112"
                     /db_xref="GeneID:6025195"
     CDS             122269..123141
                     /locus_tag="Bsph_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695878.1"
                     /db_xref="GI:169825720"
                     /db_xref="GeneID:6025195"
                     /translation="MNFHKSFQTIDTQVVGEAFRIIVQSPIMLMHEDILEADHQLNTQ
                     FEDTKQLLLNEPRGHRGMNGCLVLPSAIASYRLLFFQHAASTNFKYEALVATMTALIE
                     QGTIELSKNNTYSIETVKGVYEAYVKLSEKRDAVLSVHLILKPAQLEGEQVIIDNERR
                     YIVVEKPQQFKAIVLEELAEISTWGLLESEKYSTADGVIMYEQLNSSVRSVTFERDGY
                     ILRSPGVDSILALIAVLGEEAVRKNDSIFGSSIEIIQKHEAGYEVALTAYITGIHQFV
                     VDREDPLHHGFIIV"
     misc_feature    122281..123138
                     /locus_tag="Bsph_0112"
                     /note="hydroxyproline-2-epimerase; Provisional; Region:
                     PRK13971"
                     /db_xref="CDD:184428"
     misc_feature    122296..123129
                     /locus_tag="Bsph_0112"
                     /note="Proline racemase; Region: Pro_racemase; pfam05544"
                     /db_xref="CDD:203272"
     gene            123169..124071
                     /locus_tag="Bsph_0113"
                     /db_xref="GeneID:6025196"
     CDS             123169..124071
                     /locus_tag="Bsph_0113"
                     /EC_number="4.2.1.52"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="YP_001695879.1"
                     /db_xref="GI:169825721"
                     /db_xref="GeneID:6025196"
                     /translation="MKKLEGVFPVLVTPMKNQTDIDWDGYRQNIEHFIEAGVTGIAIN
                     GSTGEFVSLTKEERFKAVEVAVDQIKGRMTLIVGTAAETTAEAIIYTQQAEQAGADAA
                     LLINSYYAHPKDEEIYVHFKSVAESVKFPIMIYNNPFTSGVDIGLETILKVGRDVPNI
                     THIKESSGSIGKARDIVRQGQNDIEVFCGSEDLAIESLLVGAVGWISVSGNIVPELVT
                     KLYSQVKEGNLEAAWAIYDRLLPLCAFLEGSGKYVQITKRAMELKGWAGGPCRLPRLP
                     LTEEEDAQLKAIMTNLDVLAIEHY"
     misc_feature    123169..124056
                     /locus_tag="Bsph_0113"
                     /note="Dihydrodipicolinate synthase/N-acetylneuraminate
                     lyase [Amino acid transport and metabolism / Cell envelope
                     biogenesis, outer membrane]; Region: DapA; COG0329"
                     /db_xref="CDD:223406"
     misc_feature    123187..124035
                     /locus_tag="Bsph_0113"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(123196..123198,123292..123294,123301..123309,
                     123571..123573,123658..123660)
                     /locus_tag="Bsph_0113"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(123292..123294,123301..123309,123571..123573,
                     123658..123660,123784..123786)
                     /locus_tag="Bsph_0113"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(123304..123306,123319..123324,123415..123420,
                     123490..123495,123514..123516,123526..123528,
                     123982..123987)
                     /locus_tag="Bsph_0113"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    123658..123660
                     /locus_tag="Bsph_0113"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            124071..125573
                     /locus_tag="Bsph_0114"
                     /db_xref="GeneID:6025197"
     CDS             124071..125573
                     /locus_tag="Bsph_0114"
                     /EC_number="1.2.1.3"
                     /note="similar to mitochondrial Aldehyde dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="YP_001695880.1"
                     /db_xref="GI:169825722"
                     /db_xref="GeneID:6025197"
                     /translation="MEKGGRLMEAVLTLKPQIKEFLQSTIGLYIDGKYVQAQSGKTLN
                     VLNPANEEVIAVVSEAQAEDIDLAVHAAQQAFEGQWSMMEAAERSRIIYKLADLLEEH
                     REELAQLESLDNGKPYKAALADDVDGTVQHFRYYAGWATKITGQTVQVSKDYLNYIVH
                     EPVGVVGQIIPWNFPLAMAAWKLGAALAVGCTVVIKPAAETPLSLLYVGQLMKQAGFP
                     DGVVNIVPGTGEAGEAIVTHKGVAKVAFTGSTKTGIHVMKKAADDVKSITLELGGKSP
                     AIVLPDADVEEAIEGTFAGTMYNHGQNCSACTRVFVHSSLYNLFIERLAEKAKALKIG
                     SGLDPETDMGPLVSQKQLNTVLDYIEKGKEEGARIVAGGDRALEKGYFVQPTIFADVQ
                     DTMIIAQEEIFGPVMSILSFETVDEVIVRANNSKYGLAASIWTENVKKAHYIASKLQA
                     GTVWINDFGLEWETMPFGGYKQSGIGREMGGEYGLSNYTEVKSVFVNMKQ"
     misc_feature    124149..125552
                     /locus_tag="Bsph_0114"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:245815"
     misc_feature    124185..125552
                     /locus_tag="Bsph_0114"
                     /note="Aldehyde dehydrogenase family; Region: Aldedh;
                     pfam00171"
                     /db_xref="CDD:215767"
     misc_feature    order(124575..124589,124611..124613,124656..124658,
                     124662..124667,124806..124817,124824..124826,
                     124833..124838,124878..124886,124980..124982,
                     125271..125273,125277..125279,125355..125357,
                     125469..125471)
                     /locus_tag="Bsph_0114"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143395"
     misc_feature    order(124587..124589,124878..124880,124971..124973,
                     124980..124982)
                     /locus_tag="Bsph_0114"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143395"
     gene            complement(125643..126929)
                     /locus_tag="Bsph_0115"
                     /db_xref="GeneID:6025198"
     CDS             complement(125643..126929)
                     /locus_tag="Bsph_0115"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="YP_001695881.1"
                     /db_xref="GI:169825723"
                     /db_xref="GeneID:6025198"
                     /translation="MQLSIKQTQELQIVMSAQLRQAIELLQYSTQELEQYIREQELVN
                     PLIELSEPTFKEHLQISKTCGRHYNNWHLSTKCEKNIRDELFQQVRLTFDNEKDIQLL
                     KHIIYHLDDNGYYEQSIQSSYNDLEIEKGIHLLQTIGPLGIGARNLKECLLLQTIYGP
                     NSPAHADTIISNYLEELAHNNWKKISKELDISLNDLQIIYLFIQSLQPKLSSLFYQEL
                     VHTTIPDIIVDIVDGGITFSLNDYYLPKVSIHADYFPYIKAHSSEKSYFKKHLADYHW
                     LVNSIEQRRNTMINIMKALIEKQRKFFLDGLDAIQPLTLREIADQIDVHESTVSRITT
                     NKYVQTAFGTFELKELFSSKLSTANGHSVSQIKVKSLLSDYIKSENKAKPFSDQKIAE
                     YFNSALGIEISRRTIAKYREDMSIPSSARRKIIPFK"
     misc_feature    complement(125661..126929)
                     /locus_tag="Bsph_0115"
                     /note="RNA polymerase factor sigma-54; Reviewed; Region:
                     PRK05932"
                     /db_xref="CDD:235648"
     misc_feature    complement(126777..126923)
                     /locus_tag="Bsph_0115"
                     /note="Sigma-54 factor, Activator interacting domain
                     (AID); Region: Sigma54_AID; pfam00309"
                     /db_xref="CDD:215850"
     misc_feature    complement(126168..126698)
                     /locus_tag="Bsph_0115"
                     /note="Sigma-54 factor, core binding domain; Region:
                     Sigma54_CBD; pfam04963"
                     /db_xref="CDD:218353"
     misc_feature    complement(125661..126140)
                     /locus_tag="Bsph_0115"
                     /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
                     pfam04552"
                     /db_xref="CDD:218144"
     gene            complement(127111..128175)
                     /locus_tag="Bsph_0116"
                     /db_xref="GeneID:6025199"
     CDS             complement(127111..128175)
                     /locus_tag="Bsph_0116"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="YP_001695882.1"
                     /db_xref="GI:169825724"
                     /db_xref="GeneID:6025199"
                     /translation="MSKLEQLRNALQAQGTSAIIITNAQNRRYLTGFTGSAGTVIVTN
                     TRALLLVDFRYTQQATEQSKTFEVHEIDRNRLYEMIQEILDQESIQSVGFEQHHVTYY
                     TYQLMANKLTATLKPLSTIVENLRMIKTPEEIEIIKKAAWISDEAFKHILTFIKPGLS
                     EIEIANELESHMRKNGATGAAFDMIVASGHRSALPHGVASSKVIEQGDMLTLDFGAYY
                     QGYRSDMTRTIAVGEPPEQLKEIYQIVYDSLQHALSNMKAGITGQNADSYTRDYITAK
                     GYGDNYGHGAGHGIGLDIHEDIFMSTVCEDVLEENMVLTVEPGIYLPQVGGVRIEDDV
                     IITKDGVEVITHSPKELIIL"
     misc_feature    complement(127114..128175)
                     /locus_tag="Bsph_0116"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    complement(127792..128169)
                     /locus_tag="Bsph_0116"
                     /note="Creatinase/Prolidase N-terminal domain; Region:
                     Creatinase_N; pfam01321"
                     /db_xref="CDD:216431"
     misc_feature    complement(127156..127764)
                     /locus_tag="Bsph_0116"
                     /note="Similar to Prolidase and Aminopeptidase P. The
                     members of this subfamily presumably catalyse hydrolysis
                     of Xaa-Pro dipeptides and/or release of any N-terminal
                     amino acid, including proline, that is linked with
                     proline; Region: APP-like; cd01092"
                     /db_xref="CDD:238525"
     misc_feature    complement(order(127183..127185,127225..127227,
                     127312..127314,127504..127506,127537..127539,
                     127588..127590))
                     /locus_tag="Bsph_0116"
                     /note="active site"
                     /db_xref="CDD:238525"
     gene            128314..129990
                     /gene="dppE"
                     /locus_tag="Bsph_0117"
                     /db_xref="GeneID:6025353"
     CDS             128314..129990
                     /gene="dppE"
                     /locus_tag="Bsph_0117"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide-binding protein dppE"
                     /protein_id="YP_001695883.1"
                     /db_xref="GI:169825725"
                     /db_xref="GeneID:6025353"
                     /translation="MAKKTKWLFVLLGLMLVILVGCYGKPTSGNTAKSNESDNATADG
                     DDNIATQELHLVATGDLTTMSSLGSVDALAVTAMNSVFEGLYRIGPENTPIPGMAESH
                     EVSEDGTVYTFKIRKDAVWSNGSPVTAYDFEYAWKRAINPETQAIYSYLMLDIKNAAN
                     VQTEEDPLYGKVEEIGIKALNDDTLEVQLNAPIPYFISLTTYAPFFPLNKEFTESQGD
                     QYALEADNMIYNGPFMMESWQHGQGWTFVKNESYWDKDTVKLTKITQKIVKDTATAVN
                     LYEAGEIDTAELSSEYVAQYKDSPEYSTFLKPNTYFIRMNHENKYLSNLNIRKAIDMA
                     WDKQGFADVILQDGSIPAYYLVPQGLSTDDKGNDFRDGNGDMNKTDIELAKEAWATGL
                     KELGVDQVKLEFLTYDRAESKKAAEFIKNQLETNLEGLELTINMQPNKQKLALEGAVD
                     FDLDYGGWGPDYQDPMTYIELFESTAYYNQSNYKNEKVDAFIKQAKTTSDVTERWELM
                     QQAEKLMMEDVAFAPTFQKGLSRLTKPYVKNLYEHPFSADISYKWVEIVK"
     misc_feature    128464..129975
                     /gene="dppE"
                     /locus_tag="Bsph_0117"
                     /note="The substrate-binding component of an ABC-type
                     oligopetide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_OppA; cd08504"
                     /db_xref="CDD:173869"
     misc_feature    order(128536..128538,129172..129174,129232..129234,
                     129628..129630,129676..129678,129682..129696,
                     129892..129894)
                     /gene="dppE"
                     /locus_tag="Bsph_0117"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173869"
     misc_feature    128590..129753
                     /gene="dppE"
                     /locus_tag="Bsph_0117"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 5 Middle; Region: SBP_bac_5; pfam00496"
                     /db_xref="CDD:215949"
     gene            complement(130031..130237)
                     /locus_tag="Bsph_0119"
                     /db_xref="GeneID:6025354"
     CDS             complement(130031..130237)
                     /locus_tag="Bsph_0119"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695884.1"
                     /db_xref="GI:169825726"
                     /db_xref="GeneID:6025354"
                     /translation="MQGGLFNGITYSFKRFFARVTKNGVYAFELDGDLEFVHAPSCNF
                     TYPLLLAGIIGCSTTAILSIVFYL"
     gene            130209..130322
                     /locus_tag="Bsph_0118"
                     /db_xref="GeneID:6025355"
     CDS             130209..130322
                     /locus_tag="Bsph_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695885.1"
                     /db_xref="GI:169825727"
                     /db_xref="GeneID:6025355"
                     /translation="MIPLKSPPCTTTNEAPVIVEVSDTRKILLINVKKVIG"
     gene            complement(130393..132384)
                     /locus_tag="Bsph_0120"
                     /db_xref="GeneID:6025356"
     CDS             complement(130393..132384)
                     /locus_tag="Bsph_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001695886.1"
                     /db_xref="GI:169825728"
                     /db_xref="GeneID:6025356"
                     /translation="MKKILEVKNLSVSFNTYNGEVQAVRNISFDLFEGEILAVVGESG
                     SGKSVTSKSLLRLNPTESTMVKSGHIFYNGHDILSSSEQEIRAIRGAEIAMIFQDPMT
                     ALNPTMTIGHQIAESIKKHTTLRGKQITNRVIELLQLVGIKEADKRYKQYPHQFSGGM
                     RQRIVIAMALACEPRIIIADEPTTALDVSIQAQILELLKNIQQNMNLSIIFITHDLGV
                     VAKMANRVAVMYAGKIIEIGLVDEIFYHCQHPYTQGLLAAMPNPDMGTNSLYAIPGTP
                     PNLLHPPTGDAFAARNKHALKIDFIEEPPMFQVSDTHFAATWLLHKHAPKIVPVHQHL
                     AQVQQEKRNASAILDKEHPYLSLKEVKQHFSLGKNSVNKAVDGITFDIYKGEIFGLVG
                     ESGCGKSTTGRSIIGLHSITSGEILVDGRNINDNQTKKDKLTFNSKVQMIFQDPYSSL
                     NPRMKIMDIIAEGLAIHEVPKSEWKPKIYELLNIVGLTKEYANRYPHELSGGQRQRIG
                     IARALAVEPELIIADEPISALDVSIQAQIVNLLKQLQKERGLTYLFIAHDLSMVKYIS
                     DRIGVMYQGKIVELANSQELYDYPVHPYTKSLLSAIPLPDPKLERDRKRIIFNEVTYQ
                     ANRNTESESFVEIRPGHFVMLTEEELIHYRSAQEGGILL"
     misc_feature    complement(130456..132381)
                     /locus_tag="Bsph_0120"
                     /note="glutathione transporter ATP-binding protein;
                     Provisional; Region: PRK10261"
                     /db_xref="CDD:182342"
     misc_feature    complement(131671..132375)
                     /locus_tag="Bsph_0120"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(132241..132264)
                     /locus_tag="Bsph_0120"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(131743..131745,131842..131847,
                     132091..132093,132238..132246,132250..132255))
                     /locus_tag="Bsph_0120"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(132091..132102)
                     /locus_tag="Bsph_0120"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131890..131919)
                     /locus_tag="Bsph_0120"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131842..131859)
                     /locus_tag="Bsph_0120"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131824..131835)
                     /locus_tag="Bsph_0120"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131737..131757)
                     /locus_tag="Bsph_0120"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131428..131688)
                     /locus_tag="Bsph_0120"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:244611"
     misc_feature    complement(130642..131322)
                     /locus_tag="Bsph_0120"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(131188..131211)
                     /locus_tag="Bsph_0120"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(130714..130716,130813..130818,
                     131053..131055,131185..131193,131197..131202))
                     /locus_tag="Bsph_0120"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(131053..131064)
                     /locus_tag="Bsph_0120"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(130861..130890)
                     /locus_tag="Bsph_0120"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(130813..130830)
                     /locus_tag="Bsph_0120"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(130795..130806)
                     /locus_tag="Bsph_0120"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(130708..130728)
                     /locus_tag="Bsph_0120"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<130537..130659)
                     /locus_tag="Bsph_0120"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:244611"
     gene            complement(132398..133429)
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /db_xref="GeneID:6025357"
     CDS             complement(132398..133429)
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="YP_001695887.1"
                     /db_xref="GI:169825729"
                     /db_xref="GeneID:6025357"
                     /translation="MTSKLTDSTTKSHPKELFEYAPETDITDDFTYRPEQSFWQDAWR
                     GLRKNKAAIIGLCTIIVVLLLAIFGPFMNSHGYDEQNIARTNLPPKIPILENISFLGL
                     NGVDSRGIDQYEAKGIGEYFWFGTDELGRDLWTRIWEGTRISLYIAFLAATIDLIIGV
                     AYGAVSAFYGGRADNIMQRIIEVLVGIPGLIVNILLILILKPGIISITIAMVIVGWIS
                     MARIVRAQILKLKSYEYVLASRTLGASNQRLIWKHLIPNTLGPIIVATTFTIPGAIFT
                     EALLSFIGLGLQPPTASLGTIVNDSYKLLRIYPHGMIISSIVISLIMISFNLLGDGLR
                     DAFDPKTRK"
     misc_feature    complement(132401..133342)
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(133160..133324)
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:221848"
     misc_feature    complement(132506..133006)
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(132506..132511,132539..132544,
                     132584..132589,132596..132607,132626..132628,
                     132635..132640,132680..132682,132731..132733,
                     132740..132745,132755..132757,132761..132766,
                     132773..132775,132779..132781,132785..132790,
                     132839..132841,132845..132850,132857..132886,
                     132890..132901,132929..132931,132944..132949,
                     132956..132961))
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(132590..132607,132839..132883))
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(132509..132511,132539..132541,
                     132548..132550,132587..132589,132839..132841))
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(132659..132661,132671..132676,
                     132692..132730))
                     /gene="dppC"
                     /locus_tag="Bsph_0121"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(133426..134322)
                     /locus_tag="Bsph_0122"
                     /db_xref="GeneID:6021566"
     CDS             complement(133426..134322)
                     /locus_tag="Bsph_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide ABC transporter permease"
                     /protein_id="YP_001695888.1"
                     /db_xref="GI:169825730"
                     /db_xref="GeneID:6021566"
                     /translation="MIITLFIIILLSFLLMKALPGSPFNDERLPETQKELLYKKYGLD
                     KPVPVQFGIYLTNLVQGDLGVSFVFDNRPVTKIIKERIGASAILGFQAIIVGTIIGLL
                     LGIIAALRHNTIIDYSATILAVLGISIPSFVFAGFLQYWVGVKLGWLPIAFWNGFEYS
                     ILPTIALAVGVVATIARFTRMEMLEVLSQEYILTSKAKGLSKPIIITKHGIRNAMIPI
                     VTIIGPLTVNTITGSLVIEKIFSIPGLGEQFVNSIITNDYQLIMGTTIFYAVLFVTIV
                     LIIDILYGLIDPRIRVTGGDNT"
     misc_feature    complement(133447..134277)
                     /locus_tag="Bsph_0122"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(133480..133995)
                     /locus_tag="Bsph_0122"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133480..133485,133492..133497,
                     133504..133509,133513..133518,133525..133530,
                     133558..133563,133609..133614,133621..133632,
                     133651..133653,133660..133665,133705..133707,
                     133756..133758,133765..133770,133780..133782,
                     133786..133791,133798..133800,133804..133806,
                     133810..133815,133906..133908,133912..133917,
                     133924..133953,133957..133968))
                     /locus_tag="Bsph_0122"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133615..133632,133906..133950))
                     /locus_tag="Bsph_0122"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133528..133530,133558..133560,
                     133567..133569,133612..133614,133828..133830,
                     133906..133908))
                     /locus_tag="Bsph_0122"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(133684..133686,133696..133701,
                     133717..133755))
                     /locus_tag="Bsph_0122"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            134505..134580
                     /locus_tag="Bsph_tRNA9"
                     /db_xref="GeneID:6021567"
     tRNA            134505..134580
                     /locus_tag="Bsph_tRNA9"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:6021567"
     gene            135052..135390
                     /locus_tag="Bsph_0123"
                     /db_xref="GeneID:6021568"
     CDS             135052..135390
                     /locus_tag="Bsph_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695889.1"
                     /db_xref="GI:169825731"
                     /db_xref="GeneID:6021568"
                     /translation="MSKDQFLKYFYLPLLIGSMLMMVGCGDPIIEIEEANTYHWQKNM
                     NEVEFEKLKNDMSYIEVVETAGGAGKKVKNNEYRWNDETLLTQAYIVKFKDDKLIAKE
                     IVAVKGHSNR"
     gene            135665..136114
                     /gene="ydiB"
                     /locus_tag="Bsph_0124"
                     /db_xref="GeneID:6021569"
     CDS             135665..136114
                     /gene="ydiB"
                     /locus_tag="Bsph_0124"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_001695890.1"
                     /db_xref="GI:169825732"
                     /db_xref="GeneID:6021569"
                     /translation="MYEIIMNSLDDTERFASKLANKLEAQDTITLEGDLGAGKTTFTK
                     ALAKELGVKRTVNSPTFTIIKQYEGRLPFNHLDVYRLAESDEDLGWDELFYGDAVSVV
                     EWAHLIEQDLPQDRLAIEIYRIGENERRFVLIPRGERYEALCEELMK"
     misc_feature    135671..136105
                     /gene="ydiB"
                     /locus_tag="Bsph_0124"
                     /note="Predicted ATPase or kinase [General function
                     prediction only]; Region: COG0802"
                     /db_xref="CDD:223873"
     gene            136111..136818
                     /gene="ydiC"
                     /locus_tag="Bsph_0125"
                     /db_xref="GeneID:6024511"
     CDS             136111..136818
                     /gene="ydiC"
                     /locus_tag="Bsph_0125"
                     /codon_start=1
                     /transl_table=11
                     /product="YdiC"
                     /protein_id="YP_001695891.1"
                     /db_xref="GI:169825733"
                     /db_xref="GeneID:6024511"
                     /translation="MIWFGIETANTPLSIAVIKDGKIVAEMVQNIKLTHSAGAMPAIE
                     EILARIDVKPNDLDAIAVSEGPGSYTGVRIGVTLAKTLAWTLQKPLVGVSSLKALAAN
                     AALYNGLVCPIFDARRRNVYTAVYQGETLEALVEDHHAHIDDVLVRLKALEQPILFVG
                     TDVDIFWENIVQMLGDYAVRAPFSIDLPRATEVIHIATKMELPSVEATHHFVPQYKRI
                     AEAEANWLKEQKEKEHD"
     misc_feature    136126..136755
                     /gene="ydiC"
                     /locus_tag="Bsph_0125"
                     /note="tRNA threonylcarbamoyl adenosine modification
                     protein YeaZ; Region: T6A_YeaZ; TIGR03725"
                     /db_xref="CDD:234332"
     misc_feature    136213..>136548
                     /gene="ydiC"
                     /locus_tag="Bsph_0125"
                     /note="Glycoprotease family; Region: Peptidase_M22;
                     pfam00814"
                     /db_xref="CDD:216132"
     gene            136838..137263
                     /locus_tag="Bsph_0126"
                     /db_xref="GeneID:6024512"
     CDS             136838..137263
                     /locus_tag="Bsph_0126"
                     /EC_number="2.3.1.128"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein (S18)-alanine
                     acetyltransferase"
                     /protein_id="YP_001695892.1"
                     /db_xref="GI:169825734"
                     /db_xref="GeneID:6024512"
                     /translation="MVSDDVPAVYEIELASFPVPWTLDSFYYEVHENQYAHYVLALDE
                     NGSIIGFCGMWMVIDAAQITNVAVIEQARGRGIGEGLMREAMHIARLHGMEVMTLEVR
                     VTNTVAQNLYRKLHFQDGGIRKGYYTDNGEDALVMWVNL"
     misc_feature    136850..137248
                     /locus_tag="Bsph_0126"
                     /note="ribosomal-protein-alanine acetyltransferase;
                     Region: rimI; TIGR01575"
                     /db_xref="CDD:233477"
     misc_feature    136952..137137
                     /locus_tag="Bsph_0126"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(137033..137041,137069..137074)
                     /locus_tag="Bsph_0126"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            137263..138279
                     /locus_tag="Bsph_0127"
                     /db_xref="GeneID:6024513"
     CDS             137263..138279
                     /locus_tag="Bsph_0127"
                     /EC_number="3.4.24.57"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="YP_001695893.1"
                     /db_xref="GI:169825735"
                     /db_xref="GeneID:6024513"
                     /translation="MNNGLILAIESSCDETAAAIIRNGHEIVSNVVASQIESHKRFGG
                     VVPEIASRHHVEQITVVIEEALAQANIKPADLDAVAVTEGPGLVGALLIGINAAKAFA
                     FANNLPIIGVHHIAGHIYANALVQPMEFPLLALVVSGGHTELVYMKEHGSFEVIGETR
                     DDAAGEAYDKVARVLNLPYPGGPRIDQLAHEGEEAVPFPRVWLEEGSYDFSFSGLKSA
                     VINYKHNMDQRGEAISPAGVAKGFQESVVEVLTAKTLRAAREYQVKQVIAAGGVAANK
                     GLRASLEAVFTEEGIPFFVPPLKLCTDNAAMIGAVAMPMYEAGIRGNLTMNGRPGMEL
                     KSWV"
     misc_feature    137275..138270
                     /locus_tag="Bsph_0127"
                     /note="UGMP family protein; Validated; Region: PRK09604"
                     /db_xref="CDD:236585"
     misc_feature    137278..>137598
                     /locus_tag="Bsph_0127"
                     /note="tRNA threonylcarbamoyl adenosine modification
                     protein YeaZ; Region: T6A_YeaZ; TIGR03725"
                     /db_xref="CDD:234332"
     gene            complement(138725..140668)
                     /locus_tag="Bsph_0128"
                     /db_xref="GeneID:6024514"
     CDS             complement(138725..140668)
                     /locus_tag="Bsph_0128"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001695894.1"
                     /db_xref="GI:169825736"
                     /db_xref="GeneID:6024514"
                     /translation="MIVLQVNQLTKSFLADEILSGVKLEVQHRDRVALVGRNGAGKST
                     LLKIIAGQMSYDSGDIIIPKGIQVGYLEQHAGLNSTLTIWDEMMTIFEPLLAQEQTLR
                     SLEQQMADSTVYENPTLYAKVMSEYDQLQHTFKDAGGYQYESDMRSVLHGMQFYPEDY
                     DKPISSLSGGQRTRLALAKLLLSKPDLLILDEPTNHLDIETLSWLESYLKSYEGAILI
                     VSHDRYFLDQVVSIVYEVSRHRVTKYTGNYSAYLDVKAKNYERDVKLFERQQDEKAKL
                     EDFIQKNIARASTTKMAQSRRKMLERTEWMESPDGDEKSASFGFTIERQSGNDVLSVD
                     DLTIGYGDQRISSGIKLRTFREDRIALVGPNGVGKSTLLKTIVKDLTPLAGDIRYGTN
                     VQIGYYDQEQAKLSSNKSVSKELWDEWPLMNEKDIRTVLGRFLFSGEDVDKVVSSLSG
                     GEKARLALSKLMMQKAHFVILDEPTNHLDLDSKEVLENALIDYPGTLLFVSHDRYFIN
                     RIATKVVELSGTGSFEYLGDYDYYVEKKQELFELAQMKSASQPQLQQALPDKTSTSKI
                     DKEAKKRERQIRRAIEELEGKMQETTTIIDRLEEALCDPAIFTDHEKIAQLQGELATA
                     KEKHELLELEWLELNEELEHINM"
     misc_feature    complement(139055..140668)
                     /locus_tag="Bsph_0128"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    complement(<140450..140659)
                     /locus_tag="Bsph_0128"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(139949..>140170)
                     /locus_tag="Bsph_0128"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(139715..139969)
                     /locus_tag="Bsph_0128"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:221805"
     misc_feature    complement(139106..139678)
                     /locus_tag="Bsph_0128"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            140922..141557
                     /locus_tag="Bsph_0129"
                     /db_xref="GeneID:6024515"
     CDS             140922..141557
                     /locus_tag="Bsph_0129"
                     /note="modulates transcription in response to the
                     NADH/NAD(+) redox state"
                     /codon_start=1
                     /transl_table=11
                     /product="redox-sensing transcriptional repressor Rex"
                     /protein_id="YP_001695895.1"
                     /db_xref="GI:169825737"
                     /db_xref="GeneID:6024515"
                     /translation="MKQELKIPQATTKRLPLYYRFIQNFAQEGMERISSKELSEAMKI
                     DSATIRRDFSYFGALGKKGYGYDVQHLLQFFSQTLDQHETTKVALIGVGNLGSALLKY
                     NFQKNHNTHIVVAFDSKAPKDGKMISNIPVFHPDLLEEKYAEYGAELAILTVSPRSAQ
                     KMADRLAAMNAKGILNFTPERLTVPDSMQLLTIDLSVELQALIYLIRNQEV"
     misc_feature    140922..141551
                     /locus_tag="Bsph_0129"
                     /note="redox-sensing transcriptional repressor Rex;
                     Provisional; Region: PRK05472"
                     /db_xref="CDD:235486"
     misc_feature    140937..141083
                     /locus_tag="Bsph_0129"
                     /note="Putative DNA-binding protein N-terminus; Region:
                     Put_DNA-bind_N; pfam06971"
                     /db_xref="CDD:219246"
     misc_feature    141165..141458
                     /locus_tag="Bsph_0129"
                     /note="CoA binding domain; Region: CoA_binding; pfam02629"
                     /db_xref="CDD:202320"
     gene            141714..141908
                     /locus_tag="Bsph_0130"
                     /db_xref="GeneID:6025107"
     CDS             141714..141908
                     /locus_tag="Bsph_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent protein translocase"
                     /protein_id="YP_001695896.1"
                     /db_xref="GI:169825738"
                     /db_xref="GeneID:6025107"
                     /translation="MAVMGGIGPMSLIIIGIVALLIFGPKKLPELGKAFGSTLREFKN
                     ATKGLADEDDDDKKKKELDK"
     misc_feature    141723..>141863
                     /locus_tag="Bsph_0130"
                     /note="twin arginine translocase protein A; Provisional;
                     Region: tatA; PRK14861"
                     /db_xref="CDD:237837"
     gene            141926..142750
                     /locus_tag="Bsph_0131"
                     /db_xref="GeneID:6025108"
     CDS             141926..142750
                     /locus_tag="Bsph_0131"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase tatCy"
                     /protein_id="YP_001695897.1"
                     /db_xref="GI:169825739"
                     /db_xref="GeneID:6025108"
                     /translation="MNPKDLTVIEHIEELRKRLFIVAVFFVLAMAGAFFVAKPLVKYL
                     QTTGAKYNIELHAFDVVTPLAIYIQVVFLIAFILSSPVLMYQLWSFISPGLREVERRA
                     TLSYIPYSFLLFIAGLSFSYFLLFPYVIKFMMNLSNDLDIQQTIGIHEYFTFLFKLTI
                     PFGFLFQLPIVVLFFSRIGILSPDLLIRIRKYSYFGLFVCAALIAPPELASHLMVSVP
                     LFILYEISIMISRVGYRKYLKSEEIRLKEEQEAEQKRQIEEALEQQRRQIEELNNQ"
     misc_feature    141926..142633
                     /locus_tag="Bsph_0131"
                     /note="Sec-independent protein secretion pathway component
                     TatC [Intracellular trafficking and secretion]; Region:
                     TatC; COG0805"
                     /db_xref="CDD:223876"
     misc_feature    <142628..142741
                     /locus_tag="Bsph_0131"
                     /note="DNA-binding domain; Region: DBINO; pfam13892"
                     /db_xref="CDD:206063"
     gene            complement(142826..143455)
                     /locus_tag="Bsph_0132"
                     /db_xref="GeneID:6025109"
     CDS             complement(142826..143455)
                     /locus_tag="Bsph_0132"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family"
                     /protein_id="YP_001695898.1"
                     /db_xref="GI:169825740"
                     /db_xref="GeneID:6025109"
                     /translation="MKMTDLTSEQAAPITQGWYIALSFAIALILSLILTSRDKTFWNV
                     YQGKKETIPLTIIWGILGFILVFFGQMIGAAIEMAVFGIEGGSQNTADIVAIAKGAPI
                     AILAIVVFGPILEEFVFRRVIFGSLVQTTNFWVAAIVSAIFFAIIHFDFSHILLYTIC
                     GLIFAFLYHKTKRIWTSIIAHVMLNGFVTLVQFYAEPLQKFLQELEKMQ"
     misc_feature    complement(142895..143155)
                     /locus_tag="Bsph_0132"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:217080"
     gene            144172..145806
                     /locus_tag="Bsph_0133"
                     /db_xref="GeneID:6025110"
     CDS             144172..145806
                     /locus_tag="Bsph_0133"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="YP_001695899.1"
                     /db_xref="GI:169825741"
                     /db_xref="GeneID:6025110"
                     /translation="MAKDIKFSEDARSLMLQGVDKLANAVKITLGPKGRNVVLEKKFG
                     SPLITNDGVTIAKEIELENPYENMGAKLVAEVASKTNEIAGDGTTTATVLAQAIIREG
                     LKNVTAGANPVGIRKGIDKAVAAALTELHTISRPVSNKDEIAQVAAISAADDEVGQLI
                     AEAMERVGNDGVITIEESKGFTTELDVVEGMQFDRGYASHYMVTDTDKMEAVLDNPYI
                     LITDKKITNIQEVLPLLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKA
                     PGFGDRRKAMLEDIAILTGGQVITEELGLDLKSADISSLGRAAKVVVTKDNTTIVEGV
                     GGADAIEARIGQIRAQLAETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKL
                     RIEDALNSTRAAVEEGIVSGGGTALLNVYAAVEKVSESEEGDVATGVKIVLRALEEPV
                     RQIANNAGLEGSIIVDRLKREEIGIGFNAATGEWVNMMEAGVVDPAKVTRSALQNAAS
                     VAALFLTTEAVVADIPEPAGAGMPDMSGMGGMPGMM"
     misc_feature    144172..145746
                     /locus_tag="Bsph_0133"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12849"
                     /db_xref="CDD:237230"
     misc_feature    144178..145737
                     /locus_tag="Bsph_0133"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    order(144178..144180,144190..144192,144241..144243,
                     144274..144285,144289..144291,144304..144309,
                     144313..144315,144343..144345,144349..144351,
                     144373..144375,144385..144387,144394..144396,
                     144754..144756,144850..144852,144934..144936,
                     145315..145317,145321..145323,145543..145545,
                     145705..145707,145714..145734)
                     /locus_tag="Bsph_0133"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(144259..144267,144427..144429,144439..144441,
                     144616..144618,145357..145359,145408..145410,
                     145528..145530,145645..145647,145651..145653)
                     /locus_tag="Bsph_0133"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(144493..144495,145468..145470,145522..145524,
                     145549..145551,145555..145560,145567..145569)
                     /locus_tag="Bsph_0133"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(144589..144591,144721..144723,144742..144744,
                     145288..145290,145390..145395)
                     /locus_tag="Bsph_0133"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            146151..147092
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /db_xref="GeneID:6025111"
     CDS             146151..147092
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="YP_001695900.1"
                     /db_xref="GI:169825742"
                     /db_xref="GeneID:6025111"
                     /translation="MDILLHAVSNGRFGTLDSVDSESYLNIILQVRMPRVIFALLIGI
                     GLALCGAVMQAVVQNPLADPYILGISSGASLGATFAILVGFGSSALLAQFGVAFGAFA
                     GAMLTSMAVLILSSIGGKATSVKLVLSGVVIGALCSSFSSLIIFFANNAEGIKTVTFW
                     SMGSLASASWDKTPILAIVIVLGAALFLFQHRVLNTMLLGDESAITLGINLSVYRKLY
                     MILTSLITGTMVAYAGMIGFVGLIIPHITRGIFGADHKRLMLGTLLLGGLFMIWADIL
                     SRTLIENVELPIGIITSVIGSPLFIYMIVKKGYNFGG"
     misc_feature    <146157..147074
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /note="iron-hydroxamate transporter permease subunit;
                     Provisional; Region: PRK10577"
                     /db_xref="CDD:236720"
     misc_feature    146304..147062
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(146310..146312,146322..146330,146712..146717,
                     146721..146729,146733..146738,146742..146759,
                     146763..146771,146892..146894,146913..146915)
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(146325..146327,146331..146333,146346..146348,
                     146523..146525,146529..146534,146541..146546,
                     146553..146558,146565..146567,146574..146579,
                     146583..146585,146622..146627,146634..146636,
                     146862..146864,147018..147020,147027..147032,
                     147039..147041,147048..147053,147060..147062)
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(146583..146585,146664..146666,146838..146840,
                     146850..146852,146982..146984,147009..147011)
                     /gene="fecD"
                     /locus_tag="Bsph_0134"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            147097..147858
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /db_xref="GeneID:6021632"
     CDS             147097..147858
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /EC_number="3.6.3.34"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin transport system ATP-binding protein fecE"
                     /protein_id="YP_001695901.1"
                     /db_xref="GI:169825743"
                     /db_xref="GeneID:6021632"
                     /translation="MELVAKEIEVKIGKKEIVKNISIHVNKQQFVGLIGPNGCGKSTL
                     LKSIYKSLVPQKGMVFLDDLDVLKSPEKKISQHLGVVGQFNEMHFDLTVQQMVMLGRT
                     PHKKMLESDNQKDFDIVEEALTRTNLQAYKGRSFLSLSGGEKQRVILARTIAQQPKFM
                     ILDEPTNHLDIRYQIEILSCVRSLNIGVLAALHDLEMAAHYCDYLYAVKDGEIYAHGT
                     PEQVLTPEIIEALYHIKCQTFTNPVTNGLGFAYGL"
     misc_feature    147154..147786
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    147154..147747
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    147199..147222
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(147208..147213,147217..147225,147343..147345,
                     147583..147588,147673..147675)
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    147334..147345
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    147511..147540
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    147571..147588
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    147595..147606
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    147661..147681
                     /gene="fecE"
                     /locus_tag="Bsph_0135"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            147872..148882
                     /locus_tag="Bsph_0136"
                     /db_xref="GeneID:6021633"
     CDS             147872..148882
                     /locus_tag="Bsph_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_001695902.1"
                     /db_xref="GI:169825744"
                     /db_xref="GeneID:6021633"
                     /translation="MKKKLLLGIGLAAVLTLTACGNTTKNTSEEAQTKEHYPLTIENF
                     TKAEGGSTWEKKDQVFDKAPEKIMANTRPAAELLLHLGLGDKIVGVGANFGAVDKSVE
                     EAYSKLNILSDEYVGKEVTLGTNPDLVFGRGGLFDNAEWGVGTVDSLNDMGIKTFVLE
                     SSITGGTYDSIYKDIENIGEIFNVQDKATSFIKELKDRQQDITSKLESIKEEKSFAYL
                     HTNDPKELFVYPAHDETFFNDAFKMVKLDNIFKDETGDVSVETLIASDPDVLILPNWD
                     GSDLTKVREEIYANPKLSSMKAIKNKQIYIVDYNYMFGYGYNTIDGMEALAKEMYPDL
                     FK"
     misc_feature    147980..148852
                     /locus_tag="Bsph_0136"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:241735"
     misc_feature    148094..148804
                     /locus_tag="Bsph_0136"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:216532"
     misc_feature    order(148310..148315,148322..148324,148409..148411)
                     /locus_tag="Bsph_0136"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            complement(148982..149638)
                     /locus_tag="Bsph_0137"
                     /db_xref="GeneID:6021634"
     CDS             complement(148982..149638)
                     /locus_tag="Bsph_0137"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheinyl transferase"
                     /protein_id="YP_001695903.1"
                     /db_xref="GI:169825745"
                     /db_xref="GeneID:6021634"
                     /translation="MSTNDIQLFALPLGEPLTSAEWNVFHNVLPSHVQRNIQQYKQWQ
                     DRQRALLGNTLIRWVLLPFMDKTTFQITQDIYGRPNVASHQHWKGDFNLSHSGDWIVL
                     ALTTNGRVGIDVEEIKPVNKDIMHFALSKQEFHMALHQPLHVFYELWTLKEALFKTGL
                     FPHLSPHMLDTIDIKKTRADLSTQLHYLDQRHPVTICWNNGSTHVKITTLNKHQLLQS
                     "
     misc_feature    complement(<149168..149539)
                     /locus_tag="Bsph_0137"
                     /note="Phosphopantetheinyl transferase [Coenzyme
                     metabolism]; Region: Sfp; COG2091"
                     /db_xref="CDD:225002"
     misc_feature    complement(149024..149314)
                     /locus_tag="Bsph_0137"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; pfam01648"
                     /db_xref="CDD:216625"
     gene            complement(149635..152802)
                     /locus_tag="Bsph_0138"
                     /db_xref="GeneID:6021635"
     CDS             complement(149635..152802)
                     /locus_tag="Bsph_0138"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="YP_001695904.1"
                     /db_xref="GI:169825746"
                     /db_xref="GeneID:6021635"
                     /translation="MNNKREFDCPTSQFNKHFSKQEKLLSNHTQLLNEEDTLAYQTLN
                     RTMADYDKTITIPEVFYQVAQQFADRIALSYEDGKMTYRQLNEQSNQVAHMLLANGLQ
                     KGDYVAIIMDRSKETIISLLGVLKAGGVYVPIDPSYPKERCQYLLHDTGAPFIITKNE
                     YSDLLNDLIHNKFQSHTVLTINQMESGLSKEDLPCNLHPSDLAYIIYTSGSTGKPKGV
                     LLKHTAVINLITDNQRIYHSTEEGVFSQFISYSFDPSVTETFTAFFSGARLHMLTSIE
                     RLSIEAFADMIARERVTTATVPNAFFTQLATHLPVEYRDKLMTLQYLSVGGEALLPAI
                     VQKWQEKFGYSTEIINVYGPTECTVLTSYFKIKSQLTDMQSSIPIGKPIANYEMYVVN
                     EDEQLCPVHVTGELCIAGVGLAAGYLHQPEKTAEVFVPHLFKPDQKMYRTGDLVRLLP
                     NGVIEFVGRKDSQIKVRGFRIELGEIETVLSNYPTIQESVVIAKKMSDGQNHLFAYYT
                     VASGIQLEERNLRDYLHNLLPDYMVPERFIELLEMPLSPTGKIDRTQLASMDTHLSRS
                     NLYVAPENDTQHLLANAWEYVLNVSPIGIHDNFFHIGGHSLKVLEILVQVKKHIPFLK
                     IQDFFQYQTIAELDQYICNHQPEDLDVQTQPTNLVYKDLMEPGPLPISPIVKPLPMTT
                     VLLTGATGYLGSHVLYELLVSTKAHIYCLIRPSEKSTLEDKLMESMQFYFGHNIGRHM
                     QNRVTIIKGDLGKKKLHLTSEDEQTLIDEIDAIIHCGADVRHFGATEHFNNVNVNGTR
                     YLLELAERKPGIHFHYVSTIGIPEELAAIQWGAEEANGDFNYDTKLHNVYTQSKLEAE
                     NLVRNAVHDMIPISIYRVGNLSCHSETGKFQRNIDDNAFYRMIKAMLYLGKTPSVQWH
                     VDFTPINYASQALVCLANQPASNGHVFHLCNPVSLTYLELIDMLKEFGYDLQVMSKQE
                     YTNWLLHDDHSIEVQEYLALAIAQLEGDGASDSPFIFNCKKTIEFLANARIECAAPNT
                     AFIHQMIEYGIETGYFPEPTQVNIR"
     misc_feature    complement(151135..152598)
                     /locus_tag="Bsph_0138"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS); Region: A_NRPS; cd05930"
                     /db_xref="CDD:213296"
     misc_feature    complement(151330..152562)
                     /locus_tag="Bsph_0138"
                     /note="amino acid adenylation domain; Region:
                     AA-adenyl-dom; TIGR01733"
                     /db_xref="CDD:233550"
     misc_feature    complement(order(152155..152160,152164..152181,
                     152188..152190))
                     /locus_tag="Bsph_0138"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213296"
     misc_feature    complement(order(151153..151155,151426..151428,
                     151435..151437,151471..151473,151666..151668,
                     151738..151755,151819..151824,152176..152181))
                     /locus_tag="Bsph_0138"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213296"
     misc_feature    complement(150880..151065)
                     /locus_tag="Bsph_0138"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:215989"
     misc_feature    complement(149668..150759)
                     /locus_tag="Bsph_0138"
                     /note="thioester reductase domain; Region:
                     Thioester-redct; TIGR01746"
                     /db_xref="CDD:233557"
     misc_feature    complement(149875..150759)
                     /locus_tag="Bsph_0138"
                     /note="extended (e) SDRs, subgroup 1; Region: SDR_e1;
                     cd05235"
                     /db_xref="CDD:187546"
     misc_feature    complement(order(150172..150183,150247..150249,
                     150259..150261,150352..150360,150427..150429,
                     150469..150477,150661..150669,150727..150738,
                     150742..150744))
                     /locus_tag="Bsph_0138"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187546"
     misc_feature    complement(order(150247..150249,150259..150261,
                     150352..150354,150424..150426))
                     /locus_tag="Bsph_0138"
                     /note="active site"
                     /db_xref="CDD:187546"
     misc_feature    complement(order(150088..150090,150121..150123,
                     150175..150177,150259..150261,150352..150354))
                     /locus_tag="Bsph_0138"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187546"
     gene            complement(152934..154682)
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /db_xref="GeneID:6021636"
     CDS             complement(152934..154682)
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_001695905.1"
                     /db_xref="GI:169825747"
                     /db_xref="GeneID:6021636"
                     /translation="MKKRKKQHMSISKKITAIMVSILLLFGLVTLGLSYYIVRNSNLT
                     DMNQSLDDKGMILAKTIDVNTLKSILDNPSDSNPDALRLTKEMDAINDYSDSITNLFL
                     ITVNGENINAPVLSSSILKLGAEYNQDMIAMGLSPDFLARIKEVFETKEATATDIYSD
                     EFGSYKTGLTPILDDDGNMLAAYAIDYDVSMVTGKAMSEALWTLVVTVIFLIGSSIAV
                     YTLLRKKLTPIQQLSLQSKKVANGNLELEPLPVTSTDEVGTLTQNFNSMIENLKTVIK
                     STTNVSARVSNTANILSTNMQETSDSYNTVASSMQEIASSADLQVQRAKESTITIEEM
                     SIGIQRIAMTSNQISESSILASEEAERGNDSTNKSVAQMNAISQAVNQSAASVKLLGD
                     HSNKIEEIVGIITGIASQTNLLALNAAIEAARAGEAGSGFAVVADEVRKLAEQSEASA
                     REISTLISHIQHDTNESVNIMVRAVEEVDHGIVMINDSEQSFSQILTSIHHVTGQIQE
                     LSATIEEMAAGMEQVTSAVKDMEDFSINSKDSTRAVAATSASQLNTVQQVSEEAQVLS
                     ELSEELLNVVNTFVVK"
     misc_feature    complement(153864..154007)
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(153870..153875,153882..153887,
                     153891..153896,153903..153908,153912..153917,
                     153966..153968,153972..153977,153984..153989,
                     153993..153998,154005..154007))
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(153012..153770)
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(153093..153689)
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(153093..153098,153105..153107,
                     153114..153119,153126..153128,153135..153140,
                     153144..153149,153156..153161,153165..153170,
                     153177..153179,153186..153191,153198..153200,
                     153207..153212,153219..153224,153228..153233,
                     153240..153242,153249..153254,153261..153263,
                     153270..153275,153312..153317,153324..153329,
                     153333..153338,153345..153350,153357..153359,
                     153366..153371,153378..153380,153387..153389,
                     153399..153401,153420..153422,153429..153431,
                     153441..153443,153450..153455,153462..153464,
                     153471..153473,153480..153485,153492..153497,
                     153504..153506,153513..153518,153522..153524,
                     153534..153539,153543..153548,153555..153557,
                     153564..153569,153576..153581,153588..153590,
                     153597..153602,153609..153611,153618..153623,
                     153627..153632,153639..153641,153648..153653,
                     153660..153665))
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(153354..153455)
                     /gene="tlpC"
                     /locus_tag="Bsph_0139"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(155239..155700)
                     /locus_tag="Bsph_0140"
                     /db_xref="GeneID:6023174"
     CDS             complement(155239..155700)
                     /locus_tag="Bsph_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695906.1"
                     /db_xref="GI:169825748"
                     /db_xref="GeneID:6023174"
                     /translation="MAPEDFNSQFRPGMKIWVTLPTGTYSGTLIRTFGTGGRTAEIQL
                     DNGQIVTVDVSQITAAGTGAPPGNSYPPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPY
                     PPRPYPPQPYPPQPPRPYPPFPGGQFPGFPPPLLPGLPNIMPGIIGNPRQP"
     gene            155867..157204
                     /locus_tag="Bsph_0141"
                     /db_xref="GeneID:6023175"
     CDS             155867..157204
                     /locus_tag="Bsph_0141"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695907.1"
                     /db_xref="GI:169825749"
                     /db_xref="GeneID:6023175"
                     /translation="MAIIKVKKINIKNLRNVRHGEIILAVNFETFLKANVVGLYGQNG
                     SGKTTIVDAFGLLKTLISGWLAEVKLPSQEKRLILAGEDTASLDFEFLVENQFGTFFV
                     HYYVELQEDQHRLYTTLERLTYRENDKGKRSKVLMAMTENGIQIRNSHLPDMSEQARI
                     QLLVIQQLARKEYRSFLFHKDLKPLLQERLTEQEIQLLQNMAVDFNRDLHVVNNQNIA
                     PLFEERIMPFSIHLEKTRGQIPYDLKGPALLPEDEFYALCEVIEQSNRVLAAIIPGLT
                     IKINIITKQTMDDGGQGIRFEFLSQRGEQELPLRTESEGILKIISVLSVLIAVYNNPN
                     ACVVIDELDSGVFEYLLGELLTVIDEDGKGQLFFTSHNLRVLEVLAIKNLWFTTTNEN
                     HRYMQLKGIKEVNNARDVYLRAIQLGGQDEEVYKETKTFKIKRAFRKAGVHHD"
     misc_feature    155912..>156055
                     /locus_tag="Bsph_0141"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:247755"
     misc_feature    155945..156541
                     /locus_tag="Bsph_0141"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:222160"
     misc_feature    155987..156010
                     /locus_tag="Bsph_0141"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(155996..156001,156005..156013)
                     /locus_tag="Bsph_0141"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    <156524..156997
                     /locus_tag="Bsph_0141"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:222036"
     gene            157197..157928
                     /locus_tag="Bsph_0142"
                     /db_xref="GeneID:6023176"
     CDS             157197..157928
                     /locus_tag="Bsph_0142"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695908.1"
                     /db_xref="GI:169825750"
                     /db_xref="GeneID:6023176"
                     /translation="MTKKVLLIIVEGQTEQIILEDYLDAYFENATIRFDVQREDVLTK
                     WDAHKRIPNIKNSVIRVIQSYLEKYKFLAKDLTAVVHITDADGCFIAPECVQVDEKIE
                     QKLFYTEEAILVKSNKRKEQIEQRNEMKARNVRILIANDHFSINRLKVPYQLFYFSTN
                     LEHVLWDERNEIPTEKIHKADEFIENLSGTIEDYLKAYLPVDTELPYREKMKKSWSYL
                     MEGSHSLQRGTNVPLLFEMIKTDVQ"
     gene            complement(157973..163057)
                     /locus_tag="Bsph_0143"
                     /db_xref="GeneID:6023177"
     CDS             complement(157973..163057)
                     /locus_tag="Bsph_0143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695909.1"
                     /db_xref="GI:169825751"
                     /db_xref="GeneID:6023177"
                     /translation="MTLSHEQKTHFQSIVDTAPSTIQPLAAALLKYMDNRNYDIEQLI
                     TEQHVQSLEELFSGPLLEVLTLFSSQERASHIKKLALRFDATIFQTDSLRRSFRSASS
                     VQDHLFQCLQLIEEMLTFEEIGLQDLLAHHSQYEHGTYPNYSSYVLKNENEKVMSFHV
                     FEQLLAEELSLENPIIEEKIESILFDEHRSSFFGHPLIRGIFKSSNSRMHEALGKLLV
                     AAARQEGLRQAIVENIDHGNLDAQLKMMKLIQEHQLTRFSSVIRAVDTWMGLGYSSFE
                     NQKITEEVLSLAIQAMEDDHFTEQLLKSERTIDIYVALWATSTKDYTKLELLLADLLK
                     RDKHIQLTTLAFLKNLSKISFTAPFVKELILTTKDIELFAFAWNNFIHANHYINSEYA
                     RDNEWEKTLQGFMKENSQLQGIEYPLFEQLEWAKNEMTKDGLSITGKPLSFVFVHLSF
                     EDLISTQIILAHYLQDEELFQRIIARSDAYPPSSRIGLLNIYCLDPITQGQREFLFNS
                     LRDRSSINRSLALKKIHALTPTQEEIAKIEDLLANKSGALRKEAISLLKVQPQDHVLQ
                     SAERLIKDNKQLKRLGGLELLLEASKDYNLANEQITALCSLLPKITKNEQVFLEQLVA
                     RDVPEYNESNGFGLYTPHAPISYDSITNSSIKMNSEEPWQQLIPLYVQTPTPIEKFFQ
                     YDLDKLLFKLEQLIHILDEYADFEYETFQWNDTKMTTTLGQKYSILATKTDSQRHASL
                     DVYPIPEAIVQWIQSSSFSSEDLAYFNFYSHLSEYPAAHDLSEAAHVLIQPFFQYEEI
                     KKYVAQFNSLKYHYTLQQIFSVLSQDIKNISGETTLHTEAVSLLERHTPVFNSFNQAA
                     GIVLQLLHQIPADQWQVNVRDKGYYYYQSTSTIIDLDIIEAFVDRLSNYATYEDYAKM
                     LAINEELTKRMQKENYSPILYDLSLFQYLDAFKAGLLKQDHLYEAIFTNTLASEIFTE
                     PSKLLDRYQSFDDLTDFLAIRNEAIDRILAIELKRGDTPTAVTKLASSISYFEGIDYF
                     LQILQALDGEKLSRGYIWQAETKKDVFSRLLTSCYPKKEETAQQLKEAWQKTEISKER
                     LIEAMMYNQHWIDLVSEVIDWEGLKESAWYFIAHTTDSLSDFAKDQIALFSSITAEDF
                     GDGAFDLAWFQSAYQTLGSKKFKVVYDAAKYASEGANHRRAQLYADTAIGKLSPKPLM
                     KEIQEKRNKDKLRALGLIPLKSADDKDALDRYQFIQQFLKESKQFGAQRRASEARAAS
                     IALENLARNAGDGEATRFIWRMELSAFNDIQQLFKAQPIEQITAHLQIEEDATITIIV
                     EKDGKRLKNIPTALKKHADVVTLQEARKDLQEQYKRARPALEQAMALETIFSAEELIN
                     LLAHPILAPLLQKLVFISGEHVGMITPEGLQVLSGNVVNLAPTTTLMIAHPYHLLESG
                     QWRQWQAYMFEHKIQQPFKQVFRELYLINADEKGRKQSLRYAGHQVNPSQTVALLKTR
                     GWQISYETGPRKVYYKENIVASLYAQADWFTPAEIEAPTIEGVYFYNRLTGKDIVLDD
                     IPAAIFSEVMRDMDLVVSVAHVGGVDPEASHSTVDMRSIIVEELAKLLKLSNVETKKQ
                     HVLIEGKLASYSLHLGSGIVHQVGGSMIPIVAVPSQHRGRIFLPMVDDDPRTAEIMAK
                     LLLLSEDTKIKDPAILAHIRSYEQTH"
     misc_feature    complement(158567..159088)
                     /locus_tag="Bsph_0143"
                     /note="Domain of unknown function (DUF4132); Region:
                     DUF4132; pfam13569"
                     /db_xref="CDD:222230"
     gene            complement(163071..163490)
                     /locus_tag="Bsph_0144"
                     /db_xref="GeneID:6023178"
     CDS             complement(163071..163490)
                     /locus_tag="Bsph_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695910.1"
                     /db_xref="GI:169825752"
                     /db_xref="GeneID:6023178"
                     /translation="MRLFYQQKVIGKKSRKLQKIPFFIEEPVINLQDLLIKIVTQQVQ
                     QYNEKMVDTPLHLYLTDQQLDHAAQYGKVHFGEKKNGSFQPVDQAVSTMLQAFQDELF
                     LVLHNEETIDSLNSPLAVQEDDVFTFIKLTMLAGRIW"
     gene            complement(163659..163862)
                     /locus_tag="Bsph_0145"
                     /db_xref="GeneID:6023379"
     CDS             complement(163659..163862)
                     /locus_tag="Bsph_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695911.1"
                     /db_xref="GI:169825753"
                     /db_xref="GeneID:6023379"
                     /translation="MDFLIALQLGQIIVQVRKAPSFFSIYFHTYLFLKNTCVTSSVFS
                     LLFVLERKMIHTPTKTIVQTFYF"
     gene            164091..165263
                     /locus_tag="Bsph_0146"
                     /db_xref="GeneID:6023380"
     CDS             164091..165263
                     /locus_tag="Bsph_0146"
                     /codon_start=1
                     /transl_table=11
                     /product="spore peptidoglycan hydrolase"
                     /protein_id="YP_001695912.1"
                     /db_xref="GI:169825754"
                     /db_xref="GeneID:6023380"
                     /translation="MGQALVIPIVGSFYYVQPGDSLWSIGQRLGINYVTLAQVNGINP
                     NQPLAVGMRLYIPQPPKTRAETLAYLEPRGTSVSEVLLDQAREAGPYLTYLALFSYEA
                     RRDGTLRIPPSQGVPQITDDTGASLAMVVTNLENFSFSGELARDIFQSTAVQDLLFDN
                     ILAEANKLGDVKDIHFDFENLPGDQREAYNNFLRRAVEKFHTQGYTVSTALAPKTSAS
                     DRGPWTAGHDYRAHGEIVDFVLLMTYEWGYSAGPPMAVSPLPEVEEVVKYAVSEIPAG
                     KIMLGQNLYGYDWTLPFVQGGPIAEALSPQRAIETAKRYNAAIQYDWRAQAPFFEYYD
                     EQGRAHIVWFEDARSIQAKFNLVKQYNLRGIGYWKLGLPFPQNWLLIGANFDVVKK"
     misc_feature    164094..165248
                     /locus_tag="Bsph_0146"
                     /note="Predicted glycosyl hydrolase [General function
                     prediction only]; Region: COG3858"
                     /db_xref="CDD:226376"
     misc_feature    164127..164258
                     /locus_tag="Bsph_0146"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    164280..165233
                     /locus_tag="Bsph_0146"
                     /note="Cortical fragment-lytic enzyme (CFLE) is a
                     peptidoglycan hydrolase involved in  bacterial endospore
                     germination.  CFLE is expressed as an inactive preprotein
                     (called SleB) in the forespore compartment of sporulating
                     cells.  SleB translocates across the...; Region:
                     GH18_CFLE_spore_hydrolase; cd02874"
                     /db_xref="CDD:119353"
     misc_feature    order(164292..164294,164382..164387,164505..164507,
                     164613..164615,164619..164621,164625..164627,
                     164814..164816,164820..164825,164943..164945,
                     165192..165194)
                     /locus_tag="Bsph_0146"
                     /note="active site"
                     /db_xref="CDD:119353"
     gene            165369..167603
                     /locus_tag="Bsph_0147"
                     /db_xref="GeneID:6023381"
     CDS             165369..167603
                     /locus_tag="Bsph_0147"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695913.1"
                     /db_xref="GI:169825755"
                     /db_xref="GeneID:6023381"
                     /translation="MYFRRDILGKFKKLGIILTSTAFSVGMLAPISQASANVKESSER
                     IEIQVASTETKITKNMLIKKLRSLFPEEFKFVADQDFNSGPGHFYRDDTTVRYELNFY
                     KTIKGKDVHGSFVFKGDDLELEHFYYQPANMAEAIYPAKYSENEAQKIAQKFLGKFVN
                     SDNFKLRDDNNEYGFNITRPLSEPITYSFTYSPIYNGVLIGDQSITINVLANGDVTGM
                     SSNAESISKASFDNLDQKKKEEDVLAQVRENLAMELRYYIDYDYRSDQSNVKLVYAPV
                     TGFNGVHALNGQWQTANGFTEQLPKTKSVEKISAQPLPPRKNGITATEAEEFAKNFLK
                     VDESKAKLTIDLVDERENDNGETIYSVNYTYMYGNGGSGSSLEINKATGELVQYHDLS
                     RDFLTDNKVNAISKDAALKKAIDYLKEWAPSYLHEYSMPIEDAVFDQYSKDYYFTFPR
                     IMNGIAVVGDGLHVGIGADGTLRSLSVNKQKIDNWQPIKNVISADKAKEAYSKALTLQ
                     LQYVKQDTESKLHYDLVYAPTYNGSLYNQIDAVSGEWLNNVDGSTEKPVISHPTAAKE
                     LNYLFNQNVLDVKDIANFNADAAVTKGEALKILLHSLTYGYYGSGDGEKQSFNNIDKK
                     HPLYGVVEQAVKMGIIQPANQFALDATLSRQEFAEWSIKLLQLDNVAKYKDIYKLNFA
                     DAASIDPAYTGYIALANGMGLIDAQQNNFNATKSVSYADLAVSTVRLAKAIQENKVDR
                     NFYY"
     misc_feature    167217..167342
                     /locus_tag="Bsph_0147"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     gene            167711..168175
                     /locus_tag="Bsph_0148"
                     /db_xref="GeneID:6023382"
     CDS             167711..168175
                     /locus_tag="Bsph_0148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695914.1"
                     /db_xref="GI:169825756"
                     /db_xref="GeneID:6023382"
                     /translation="MKLKLLLAISFVMVILYGCNKEEVKDVPTNAPADQNASQQTGDT
                     PTDQVTFNFLEFSLDVDYSATESYEVEYENKKTGISAKLQDDRQNVKLQGDEAYTKLE
                     PLFKQLNFDSTTPNDEVIDQVIKVFNIEDNYQSIEVEVEFMDGNEKEFKRLP"
     misc_feature    167867..168142
                     /locus_tag="Bsph_0148"
                     /note="YusW-like protein; Region: YusW; pfam14039"
                     /db_xref="CDD:206209"
     gene            complement(168226..170211)
                     /locus_tag="Bsph_0149"
                     /db_xref="GeneID:6023383"
     CDS             complement(168226..170211)
                     /locus_tag="Bsph_0149"
                     /EC_number="1.11.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="YP_001695915.1"
                     /db_xref="GI:169825757"
                     /db_xref="GeneID:6023383"
                     /translation="MKKDINQKQHQLEAFRVSDKNQPLTTNQGLKIAEDEHSLKAGNR
                     GPTLLEDFHFREKMTHFDHERIPERVVHARGSAAHGIFETYECASDITKAQFLNGKGT
                     KTPVFVRFSTVAGSRGSADTVRDARGFATKFYTQEGNYDLVGNNIPIFFIQDAIKFPD
                     FVHAVKPEPNNEIPQAQSAHDTFWDFIANNQESAHMVMWHMSDRSIPRSYRMMEGFGV
                     NTYRFINSEGKSHFVKFHWKPVLGVKSLVWDEAQIIAGKDPDFHRRDLWESIERGDYP
                     EWELSVQLIPLEDEFKFNFDILDATKIWPEEEVPVRILGKMTLNKNVDNFFAETEQAA
                     FHVGHVVPGIDFSNDPLLQGRLFSYTDTQLIRLGGPNFHEIPINKPICPFHNNQRDGY
                     GRQTINVGQVSYHKNSLADNTPSPVSEEEGGYTHYEEKVEGHKVRARSESFKDHFTQA
                     RLFWLSMTEIEKEHIINAFSFELGKVKSKAIRKQVVDMFAHVSHSLATAIADNIGIVP
                     PVQVEVPHIMQTSPAVSQILNAVESVKTFKVAVIVAENTEENLNELIATLLSKNIVVE
                     LVSTKQGLLNGFEIHETFATASSVLYDGIYVSGSFHDLNQQAKAEQFIEEAYQHFKTI
                     GLAKNVSFSQHLANKNGVANNLPSFIQLLAKHRHWER"
     misc_feature    complement(168229..170196)
                     /locus_tag="Bsph_0149"
                     /note="hydroperoxidase II; Provisional; Region: katE;
                     PRK11249"
                     /db_xref="CDD:236886"
     misc_feature    complement(168700..170028)
                     /locus_tag="Bsph_0149"
                     /note="Clade 2 of the heme-binding enzyme catalase;
                     Region: catalase_clade_2; cd08155"
                     /db_xref="CDD:163711"
     misc_feature    complement(order(168760..168762,168772..168774,
                     168778..168780,168787..168792,168988..169005,
                     169030..169038,169042..169044,169051..169053,
                     169057..169062,169072..169074,169084..169095,
                     169099..169104,169111..169119,169126..169131,
                     169138..169146,169153..169155,169162..169164,
                     169168..169170,169192..169197,169216..169218,
                     169225..169227,169231..169236,169240..169242,
                     169318..169320,169324..169326,169339..169344,
                     169411..169413,169420..169425,169432..169434,
                     169444..169449,169456..169458,169465..169467,
                     169657..169659,169666..169668,169690..169707,
                     169723..169725,169732..169734,169738..169752,
                     169795..169800,169855..169860,170002..170004,
                     170017..170019))
                     /locus_tag="Bsph_0149"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163711"
     misc_feature    complement(order(169135..169137,169147..169149,
                     169738..169740,169762..169764,169777..169779,
                     169879..169881,169996..169998))
                     /locus_tag="Bsph_0149"
                     /note="heme binding pocket [chemical binding]; other site"
                     /db_xref="CDD:163711"
     misc_feature    complement(168241..168606)
                     /locus_tag="Bsph_0149"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in at the C-terminal of several large
                     catalases; Region: GATase1_catalase; cd03132"
                     /db_xref="CDD:153226"
     misc_feature    complement(order(168367..168369,168376..168378,
                     168493..168501))
                     /locus_tag="Bsph_0149"
                     /note="domain interactions; other site"
                     /db_xref="CDD:153226"
     gene            170384..170818
                     /locus_tag="Bsph_0150"
                     /db_xref="GeneID:6024431"
     CDS             170384..170818
                     /locus_tag="Bsph_0150"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_001695916.1"
                     /db_xref="GI:169825758"
                     /db_xref="GeneID:6024431"
                     /translation="MKEDNRNLKAFTVLFRAYQTIQEATKRDLLQFDLNQTEFSVLEF
                     LYHRGEQPIQVIGKRILIASSSITYVIDKLEQKGYVYRKSCPRDRRVTYVLLTHEGQI
                     LMEEIFPKHEQKINEIFEVLEPQELDTMILSLKKVGKNANEH"
     misc_feature    170462..170764
                     /locus_tag="Bsph_0150"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    170483..170659
                     /locus_tag="Bsph_0150"
                     /note="MarR family; Region: MarR; pfam01047"
                     /db_xref="CDD:201571"
     misc_feature    <170585..170761
                     /locus_tag="Bsph_0150"
                     /note="MarR family; Region: MarR_2; cl17246"
                     /db_xref="CDD:247800"
     gene            170868..171851
                     /locus_tag="Bsph_0151"
                     /db_xref="GeneID:6024432"
     CDS             170868..171851
                     /locus_tag="Bsph_0151"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="YP_001695917.1"
                     /db_xref="GI:169825759"
                     /db_xref="GeneID:6024432"
                     /translation="MNHLKGVHHVTAITSSAEENYKFFTYVLGMRLVKKTVNQDDIQT
                     YHLFFADDKGSAGTDMTFFDFPNIQKGVHGTNEISKTSFRVPTDASLEYWEKRFDRLH
                     VKHTGIKEQFGKKTLSFVDFDDQQYQLISDEHDTGIASGTPWQVGPIPLKYAITGLGP
                     VFIRVANFNYFKDVLEKVMLFTEIGEEGDFHLFEVGEGGNGAQVIVEHNTVLPVARQG
                     FGTVHHAAFRVEDRAVLDEWTARFESFGFHTSGYVNRHFFESLYARVAPQILFELATD
                     GPGFMGDEPYETLGEKLSLPPFLEPKRTQIEGLVRPIDTVRSSITFDKEYE"
     misc_feature    170883..171257
                     /locus_tag="Bsph_0151"
                     /note="N-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_N_like; cd08346"
                     /db_xref="CDD:211356"
     misc_feature    order(170892..170894,170898..170900)
                     /locus_tag="Bsph_0151"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:211356"
     misc_feature    171336..171806
                     /locus_tag="Bsph_0151"
                     /note="C-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_C_like; cd08347"
                     /db_xref="CDD:176695"
     misc_feature    order(171537..171539,171681..171683)
                     /locus_tag="Bsph_0151"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:176695"
     gene            171920..172537
                     /locus_tag="Bsph_0152"
                     /db_xref="GeneID:6024433"
     CDS             171920..172537
                     /locus_tag="Bsph_0152"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H nitroreductase ydfN"
                     /protein_id="YP_001695918.1"
                     /db_xref="GI:169825760"
                     /db_xref="GeneID:6024433"
                     /translation="MEFSKLIDKRRSANNFLKDVKMTEEDIRPILEDVKLAPSAFNLQ
                     HANYIVVLDETMKEKVREAAYGQYKVHSASGVILVLGDKKAYKNTAELSQGMVDLGII
                     TTYELEEIVAENTHFYEDRGDAFMKEEAIRNASLSAMLFMLAAKNRGWDTCPMIGFDN
                     QKMRELFNVPEEQEIALMITIGKEKESSRRLRGYRKPVEEFATYY"
     misc_feature    171929..172522
                     /locus_tag="Bsph_0152"
                     /note="Nitroreductase-like family 1. A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_1; cd02137"
                     /db_xref="CDD:239052"
     misc_feature    order(171935..171940,171947..171949,172001..172003,
                     172022..172030,172043..172045,172049..172051,
                     172061..172069,172073..172087,172187..172189,
                     172247..172249,172256..172261,172346..172351,
                     172358..172360,172418..172423,172499..172507,
                     172511..172522)
                     /locus_tag="Bsph_0152"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239052"
     misc_feature    order(171947..171949,171953..171955,172031..172039,
                     172043..172045,172124..172126,172247..172249,
                     172376..172390)
                     /locus_tag="Bsph_0152"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239052"
     gene            172572..173144
                     /locus_tag="Bsph_0153"
                     /db_xref="GeneID:6024434"
     CDS             172572..173144
                     /locus_tag="Bsph_0153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695919.1"
                     /db_xref="GI:169825761"
                     /db_xref="GeneID:6024434"
                     /translation="MNNIHLGGNIVKVVAIVGSIRKESYNMQLAQFIEKRYAEKLDLE
                     VLSLKDLPMYNQDIENEAPQAVLDFKAKVKAADAVLWITPEYNGTVPGVMVNAIDWLS
                     RVDKVMIGKPSIIMGASMGNLGTVKAQLHLRDILFSPGINSPLLSGNDVYIGAVHTKF
                     DEEGNLTDEGTVKFLDVVIDNFLNWSKKYI"
     misc_feature    172605..173141
                     /locus_tag="Bsph_0153"
                     /note="Predicted flavoprotein [General function prediction
                     only]; Region: COG0431"
                     /db_xref="CDD:223508"
     misc_feature    172605..173045
                     /locus_tag="Bsph_0153"
                     /note="NADPH-dependent FMN reductase; Region: FMN_red;
                     pfam03358"
                     /db_xref="CDD:217511"
     gene            173274..174674
                     /locus_tag="Bsph_0154"
                     /db_xref="GeneID:6024435"
     CDS             173274..174674
                     /locus_tag="Bsph_0154"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_001695920.1"
                     /db_xref="GI:169825762"
                     /db_xref="GeneID:6024435"
                     /translation="MRKLSLKLGIIFFITLFCIETFMMFFLHASLTNSRVEEELASLQ
                     ARGNSHRTILEQNFNNETLAHVVLMESEESTDVVVTDAEGIILASSQLHPEIKELIKK
                     IDETIPYEGKILQDNWREVKAIATISPMKREQTTIGYVFMFQNTDSIHALMKRLNKHF
                     LIVGIVSGLVTIAVIIVLSRKLAEPLIQMKEATLKMSKGDFTVALSTNGKDELGDLSN
                     AIQLLSNELNHLRQEREEFLSSIAHELRTPITFIKGYTDILYKRDLSAQDRQKYLAII
                     REETNRLSRLIKDLFDLAKMDENSFIIEKQNLDLQAFFTGIKGKLSPAFQEKDIHFEV
                     CCENGLTLWADEARLEQIIINLLNNALTYCGQGDTTTVNVKKVNGVLTIIIRDTGRGI
                     PNKDLPFIFERFYRVEKSRSRALGGSGLGLAIVKELVQAHGGEVTVKSELNKGTVFEL
                     SFKGVGADENHFMHRR"
     misc_feature    173697..174629
                     /locus_tag="Bsph_0154"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    173817..173960
                     /locus_tag="Bsph_0154"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(173817..173822,173829..173834,173838..173843,
                     173850..173855,173859..173861,173907..173912,
                     173916..173921,173928..173933,173937..173942,
                     173949..173954)
                     /locus_tag="Bsph_0154"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    173967..174158
                     /locus_tag="Bsph_0154"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(173982..173984,173994..173996,174006..174008,
                     174015..174017,174027..174029,174036..174038,
                     174087..174089,174099..174101,174108..174110,
                     174120..174122,174129..174131,174141..174143)
                     /locus_tag="Bsph_0154"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    174000..174002
                     /locus_tag="Bsph_0154"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    174318..174629
                     /locus_tag="Bsph_0154"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(174336..174338,174348..174350,174357..174359,
                     174426..174428,174432..174434,174438..174440,
                     174444..174449,174528..174539,174585..174587,
                     174591..174593,174606..174611,174615..174617)
                     /locus_tag="Bsph_0154"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    174348..174350
                     /locus_tag="Bsph_0154"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(174438..174440,174444..174446,174528..174530,
                     174534..174536)
                     /locus_tag="Bsph_0154"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            174682..175332
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /db_xref="GeneID:6024698"
     CDS             174682..175332
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein SrrA"
                     /protein_id="YP_001695921.1"
                     /db_xref="GI:169825763"
                     /db_xref="GeneID:6024698"
                     /translation="MLDLLTLYLEPVFHCRAMSSIHDALIYLEEEHVDLVLLDIMMPE
                     MDGFQVCQEIRKFWHVPIIMLTAKGEHSDIVKGLNIGADDYILKPFDEEELLARIHAV
                     LRRTKVENKVVVFEGLRLDKESFELYFQQEAIPLTPKEFSMMSLFLDYQNKVFSREHL
                     INTVWGYHVSIEDRTIDSHVRNLREKLRKSGFPADDYLQTVWGIGYKWHKFADRKP"
     misc_feature    174682..174990
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    174682..174978
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="Response regulator receiver domain; Region:
                     Response_reg; pfam00072"
                     /db_xref="CDD:200976"
     misc_feature    order(174796..174798,174820..174822,174877..174879,
                     174934..174936,174943..174948)
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    174796..174798
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    <174799..175305
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    order(174805..174810,174814..174822)
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    174943..174951
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    175018..175305
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(175090..175092,175147..175152,175204..175206,
                     175213..175215,175237..175242,175279..175281,
                     175294..175296)
                     /gene="srrA"
                     /locus_tag="Bsph_0155"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(175389..175973)
                     /locus_tag="Bsph_0156"
                     /db_xref="GeneID:6024699"
     CDS             complement(175389..175973)
                     /locus_tag="Bsph_0156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695922.1"
                     /db_xref="GI:169825764"
                     /db_xref="GeneID:6024699"
                     /translation="MTFKRRWSGGLLLAVVLLTLSACSEDKTEPSSTSNNTPESEQQT
                     EMDHSTMNHSSSAEVPATLKKAEDPTFPVGSTALIKDGHMEGMKGAEATIVGAYKTTA
                     YIISYNPTSGGERVENHKWIIHEELIDVGEAPLSSDTEVKTTATHMAGMKNATVRIEE
                     AVPTTVYMVDYISTTNGETVKNHKWVTEDELTAQ"
     misc_feature    complement(175602..175760)
                     /locus_tag="Bsph_0156"
                     /note="Protein of unknown function (DUF1541); Region:
                     DUF1541; pfam07563"
                     /db_xref="CDD:148915"
     misc_feature    complement(175410..175568)
                     /locus_tag="Bsph_0156"
                     /note="Protein of unknown function (DUF1541); Region:
                     DUF1541; pfam07563"
                     /db_xref="CDD:148915"
     gene            complement(176090..176688)
                     /locus_tag="Bsph_0157"
                     /note="This region contains a gene with one or more
                     premature stops or frameshifts, and is not the result of a
                     sequencing artifact; biotin biosynthesis protein;
                     KO:K03523; identified by sequence similarity"
                     /pseudo
                     /db_xref="GeneID:6024700"
     gene            177228..178274
                     /locus_tag="Bsph_0159"
                     /db_xref="GeneID:6024701"
     CDS             177228..178274
                     /locus_tag="Bsph_0159"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_001695923.1"
                     /db_xref="GI:169825765"
                     /db_xref="GeneID:6024701"
                     /translation="MNKKFMLFSLVLLLVLIVSMTFAVMVGSVSVTPLYVWKVILSKL
                     PFIQQTIEQDWSRSQEIIIWQIRVPRVILAAIVGAGLAIAGAAIQALVRNSIADPYIL
                     GISSGAAVGATSVIILGAFSFLGIYALSVSAFIGSLLAIGLVFFLSRVGGRVSIFRLL
                     LAGMAVSFILTAISNFILMMSKQEGALKAVMFWMLGSLAGAKWSNIIIPASIFFIVFA
                     LLWLFYRNLNLLLLGEEAAVTLGVNLQQFRIQLILLVSLLTGVLVAVSGSIGFVGLII
                     PHIVRLIVGSNYKYVIPVSALLGGIFLVWADALARIIIAPQEMPIGIITAFCGGPFFI
                     WLLRRNNYSFGEGD"
     misc_feature    <177390..178250
                     /locus_tag="Bsph_0159"
                     /note="iron-hydroxamate transporter permease subunit;
                     Provisional; Region: PRK10577"
                     /db_xref="CDD:236720"
     misc_feature    177504..178238
                     /locus_tag="Bsph_0159"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(177504..177512,177888..177893,177897..177905,
                     177909..177914,177918..177935,177939..177947,
                     178068..178070,178089..178091)
                     /locus_tag="Bsph_0159"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(177507..177509,177513..177515,177528..177530,
                     177699..177701,177705..177710,177717..177722,
                     177729..177734,177741..177743,177756..177761,
                     177765..177767,177798..177803,177810..177812,
                     178038..178040,178194..178196,178203..178208,
                     178215..178217,178224..178229,178236..178238)
                     /locus_tag="Bsph_0159"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(177765..177767,177840..177842,178014..178016,
                     178026..178028,178158..178160,178185..178187)
                     /locus_tag="Bsph_0159"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            178280..179071
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /db_xref="GeneID:6024702"
     CDS             178280..179071
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /codon_start=1
                     /transl_table=11
                     /product="Iron(III) dicitrate transport ATP-binding
                     protein"
                     /protein_id="YP_001695924.1"
                     /db_xref="GI:169825766"
                     /db_xref="GeneID:6024702"
                     /translation="MTLEAKQVSFSIYDQQILHEVSVKIKKKQFVGLIGPNGSGKSTL
                     LKNMYRLLKPESGTVLLNEQDILKQSSKAIAKNLAVVSQETPVLFDFTVHDLVSMGRT
                     PHKKLLELDQEQDFQIVKNALKQTGILHLAKRSFSSLSGGEKKRVMVARALAQQAHVL
                     ILDEPTNHLDIQHQLQLMDLIQTLHLTVVAALHDLNIAAMYCDQIYVLQRGRIVCHGT
                     PEEVLTPSLLQEVFGVFADIQTHTLTGKPYLTYVPEQFARRTNPI"
     misc_feature    178280..179026
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    178289..178930
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    178382..178405
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(178391..178396,178400..178408,178526..178528,
                     178766..178771,178856..178858)
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    178517..178528
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    178694..178723
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    178754..178771
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    178778..178789
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    178844..178864
                     /gene="fecE"
                     /locus_tag="Bsph_0160"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(179161..179475)
                     /locus_tag="Bsph_0161"
                     /db_xref="GeneID:6022227"
     CDS             complement(179161..179475)
                     /locus_tag="Bsph_0161"
                     /codon_start=1
                     /transl_table=11
                     /product="quaternary ammonium compound-resistance protein"
                     /protein_id="YP_001695925.1"
                     /db_xref="GI:169825767"
                     /db_xref="GeneID:6022227"
                     /translation="MGWVFVILAAVAEIVGVIGLRFYSQHKTVRNLLLYIGGFGLSFA
                     LLYASFNYLQLSIAYVVWVGIGTVGAVLVNIMFFGESKNLARIISIVAIIIGVAGLKA
                     VS"
     misc_feature    complement(179218..179472)
                     /locus_tag="Bsph_0161"
                     /note="Small Multidrug Resistance protein; Region:
                     Multi_Drug_Res; pfam00893"
                     /db_xref="CDD:201495"
     gene            complement(179475..179828)
                     /locus_tag="Bsph_0162"
                     /db_xref="GeneID:6022228"
     CDS             complement(179475..179828)
                     /locus_tag="Bsph_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="sugE protein"
                     /protein_id="YP_001695926.1"
                     /db_xref="GI:169825768"
                     /db_xref="GeneID:6022228"
                     /translation="MQKEWMYVGLTSLFELFWIFGFNVANSWWHWIIIVSIIAIDFHF
                     LSKACEKLPTGTVYAIFAGAGAIGTTLMDIFIFNGDFNAIKGIFMVILVLGVIGLKLA
                     DNPSKDPSTTKGVDA"
     misc_feature    complement(179574..179816)
                     /locus_tag="Bsph_0162"
                     /note="Small Multidrug Resistance protein; Region:
                     Multi_Drug_Res; cl00910"
                     /db_xref="CDD:242185"
     gene            complement(179900..180499)
                     /locus_tag="Bsph_0163"
                     /db_xref="GeneID:6022229"
     CDS             complement(179900..180499)
                     /locus_tag="Bsph_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_001695927.1"
                     /db_xref="GI:169825769"
                     /db_xref="GeneID:6022229"
                     /translation="MAKVRDIMSKEEKIIQAAIEVFREKGIEKTKVSDIVKAAGIAQG
                     TFYLYFPSRLSVMPAIAKNMVERIIATVEEGVSDHKPFEQQLEEVVEMIFLITKEYGD
                     IVALIYAGIAQTEHLKEWENIYSPYYHWMSNFLLTAQQQGVIRDSINPSRSAKLIIGL
                     IESAAEQIYLFDDSKDETMQQLKLELLDFLYHALGLRHA"
     misc_feature    complement(179918..180499)
                     /locus_tag="Bsph_0163"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(180341..180460)
                     /locus_tag="Bsph_0163"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:201228"
     gene            180620..180796
                     /locus_tag="Bsph_0164"
                     /db_xref="GeneID:6022230"
     CDS             180620..180796
                     /locus_tag="Bsph_0164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695928.1"
                     /db_xref="GI:169825770"
                     /db_xref="GeneID:6022230"
                     /translation="MTMEDIKFAQLDPQQLAKINELEKKMGVTLVAYDSSSTPPHSSG
                     AYEENNSTTNHHPS"
     gene            180866..182032
                     /locus_tag="Bsph_0165"
                     /db_xref="GeneID:6022231"
     CDS             180866..182032
                     /locus_tag="Bsph_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695929.1"
                     /db_xref="GI:169825771"
                     /db_xref="GeneID:6022231"
                     /translation="MKEFYADLHIHIGRTAKGRAVKITGSKTLTLARILETASARKGL
                     DIIGIIDCHSPEVIEEMKVMIDQGELVELAEGGLRFQETTLIPGSEIEIYDHHCHGPI
                     HVLAYFPTLLRMEQFSDWMSQHMKNIHLSSQRIYCEGRTLQKKVRELGGLFIPAHVFT
                     PFKSLYGKGVHRSLTEVFDPQLIDAIELGLSSDTNMVRQIKELQSYPFVSNSDAHSLG
                     KLAREYQKLRLADANFIELQMALRDQQGRAIIANYGLNPLLGKYHQTVCSKCGEQLSN
                     EAMICTNCESTQIIKGVATRIQELSENFPHEKNRPPYIHQVPLDFIPGIGPKMMERLL
                     HAFGTEMNILHQVTMEQLEQIVPHKIAKLIDAARTGHLDIEVGGGGIYGKVHME"
     misc_feature    180881..182020
                     /locus_tag="Bsph_0165"
                     /note="PHP family phosphoesterase with a Zn ribbon
                     [General function prediction only]; Region: COG1379"
                     /db_xref="CDD:224297"
     misc_feature    <181316..181513
                     /locus_tag="Bsph_0165"
                     /note="Polymerase and Histidinol Phosphatase domain;
                     Region: PHP; cl17102"
                     /db_xref="CDD:214263"
     misc_feature    181664..>181717
                     /locus_tag="Bsph_0165"
                     /note="zinc-ribbon domain; Region: zinc_ribbon_2;
                     pfam13240"
                     /db_xref="CDD:205420"
     gene            182136..183758
                     /locus_tag="Bsph_0166"
                     /db_xref="GeneID:6024024"
     CDS             182136..183758
                     /locus_tag="Bsph_0166"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="YP_001695930.1"
                     /db_xref="GI:169825772"
                     /db_xref="GeneID:6024024"
                     /translation="MKLSKKCRFLATSMLALQLTIPVVANAEETGDYIAPSWTTQADY
                     VALGDSIAHGMNEVGAIGLGYPDYVAQALQKEGFITSFNKGFAMSGYTTKNVLADIQN
                     DVAKTVTGFGYPIEQVKLKASIKEAEIITLTIGANDLLPILKESQTAGIDTLAIIKAT
                     KEAVTNIAAILTEIKKLNPQAEVYVMGYYNSFPYYGESLQNQFKILLATMNTTIKTTV
                     EKAGAFFVPTSDIVAKDVPSYLPNPENIHLSEAGYFAVANEAFLPIIKTSSLWDVTNA
                     IQVHVKDHKTVDISWREATDNVGVENYQVYVNGKLASTVTADTTEMTLTDLTENTDYT
                     ITIKAIDAAGNESVQNPTAAFTTRETIRFTDTAHHWAKEYIQQAAEAGMMNGYPDGTF
                     KPNQNVTRAQVASILVRSLGISTQEKTPFTDIAKYDAKTQSEIAAAYAHGIIKGADGK
                     FNPARPVSRAELAVMIERAYEQQFKQPYIVQGSSPFTDITSYNAETKHAITMLFELGI
                     VSGDGQKYSPAASTTRGQAAKIMVNLNQLFNK"
     misc_feature    182262..182918
                     /locus_tag="Bsph_0166"
                     /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase; cl01053"
                     /db_xref="CDD:242274"
     misc_feature    order(182283..182285,182403..182405,182544..182546,
                     182865..182867,182874..182876)
                     /locus_tag="Bsph_0166"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    order(182283..182285,182865..182867,182874..182876)
                     /locus_tag="Bsph_0166"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    order(182283..182285,182403..182405,182544..182546)
                     /locus_tag="Bsph_0166"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     misc_feature    183219..183347
                     /locus_tag="Bsph_0166"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    183393..183524
                     /locus_tag="Bsph_0166"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    183588..183719
                     /locus_tag="Bsph_0166"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     gene            184381..184632
                     /locus_tag="Bsph_0167"
                     /db_xref="GeneID:6024025"
     CDS             184381..184632
                     /locus_tag="Bsph_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695931.1"
                     /db_xref="GI:169825773"
                     /db_xref="GeneID:6024025"
                     /translation="MFYKGTEGWHWLDAMYFAVVSLIPTGVETGLYPTTSFSKIFTMI
                     YLIVGTGVMFIMLLTLGRSIVDFSLNEEEAVAVKKRLKK"
     misc_feature    184381..184563
                     /locus_tag="Bsph_0167"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:219619"
     gene            complement(184682..184969)
                     /locus_tag="Bsph_0168"
                     /db_xref="GeneID:6024026"
     CDS             complement(184682..184969)
                     /locus_tag="Bsph_0168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695932.1"
                     /db_xref="GI:169825774"
                     /db_xref="GeneID:6024026"
                     /translation="MAQIINEQDIINAICLSQAYYKSIRPEDVIVELTYDDDTGFGAE
                     VEVNGQIEILNTGAMIGALRVWIKDVLHGDPFSTGIELVLDDEEGIIAKLS"
     misc_feature    complement(184697..184969)
                     /locus_tag="Bsph_0168"
                     /note="Protein of unknown function (DUF2653); Region:
                     DUF2653; pfam10850"
                     /db_xref="CDD:151299"
     gene            complement(184957..185421)
                     /locus_tag="Bsph_0169"
                     /db_xref="GeneID:6024027"
     CDS             complement(184957..185421)
                     /locus_tag="Bsph_0169"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695933.1"
                     /db_xref="GI:169825775"
                     /db_xref="GeneID:6024027"
                     /translation="MKKILAALFAATLIFSTVGAALFISDTPTAEAKSYKSGKKGFSN
                     NNNSSNIQKSQDTSKDQKNATTNKNNTNSTNKADTTKKGGFFSGGLMKGLMLGGLAGL
                     LFGSLFSGMGLLGNILGLLINVAAIAVIVMLVVKIMNMFKDKKRKEEAQWHK"
     gene            185894..186622
                     /locus_tag="Bsph_0170"
                     /db_xref="GeneID:6024028"
     CDS             185894..186622
                     /locus_tag="Bsph_0170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695934.1"
                     /db_xref="GI:169825776"
                     /db_xref="GeneID:6024028"
                     /translation="MLAIMGLSFVIMMIGYVFVIFIQIENVLWHILFFYAFLIFGYTM
                     FLYTSVLAYAVLYHFTPIRYEPNYIIALGSGLIGDRVPPLLASRLNEAVKQYKKYGER
                     PFIIVSGGQGTDENVSEAKAMKKYLLDVHDIPANKVLMEDQSTNTEENMIFTKNIMDQ
                     HAQGEKYRSIFVTNNFHVFRASLYAKKAKLDAEGVGSKTAFYYVPNAFTREFIGLLEM
                     NKWAHMTVFLIITLFIGLLLRAYV"
     misc_feature    185906..186511
                     /locus_tag="Bsph_0170"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1434"
                     /db_xref="CDD:224351"
     misc_feature    186095..186538
                     /locus_tag="Bsph_0170"
                     /note="YdcF-like. YdcF-like is a large family of mainly
                     bacterial proteins, with a few members found in fungi,
                     plants, and archaea. Escherichia coli YdcF has been shown
                     to bind S-adenosyl-L-methionine (AdoMet), but a
                     biochemical function has not been...; Region: YdcF-like;
                     cd06259"
                     /db_xref="CDD:99750"
     misc_feature    order(186332..186334,186341..186343,186410..186412,
                     186422..186424,186431..186433,186524..186526)
                     /locus_tag="Bsph_0170"
                     /note="putative active site [active]"
                     /db_xref="CDD:99750"
     gene            186676..187980
                     /locus_tag="Bsph_0171"
                     /db_xref="GeneID:6023459"
     CDS             186676..187980
                     /locus_tag="Bsph_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695935.1"
                     /db_xref="GI:169825777"
                     /db_xref="GeneID:6023459"
                     /translation="MQGRKTMYEQILAKRNKERIQSLQEIMQTKNTMFAQNITLLTFT
                     EVNLTALQKILYQIVRGLLKDQQQRHLQIVHSDQTQSVQDNVLTLLAEYDDVLRDAIP
                     QPIYILIWQISSLERLTSRVEVVDDVLDVVEWYFDHQDDQVKILDEEDLDHEVMIDLY
                     KEAVEDQDTDAQYQLGEYYNAKEGNCFQPEKSLKWFELAAAQGNADAQYVLGNFYFEG
                     VGVEENYTQAFSLYERAALQGHADAANNLADMYFNGEGVPLDFTLARKWFDFAASKNV
                     AEAMFTLGIIYEQGLGVNKDTNAAFNMYKKSAEAGYVEAQYRLGGIYLEGRLDQAKDI
                     NRGLFWYERAAEQFHIDAFYDLGFIWSKGLTGIRNIEKGIHWFKQAALQGDADAKLQL
                     GHIYNNGEGIARNLKEALKWYRLAADAGIEEAAKIVEELKGL"
     misc_feature    187183..187287
                     /locus_tag="Bsph_0171"
                     /note="Sel1 repeat; Region: Sel1; pfam08238"
                     /db_xref="CDD:219757"
     misc_feature    187186..187971
                     /locus_tag="Bsph_0171"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    187288..187395
                     /locus_tag="Bsph_0171"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    187396..187500
                     /locus_tag="Bsph_0171"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    187504..187611
                     /locus_tag="Bsph_0171"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    187612..187722
                     /locus_tag="Bsph_0171"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    187831..187935
                     /locus_tag="Bsph_0171"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            188610..189902
                     /locus_tag="Bsph_0172"
                     /db_xref="GeneID:6023460"
     CDS             188610..189902
                     /locus_tag="Bsph_0172"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_001695936.1"
                     /db_xref="GI:169825778"
                     /db_xref="GeneID:6023460"
                     /translation="MIFQKQSKTKALDLQQYTVKMDLSNRQLMVKQIEMLNVTKQDLQ
                     YLKAFQPYVMDNVDHIVNRFYNMIGTEQHLVNIISHHSSVEKLKVTLRQHIIEMFNGT
                     IDEVYYQRRVKIAKVHVHIGLRTQWYICAFQDLSLSFIDLVEQHIGHPQDQFNTIRAI
                     SKICNFEQQLVLEAYENTVEQHKENMEQEKEVIERQIVQSSELLAAISQETNSSFCRL
                     SEQSGDIEQLAKRSLEVSTLAENQALDGRECLKKQSQNMHNIIQSLHDIEENIEQLSD
                     MSKEMETIMSVVTNIANQTNLLALNAAIEAARAGEAGKGFSVVADEVRKLSIQTKESV
                     TAVALLLQKTSERTEKLEQSLINIQDEVASGEDNMLHTEGQFTNIVGAMTEAKDQNDC
                     MATKIQAIAGILSGLGTSFTEVTNSAEKLASFAQNLKS"
     misc_feature    188700..189128
                     /locus_tag="Bsph_0172"
                     /note="Globin domain present in Globin-Coupled-Sensors
                     (GCS). These domains detect changes in intracellular
                     concentrations of oxygen, carbon monoxyde, or nitrous
                     oxide,  which result in aerotaxis and/or gene regulation.
                     One subgroup, the HemATs, are aerotactic...; Region:
                     sensor_globin; cd01068"
                     /db_xref="CDD:238516"
     misc_feature    order(188799..188804,188829..188831,188838..188843,
                     188853..188855,188865..188870,188877..188882,
                     188889..188891,188949..188951,188961..188963,
                     188970..188972,188976..188978,188991..188993,
                     189003..189005)
                     /locus_tag="Bsph_0172"
                     /note="heme-binding site [chemical binding]; other site"
                     /db_xref="CDD:238516"
     misc_feature    189186..189896
                     /locus_tag="Bsph_0172"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    189261..189854
                     /locus_tag="Bsph_0172"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(189279..189284,189291..189296,189303..189305,
                     189312..189317,189321..189326,189333..189335,
                     189342..189347,189354..189356,189363..189368,
                     189375..189380,189387..189389,189396..189401,
                     189405..189410,189420..189422,189426..189431,
                     189438..189440,189447..189452,189459..189464,
                     189471..189473,189480..189482,189489..189494,
                     189501..189503,189513..189515,189522..189524,
                     189543..189545,189555..189557,189564..189566,
                     189573..189578,189585..189587,189594..189599,
                     189606..189611,189615..189620,189627..189632,
                     189669..189674,189681..189683,189690..189695,
                     189702..189704,189711..189716,189720..189725,
                     189732..189737,189744..189746,189753..189758,
                     189765..189767,189774..189779,189783..189788,
                     189795..189800,189804..189809,189816..189818,
                     189825..189830,189837..189839,189846..189851)
                     /locus_tag="Bsph_0172"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    189489..189590
                     /locus_tag="Bsph_0172"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            190094..190285
                     /locus_tag="Bsph_0173"
                     /db_xref="GeneID:6023461"
     CDS             190094..190285
                     /locus_tag="Bsph_0173"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695937.1"
                     /db_xref="GI:169825779"
                     /db_xref="GeneID:6023461"
                     /translation="MKTVVVLGGGITGLCTMHYLQRQVKEKNLDVQLVLVEKNTYLGG
                     KLYSAYEQVLLWKLVLILL"
     misc_feature    190139..>190246
                     /locus_tag="Bsph_0173"
                     /note="protoporphyrinogen oxidase; Provisional; Region:
                     PRK12416"
                     /db_xref="CDD:183516"
     gene            190258..191487
                     /locus_tag="Bsph_0174"
                     /db_xref="GeneID:6023462"
     CDS             190258..191487
                     /locus_tag="Bsph_0174"
                     /EC_number="1.3.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_001695938.1"
                     /db_xref="GI:169825780"
                     /db_xref="GeneID:6023462"
                     /translation="METGADSIVARHKGVMELVQELDFEDHLVYNETGISYIYTNNEL
                     HAIPADSTFGIPMSVASLEESTLISDQAKQEALKDLTLPNAGFTKESSIGEFLTYYLG
                     EELVENQIAPVLAGVYSGDLHQLSIASTLPYLIDYKNEYGSIIKGFDANREQFVKAAN
                     KKFISFQNGLSSLIERLEQTLTDVDIIKGVATSQVKKMENHYLISLTSGQNIEADYVV
                     LALPNEAVQSILQDDSLTHYFNQFTTASAITIYLGFDVPDANLPADGTGYIVSHNSDV
                     TCNAATWTSRKWKHTSKNNQLLVRLFYKSINPAYEQLRDMTDDELAAVALEDVRKSLG
                     IDEKPTVVNVTKWIDQMPKYDLAHREALQGLLLELNENYPNLSIAGCSYFGVGIGACI
                     QNGKKIGEELAEELSNL"
     misc_feature    190258..191481
                     /locus_tag="Bsph_0174"
                     /note="protoporphyrinogen oxidase; Provisional; Region:
                     PRK12416"
                     /db_xref="CDD:183516"
     gene            191683..193626
                     /locus_tag="Bsph_0175"
                     /db_xref="GeneID:6023463"
     CDS             191683..193626
                     /locus_tag="Bsph_0175"
                     /note="catalyzes the formation of
                     5,10-methylenetetrahydrofolate from
                     5-methyltetrahydrofolate and S-adenosyl-L-homocysteine and
                     methionine from S-adenosyl-L-methionine and
                     L-homocysteine; expressed in B. subtilis under methionine
                     starvation conditions"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional homocysteine
                     S-methyltransferase/5,10-methylenetetrahydrofolate
                     reductase"
                     /protein_id="YP_001695939.1"
                     /db_xref="GI:169825781"
                     /db_xref="GeneID:6023463"
                     /translation="MRRNNNDESLKPSFYIKEGFLLYRDRGREARFMGLLERLKTHVL
                     TADGAIGTVLYGYGLEYCHEEMNVQRPELIEKIHREYIAAGADIIQTNTYGANAIKLA
                     RYGLESSVQRFNEAAITIAKRAAADGGQFVLGTIGGIRGIRKSDATLNDILKTVEEQA
                     SVLLAGNPDGLLLETYYDFEELTATLKMLRAKTNIPIIAQVSMHEPGVLQNGMSLNIA
                     LHELEILGADIVGVNCRLGPYHTIQAFEGVELPEKAFMSAYPNASLLDLEDGRVVYES
                     EADYFGRAAVELRDQGVRLIGGCCGTTPKHIAAAKKYLEELSPVSEKYAKPAKIEIVR
                     DAEPAKYEPLHEKVKRERSVIVELDTPRHLEIEGFLEGAKQLYEAGADVVMMADNSLA
                     SPRISNIAMGALLKSTNGVRPLTHITCRDRNLIGLQSHLMGLNALGIHDVLAVTGDPT
                     KVGDFPGATSVYDVSSMELIQLIKQLNEGVSFSGKPLRKKANFSVAAAFNPNVRVLDR
                     AVARLEKKIEHGADYFISQPVYTKEKMIEIYEATKHLQAPIYIGIMPVTSYKSAEFLH
                     HEVPGIKLSEDALARMKACGEDKERATLEGIAIAKELVEVAAQYFNGIYLITPFLRYD
                     VTLELMKYIEQLDEQKKGVSING"
     misc_feature    191770..192630
                     /locus_tag="Bsph_0175"
                     /note="Methionine synthase I (cobalamin-dependent),
                     methyltransferase domain [Amino acid transport and
                     metabolism]; Region: MetH; cl14105"
                     /db_xref="CDD:246616"
     misc_feature    191779..193608
                     /locus_tag="Bsph_0175"
                     /note="bifunctional homocysteine
                     S-methyltransferase/5,10-methylenetetrahydrofolate
                     reductase protein; Reviewed; Region: PRK08645"
                     /db_xref="CDD:236321"
     misc_feature    192742..193581
                     /locus_tag="Bsph_0175"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    order(192844..192846,192928..192930,193015..193023,
                     193075..193080,193150..193152,193156..193158,
                     193180..193182,193186..193188,193207..193209,
                     193216..193218,193225..193230,193255..193257,
                     193261..193263,193531..193533)
                     /locus_tag="Bsph_0175"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            193619..197050
                     /locus_tag="Bsph_0176"
                     /db_xref="GeneID:6023274"
     CDS             193619..197050
                     /locus_tag="Bsph_0176"
                     /EC_number="2.1.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="YP_001695940.1"
                     /db_xref="GI:169825782"
                     /db_xref="GeneID:6023274"
                     /translation="MAKHLIEEQLDKRILILDGAMGTMLQNENLTADDFGGEELDGCN
                     ENLVLTRPDVIEKIHHKYLEAGADIICTNTFGGTPLVLNEYSLGAKAEEINKRAVEIA
                     RQAVDNYSTSDWPRFVAGAMGPTTKTLSVTGGITFDELEENFYVQAKALIEAGADVLL
                     LETSQDMLNVKAGTLGVTRAFEKTGKELPVMISGTIEPMGTTLAGQTIDAFYISIEHI
                     QPLSVGLNCATGPEFMTDHIRSLAELSTGYISCYPNAGLPDEEGCYHESPESLSQKLK
                     GFAEKGWLNIVGGCCGTTPAHIAAIREALKDEKPRQLPEKTHGHVVSGIEPLLYDDSM
                     RPLFIGERTNVIGSRKFKNLIIDGKFEEAAEIARAQVKNGAHVIDICLANPDRDELAD
                     IRGFMQEVVKKVKVPLVIDSTDEKVIEEALKFSQGKAIINSINLEDGEERFDAVLPLV
                     KKYGASLVVGTIDETGMAVDRHRKLEIAERSYQLLTEKWGIEPEDIIFDPLMFPVGTG
                     DEQYIGSALETIEGIRLIKEKMPRTLTVLGVSNISFGLPPVGREVLNAVYLYHCTQAG
                     LDYAIVNTEKLERYASIPEAEIKLANDLLFNTNDETLAVFTDFYRDKKKEKTEADIPK
                     TVEGRLAYYILEGTKEGLIADLEAAREIFETPLDIINGPLMNGMAEVGRLFNDNQLIV
                     AEVLQSAGVMKAAVAHLEQYMEKNEESAGKGKMVLATVKGDVHDIGKNLVDIILSNNG
                     YKVVDLGIKVTPAQLIEAIRKEKPDFIGLSGLLVKSAQQMVTTAQDFKEAGIDVPILV
                     GGAALSRRFTETKIADEYGGPVIYSKDAMQGLEQANLLMGEGTRENFLAEIAESRQKR
                     LEADEKRAARPAKEVTIKPARTVKEAPVFLPADLRRHVKKEYAVSHLYPYVNMRTLLG
                     HHLGLKGQVQPLLDAGDPRATELKDLVDDYLKSDLLKPSGLYQFFPAQADGDDVIIYD
                     PADSKTEIERFTFPRQQIDPFLCLADFLRTVESGEMDYIALMVVTAGQGVMAKARQLK
                     EDGKFLESHALQSTALELAEGFAERMHQEIRDQWGFPDVTDFTMRDRFAAKYQGQRFS
                     FGYPACPNLEDQEKLFGLLKPEDIGVHLTEGFMMEPEASVSAIVFAHPDARYFNV"
     misc_feature    193634..194536
                     /locus_tag="Bsph_0176"
                     /note="Methionine synthase I (cobalamin-dependent),
                     methyltransferase domain [Amino acid transport and
                     metabolism]; Region: MetH; COG0646"
                     /db_xref="CDD:223719"
     misc_feature    193646..197047
                     /locus_tag="Bsph_0176"
                     /note="5-methyltetrahydrofolate--homocysteine
                     methyltransferase; Region: metH; TIGR02082"
                     /db_xref="CDD:233714"
     misc_feature    194627..195379
                     /locus_tag="Bsph_0176"
                     /note="Pterin binding enzymes. This family includes
                     dihydropteroate synthase (DHPS) and cobalamin-dependent
                     methyltransferases such as methyltetrahydrofolate,
                     corrinoid iron-sulfur protein methyltransferase (MeTr) and
                     methionine synthase (MetH).  DHPS, a...; Region:
                     Pterin_binding; cl00219"
                     /db_xref="CDD:241697"
     misc_feature    order(194648..194650,194849..194851,194912..194914,
                     194918..194920,194996..194998,195113..195115,
                     195230..195232,195242..195244,195329..195331,
                     195335..195337)
                     /locus_tag="Bsph_0176"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238242"
     misc_feature    order(195158..195160,195170..195175,195287..195289,
                     195299..195301,195311..195313,195359..195364)
                     /locus_tag="Bsph_0176"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238242"
     misc_feature    195236..195244
                     /locus_tag="Bsph_0176"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238242"
     misc_feature    195494..196129
                     /locus_tag="Bsph_0176"
                     /note="B12 binding domain of methionine synthase. This
                     domain binds methylcobalamin, which it uses as an
                     intermediate methyl carrier from methyltetrahydrofolate
                     (CH3H4folate) to homocysteine (Hcy); Region:
                     methionine_synthase_B12_BD; cd02069"
                     /db_xref="CDD:239020"
     misc_feature    order(195599..195601,195611..195613,195662..195664,
                     195671..195673,195782..195802,195809..195811,
                     195920..195928,195932..195940,196019..196021,
                     196085..196087,196094..196096,196103..196105)
                     /locus_tag="Bsph_0176"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239020"
     misc_feature    195791..195793
                     /locus_tag="Bsph_0176"
                     /note="cobalt ligand [ion binding]; other site"
                     /db_xref="CDD:239020"
     misc_feature    196643..197047
                     /locus_tag="Bsph_0176"
                     /note="Vitamin B12 dependent methionine synthase,
                     activation domain; Region: Met_synt_B12; pfam02965"
                     /db_xref="CDD:111813"
     gene            197163..197660
                     /locus_tag="Bsph_0177"
                     /db_xref="GeneID:6023275"
     CDS             197163..197660
                     /locus_tag="Bsph_0177"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase yncA"
                     /protein_id="YP_001695941.1"
                     /db_xref="GI:169825783"
                     /db_xref="GeneID:6023275"
                     /translation="MEEKDIPEVLEIYNDIILTSKAVYRYEIQSLDEKVKWFREQQAL
                     GNPLLVFDDNGMVAGFATYSQFRPYPGYKYTMEHSVYVHKEHYQKGIATNLMLQLIEI
                     AKEQGVKTLVAGIDGENIGSIKAHEKLGFEYAGTIKNAGYKFEQWLDLVFYQLHLTGP
                     IHKRI"
     misc_feature    197163..197642
                     /locus_tag="Bsph_0177"
                     /note="Sortase and related acyltransferases [Cell envelope
                     biogenesis, outer membrane]; Region: COG1247"
                     /db_xref="CDD:224168"
     misc_feature    197304..197498
                     /locus_tag="Bsph_0177"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(197400..197408,197436..197441)
                     /locus_tag="Bsph_0177"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            197759..198790
                     /locus_tag="Bsph_0178"
                     /db_xref="GeneID:6023276"
     CDS             197759..198790
                     /locus_tag="Bsph_0178"
                     /EC_number="1.14.19.-"
                     /codon_start=1
                     /transl_table=11
                     /product="Fatty acid desaturase"
                     /protein_id="YP_001695942.1"
                     /db_xref="GI:169825784"
                     /db_xref="GeneID:6023276"
                     /translation="MATIKEKTKKLRQDVAPFAKSDTRKSVFQMINTIVPLIALWVAG
                     YLLVDVSPWLTVGLSVISAGFVVRTFIIFHDCTHGSFFKSKKANDWVGFFTGVLTSFP
                     YEKWKREHTIHHATSSNLDKRGIGDIDMMTVEEYMQASKGQRLWYRFYRNPFVMFGLG
                     PLYMVLVLNRFNRKDAKQKERTNTILTNIVIAGVCAALIFFMGWQAFLLVQGVTLFIA
                     GALGIWLFYIQHTYEDSYFEHDSEWDYVKAAVEGSSYYKLPKILQWVTGNIGFHHVHH
                     LAPRVPNYNLEKAHNETPPLHTATTITLRTSLESLRYKLYDEEQSKFVTFKEVELIIK
                     RKAKGSIAA"
     misc_feature    197801..198766
                     /locus_tag="Bsph_0178"
                     /note="Fatty acid desaturase [Lipid metabolism]; Region:
                     DesA; COG3239"
                     /db_xref="CDD:225779"
     misc_feature    197831..198616
                     /locus_tag="Bsph_0178"
                     /note="The Delta12 Fatty Acid Desaturase
                     (Delta12-FADS)-like CD includes the integral-membrane
                     enzymes, delta-12 acyl-lipid desaturases, oleate
                     12-hydroxylases, omega3 and omega6 fatty acid desaturases,
                     and other related proteins, found in a wide range of...;
                     Region: Delta12-FADS-like; cd03507"
                     /db_xref="CDD:239584"
     misc_feature    order(197978..197980,197990..197992,198086..198088,
                     198095..198100,198572..198574,198581..198586)
                     /locus_tag="Bsph_0178"
                     /note="putative di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239584"
     gene            199113..200063
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /db_xref="GeneID:6023277"
     CDS             199113..200063
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="YP_001695943.1"
                     /db_xref="GI:169825785"
                     /db_xref="GeneID:6023277"
                     /translation="MWISFEMVINIVMTILYGYVYLSIFTAFFIGNIRRPVGFYIMYG
                     LHIGFTVISTGAGFFVELHLFLSQLPFVVLTILAVVLLPLTIYSKNKRENLEGQLETA
                     NERIAELIVFEERQRIARDLHDTLGQKLSMIGLKSDLASRLIERDPQQALVEIKDIRQ
                     TASIALKEVRELVSDMRTAKFEDELMRISQILKAAEMEFVFEGDKNALQVPPLVENVL
                     SMCLKEAVNNVVKHSGATKCEIAFHQNFKEVYLVVRDNGQGITKKQAWKTGNGLKGMR
                     ERLEFINGSFKIESVDGTTLSVTIPVAITHQSVKENLKNI"
     misc_feature    199137..200024
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    199452..199643
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:219540"
     misc_feature    199776..200012
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(199782..199784,199794..199796,199803..199805,
                     199869..199871,199875..199877,199881..199883,
                     199887..199892,199917..199928,199974..199976,
                     199980..199982,199989..199994,199998..200000)
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    199794..199796
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(199881..199883,199887..199889,199917..199919,
                     199923..199925)
                     /gene="desK"
                     /locus_tag="Bsph_0179"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            200092..200691
                     /locus_tag="Bsph_0180"
                     /db_xref="GeneID:6023278"
     CDS             200092..200691
                     /locus_tag="Bsph_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="YP_001695944.1"
                     /db_xref="GI:169825786"
                     /db_xref="GeneID:6023278"
                     /translation="MIAEDQGMLLGALRSLLSMEDDMEVVGLAKNGEEAVMLVEEHQP
                     DICVMDIEMPVKTGLDAAEEMHGSGSDCKVIILTTFARPGYFERARKASVRGYLLKDS
                     PIEELVSAIRTIMDGKRIYAPELVDFVYEDDSENPLTERESQVLTLVAEGKTTKEIAA
                     ELFLSAGTVRNYISTILEKLNVGNRIEAIARFKEKGWNK"
     misc_feature    200092..200682
                     /locus_tag="Bsph_0180"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    200092..200436
                     /locus_tag="Bsph_0180"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(200101..200106,200239..200241,200263..200265,
                     200323..200325,200380..200382,200389..200394)
                     /locus_tag="Bsph_0180"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    200239..200241
                     /locus_tag="Bsph_0180"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(200248..200253,200257..200265)
                     /locus_tag="Bsph_0180"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    200389..200397
                     /locus_tag="Bsph_0180"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    200503..200673
                     /locus_tag="Bsph_0180"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(200506..200514,200551..200559,200581..200586,
                     200590..200595,200599..200613,200644..200646)
                     /locus_tag="Bsph_0180"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(200539..200541,200545..200547,200551..200553,
                     200644..200652,200659..200661,200668..200673)
                     /locus_tag="Bsph_0180"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(200736..201710)
                     /locus_tag="Bsph_0181"
                     /db_xref="GeneID:6021570"
     CDS             complement(200736..201710)
                     /locus_tag="Bsph_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="proline oxidase"
                     /protein_id="YP_001695945.1"
                     /db_xref="GI:169825787"
                     /db_xref="GeneID:6021570"
                     /translation="MLLRDFFIHLSENQLLNSAAKKYGLKLGAQSVVAGTNIEETIAS
                     IKELNAHNISCTVDNLGEFVSSKEEATAAKDKILSVVEAIHENDVKAHISLKPSQLGL
                     DIDVDFCYDNLYEIVEKAAAYDIFVNFDMEDFGRLQTSFDMVEELSKTFSNVGTVIQS
                     YFYRAKDDIEKFKDYRLRIVKGAYKEPVEVAYQDKLDIDLNFIELIEYHLLHGKFTSI
                     ATHDHNIIAHVKRFVADHNIPLDKFEFQMLYGFRTDMQKELAKEGYNFCVYVPFGEDW
                     YGYFMRRLAERPQNLNLVTKQVFTKKTNTVLAVAAGAFVLGRLTKRNK"
     misc_feature    complement(200805..201710)
                     /locus_tag="Bsph_0181"
                     /note="Proline dehydrogenase; Region: Pro_dh; cl03282"
                     /db_xref="CDD:243371"
     gene            complement(201784..202536)
                     /gene="ybbM"
                     /locus_tag="Bsph_0182"
                     /db_xref="GeneID:6021571"
     CDS             complement(201784..202536)
                     /gene="ybbM"
                     /locus_tag="Bsph_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein"
                     /protein_id="YP_001695946.1"
                     /db_xref="GI:169825788"
                     /db_xref="GeneID:6021571"
                     /translation="MTYTSLSLTLIFVCIPLLLSKTLKLGLEKDTLIATLRSIVQLLA
                     VGYILKFVFDANSYMYIFLMVALMILVATFNARKKGEGIKGITWKIALTLVIIEIITQ
                     GVLLGFNIVPATAQYIIPISGMLIGNSMVLSILFLNRFTAEITSHKDQMELILSLGGT
                     PKQAVHRQLINAVKASMIPTIESQKTIGLVQLPGMMSGQIIGGADPIQAVQFQLLIIF
                     ALLTTATLSSIMIGFLSYPALFNERMQILEMK"
     misc_feature    complement(201790..202536)
                     /gene="ybbM"
                     /locus_tag="Bsph_0182"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG0390"
                     /db_xref="CDD:223467"
     gene            complement(202533..203264)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /db_xref="GeneID:6021572"
     CDS             complement(202533..203264)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /EC_number="3.6.3.27"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate import ATP-binding protein pstB 1"
                     /protein_id="YP_001695947.1"
                     /db_xref="GI:169825789"
                     /db_xref="GeneID:6021572"
                     /translation="MNTLYEPAIHFQQVQFSVNDKMILKSITGSFPKGQITTLVGPSG
                     AGKTTLLKLCNGLLSPTNGQILIDNEPISNYEPSALRRHVGIALQAAPMIAGTVKENI
                     ALPRTLQGKKLSQQEAIQYLEDVGLDESFLYQSTNELSGGQRQKVSIARTLINQSSIL
                     LLDEITSALDRQSVKDIEKLIVTINQKYNVTMIWITHNLQQALTIGHYTWVMMNGELI
                     ETGKSALLKAPTNPRVAEFVQGASI"
     misc_feature    complement(202545..203240)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="phosphate ABC transporter ATP-binding protein;
                     Provisional; Region: PRK14250"
                     /db_xref="CDD:237648"
     misc_feature    complement(202596..203240)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="ATP-binding cassette domain of the phosphate
                     transport system; Region: ABC_PstB_phosphate_transporter;
                     cd03260"
                     /db_xref="CDD:213227"
     misc_feature    complement(203121..203144)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(order(202674..202676,202773..202778,
                     202998..203000,203118..203126,203130..203135))
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(202998..203009)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(202821..202850)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(202773..202790)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="Walker B; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(202755..202766)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="D-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(202668..202688)
                     /gene="pstB"
                     /locus_tag="Bsph_0183"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213227"
     gene            203364..203864
                     /gene="adaB"
                     /locus_tag="Bsph_0184"
                     /db_xref="GeneID:6021573"
     CDS             203364..203864
                     /gene="adaB"
                     /locus_tag="Bsph_0184"
                     /EC_number="2.1.1.63"
                     /codon_start=1
                     /transl_table=11
                     /product="O6-methylguanine-DNA methyltransferase"
                     /protein_id="YP_001695948.1"
                     /db_xref="GI:169825790"
                     /db_xref="GeneID:6021573"
                     /translation="MEKLYFDTLTFAQGSMYIVASNNGLAYIGTPNASFDEVKEWAKK
                     PFKGYSFEENQEQLQPYKEQLTAYFNKELTEFDVPIHVKGTPFQLAVWDALKELPYGS
                     TTSYGSIAERIGNPKAVRAVGSAIGANPILAIIPCHRVIGKNGQLTGFRSGLDVKQFL
                     LELEKA"
     misc_feature    203370..203861
                     /gene="adaB"
                     /locus_tag="Bsph_0184"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    203622..203858
                     /gene="adaB"
                     /locus_tag="Bsph_0184"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(203622..203627,203679..203684,203706..203708,
                     203715..203717,203721..203726,203730..203732,
                     203739..203744,203748..203750,203772..203774,
                     203787..203789,203808..203810)
                     /gene="adaB"
                     /locus_tag="Bsph_0184"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(203679..203681,203772..203777,203781..203783,
                     203853..203855)
                     /gene="adaB"
                     /locus_tag="Bsph_0184"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            complement(203931..205232)
                     /locus_tag="Bsph_0185"
                     /db_xref="GeneID:6021574"
     CDS             complement(203931..205232)
                     /locus_tag="Bsph_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="YP_001695949.1"
                     /db_xref="GI:169825791"
                     /db_xref="GeneID:6021574"
                     /translation="MEEIILSVNLIWVMLGTILVFFMHAGFAMVEAGFTRSKNAVNII
                     MKNFLTISLGGIVYFLCGYAIMFGDTVGGIFGISGFALNGVDDLSFFIFQAMFAATGA
                     TILSGAVAERTNIFAYIGIIILMSLVVYPVVGHWVWSGQGWLTDLGFVDFAGSTVVHL
                     TGAVAAFVAAVMVGPRLGKYENGRVNVITGHSIPLGALGVFLLWFGWFGFNGASTLAA
                     DPELVPNVIANTFFAAAAGVVATAFYTKFRYGHIDGSLTLNGALAGLVGITAGAANVS
                     IIGSIIIGLIAAPLLVEGVRFLEWKLKVDDPVGAIAVHGICGVWGTLAVGLFDSNGQG
                     LFYGGGLSLLGIQAVGVIATIAWVSVSVTAGIFIIKAFVPLRVTAEEEIAGLDVIEHG
                     APAYEFQDIFKSSAVRGETFAHRLTHFGKTQSNVQQEEQHI"
     misc_feature    complement(204039..205214)
                     /locus_tag="Bsph_0185"
                     /note="Ammonia permease [Inorganic ion transport and
                     metabolism]; Region: AmtB; COG0004"
                     /db_xref="CDD:223083"
     gene            complement(205246..205587)
                     /locus_tag="Bsph_0186"
                     /db_xref="GeneID:6023012"
     CDS             complement(205246..205587)
                     /locus_tag="Bsph_0186"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II (PII signal
                     transducing protein)"
                     /protein_id="YP_001695950.1"
                     /db_xref="GI:169825792"
                     /db_xref="GeneID:6023012"
                     /translation="MKKIEVIIRPEVFGAVRDGLAQQGIAGLSVSEIAGCGRQLGRTG
                     LFRGNTYEIEFLPKLKLEMIVDDSKVDGIVEILLREAATGKVGDGKIFIYPVEQAIRI
                     RTKEVGSIAVE"
     misc_feature    complement(205276..205578)
                     /locus_tag="Bsph_0186"
                     /note="Nitrogen regulatory protein P-II; Region: P-II;
                     pfam00543"
                     /db_xref="CDD:201295"
     misc_feature    complement(205276..205578)
                     /locus_tag="Bsph_0186"
                     /note="Nitrogen regulatory protein P-II; Region: P-II;
                     smart00938"
                     /db_xref="CDD:198006"
     gene            205960..207360
                     /locus_tag="Bsph_0187"
                     /db_xref="GeneID:6023013"
     CDS             205960..207360
                     /locus_tag="Bsph_0187"
                     /EC_number="2.4.2.11"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="YP_001695951.1"
                     /db_xref="GI:169825793"
                     /db_xref="GeneID:6023013"
                     /translation="MAESYWADGIHNKKAIFELYFRKLPFGNGYAIFAGLERMLDYLR
                     NFRFSESDITYLREEVGYKEDFIEYLKDIRFTGDMYSMVEGELVFANEPIVRIEAPLV
                     EAQLIETALLNIVNYQTLIATKASRIKQIIKNEVAMEFGTRRAQEMDAAIWGTRAAFI
                     GGFASTSNVRAGKLFNIPVSGTHAHALVQAYKNDYDAFHSYAKRHRDCVFLVDTYNTL
                     KSGVPTAIKVAKELGDKINFIGIRLDSGDIAFLSKEARRMLDAAGFHDAKIIVSNDLD
                     EYTILNLKAQGAKVDVWGIGTKLITAYDQPALGAVYKMVAIENSEGQLEDTIKISANA
                     EKVTTPGLKNVYRIIDKKNGKAEGDYIAMQDENPQEEERIKMFHPIHTFVSKFVTNFE
                     AKNLHQHVIHHGEINYTNPTLEEMRDYAAGNLELLWDEYKRAMNPEEYPVDLSQKCWD
                     NKMRNIEEVHNMVKQM"
     misc_feature    205960..207303
                     /locus_tag="Bsph_0187"
                     /note="nicotinate phosphoribosyltransferase; Validated;
                     Region: PRK09243"
                     /db_xref="CDD:236426"
     misc_feature    205960..206904
                     /locus_tag="Bsph_0187"
                     /note="Nicotinate phosphoribosyltransferase (NAPRTase),
                     subgroup A. Nicotinate phosphoribosyltransferase catalyses
                     the formation of NAMN and PPi from 5-phosphoribosy
                     -1-pyrophosphate (PRPP) and nicotinic acid, this is the
                     first, and also rate limiting, reaction...; Region:
                     NAPRTase_A; cd01570"
                     /db_xref="CDD:238804"
     misc_feature    order(206383..206391,206455..206460,206689..206691,
                     206773..206778,206839..206841,206845..206850,
                     206857..206859)
                     /locus_tag="Bsph_0187"
                     /note="active site"
                     /db_xref="CDD:238804"
     gene            207379..208203
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /db_xref="GeneID:6023014"
     CDS             207379..208203
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /EC_number="6.3.1.5"
                     /note="catalyzes the formation of nicotinamide adenine
                     dinucleotide (NAD) from nicotinic acid adenine
                     dinucleotide (NAAD) using either ammonia or glutamine as
                     the amide donor and ATP; ammonia-utilizing enzymes include
                     the ones from Bacillus and Escherichia coli while
                     glutamine-utilizing enzymes include the Mycobacterial one;
                     forms homodimers"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="YP_001695952.1"
                     /db_xref="GI:169825794"
                     /db_xref="GeneID:6023014"
                     /translation="MTLQQQIIEELRVQPTINAQEEIRKSIDFLKEYAKHYSFVKGFV
                     LGISGGQDSTLTGKLAQLAVDELNKEVGEMKYSFWAIRLPYGVQADEQDCQDAIDYIK
                     PTGSYTVNIKDAVDASVKALANAGVELNDFVKGNEKARERMKVQYSIAAMNGGVVLGT
                     DHAAEAITGFYTKFGDGGADLMPIFRLNKRQGKQLLAELNCPEHLYTKVPTADLEENR
                     PSLPDEVALGVSYDQIDDYLEGKEIPEEPRQLLEGYYLRSQHKRHMPITIFDVFWK"
     misc_feature    207427..208200
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="NAD synthase [Coenzyme metabolism]; Region: NadE;
                     COG0171"
                     /db_xref="CDD:223249"
     misc_feature    207427..208164
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="NAD+ synthase is a homodimer, which catalyzes the
                     final step in de novo nicotinamide adenine dinucleotide
                     (NAD+) biosynthesis, an amide transfer from either ammonia
                     or glutamine to nicotinic acid adenine dinucleotide
                     (NaAD). The conversion of NaAD to NAD...; Region:
                     NAD_synthase; cd00553"
                     /db_xref="CDD:238309"
     misc_feature    order(207451..207456,207463..207465,207472..207477,
                     207697..207699,207700..207702,207709..207714,
                     207721..207726,207775..207777,207787..207789,
                     207796..207801,207805..207813,207817..207825,
                     207829..207834,207895..207900,207907..207924,
                     207931..207936,208156..208158,208162..208164)
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238309"
     misc_feature    order(207511..207522,207535..207537,207619..207627,
                     207772..207774,207784..207786,207793..207798,
                     207802..207804,207856..207858,207871..207873,
                     207886..207897,207904..207906,208009..208014,
                     208018..208020,208054..208056,208156..208161)
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    order(207514..207522,207532..207537,207622..207627,
                     207802..207804,207856..207858,207943..207945,
                     208006..208011)
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="ATP binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    order(207520..207522,207532..207534,207871..207873,
                     208009..208011)
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    order(207649..207651,207997..208020,208036..208059)
                     /gene="nadE"
                     /locus_tag="Bsph_0188"
                     /note="active-site loop [active]"
                     /db_xref="CDD:238309"
     gene            208361..208681
                     /locus_tag="Bsph_0189"
                     /db_xref="GeneID:6023015"
     CDS             208361..208681
                     /locus_tag="Bsph_0189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695953.1"
                     /db_xref="GI:169825795"
                     /db_xref="GeneID:6023015"
                     /translation="MRTSRVNATTSSVFRQENQYLHAGDISHNFGQNPQNLFKNSLQR
                     NKEKKRSSINTPNQQKQHQQTAPIHMDSTNDLQIRRELNETALKLSRLSRQKKLLNSY
                     RSSI"
     gene            208888..209526
                     /locus_tag="Bsph_0190"
                     /db_xref="GeneID:6023016"
     CDS             208888..209526
                     /locus_tag="Bsph_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695954.1"
                     /db_xref="GI:169825796"
                     /db_xref="GeneID:6023016"
                     /translation="MKKLWLPALLLLLLAACNSEKPQVKEKGSEQDATEMETEVVDDS
                     VQVASLVDSRLQEPKEDTVCEMCNMKVYMKDHEMGVFSTQAIKEDGTIAFYDDIGCLL
                     NAEVANEEKNAKFVRDFVTKEWAKVEDVTIVKTELKSPMNWGYIYFVNKAEADTYIQE
                     NPNAYVEELQKIKDDALERRKKMMEKKAKEESGDSSSMHSNEMNHGQEGHGH"
     gene            209562..210857
                     /locus_tag="Bsph_0191"
                     /db_xref="GeneID:6021604"
     CDS             209562..210857
                     /locus_tag="Bsph_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding periplasmic protein"
                     /protein_id="YP_001695955.1"
                     /db_xref="GI:169825797"
                     /db_xref="GeneID:6021604"
                     /translation="MLNKVVNVMKRICLFVLFFLWASQTANAEFDLQLAIDQAKPGEI
                     VHIPAGRYQGNFIVKKPIKLLGEKGVELYSQNTEPALKIDHTANVSIENIMISAKNKG
                     IVVNETENLKLKAIEIKNIQVGIHIQRSKHIRIVENKIVGNQLHYAEKGNGVAVFKSE
                     DIAIEHNAIDLVQDGIYVEEAKQIDVRQNEVTNSRYGTHFMYSSDVKVDYNSYFQNVT
                     GLMVMMTTDLEIARNTVRNHNDFNSYGLLMYDTQQAKVRKNSFQNNRVGVALQKCSVI
                     QIQENRFQMNQTALEGTKVDKHSIIKDNQFTGNILTARSDQQGLRLVRNFYDDYRGID
                     VAGDGFGDVPYVAVSSFGQWMVRQPVYQFFVASPSVMILTSLDQQVNKTEQNLLVDNE
                     PRLISHTKEKGLSINILQFIIGLVVTMGGFWLWKRGMLV"
     misc_feature    209655..210743
                     /locus_tag="Bsph_0191"
                     /note="nitrous oxide reductase family maturation protein
                     NosD; Region: NosD_copper_fam; TIGR04247"
                     /db_xref="CDD:234521"
     gene            210896..211306
                     /locus_tag="Bsph_0192"
                     /db_xref="GeneID:6021605"
     CDS             210896..211306
                     /locus_tag="Bsph_0192"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_001695956.1"
                     /db_xref="GI:169825798"
                     /db_xref="GeneID:6021605"
                     /translation="MGGCSGKVYNPRDIISETDICEICNMSIVHQEYAGQIVLTNGDY
                     KIFDDIGCLMDYLTLNGEGEIGAAYIKNKANNEWIDVYKATYVYNPGYWTPMNYGVLA
                     FATEAEAQEWMTNEGEGQLLAYQDLLTFNWGIHK"
     misc_feature    210902..211273
                     /locus_tag="Bsph_0192"
                     /note="NosL; Region: NosL; cl01769"
                     /db_xref="CDD:242698"
     gene            211306..212106
                     /locus_tag="Bsph_0193"
                     /db_xref="GeneID:6021606"
     CDS             211306..212106
                     /locus_tag="Bsph_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695957.1"
                     /db_xref="GI:169825799"
                     /db_xref="GeneID:6021606"
                     /translation="MFVKIELKQILRSHWMQLVAFLFTFVFVAIIVIQRMALPDMEGF
                     TRQTASFLNVLLFLLPLFIITIGSMSLAGDIESGWFSLLKTYPMKIAQYIIGKYVAIS
                     LAFLLVVLVAFGVVLALGGLLDGVQLPIILVILTLLCIFIFVSLGIVLGAMAKTRLFA
                     LALSLVVWSFFLLLISYALMALGAVVAGHVLQKLTIISIHINPVEWLRFGYFIFTHQA
                     SVLGPAFYGVTKFYSSPEGHVMYVIVTLLWIILPLILATKFLKEDPKR"
     gene            212103..212783
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /db_xref="GeneID:6021607"
     CDS             212103..212783
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /codon_start=1
                     /transl_table=11
                     /product="lantibiotic ABC transporter ATP-binding protein"
                     /protein_id="YP_001695958.1"
                     /db_xref="GI:169825800"
                     /db_xref="GeneID:6021607"
                     /translation="MILLEAKNVANVYGNGRGLKEATFTLHSGKILALVGGNGAGKST
                     LIRLLTGQEKKKSGEMIWHKPQVIRYMPDDVNFPIMLTAAEIFELLASLKQVDQDEQE
                     RILKRVSLWDVRNQPAKQFSKGMLQRLNLAQSLLGSGSLLILDEPTNGLDPFWIAQLK
                     HVMIEEKKKGNTVIFSTHLLSFAEEIADDVLVLHDGEIIISGPITEIFTQENSTSLEE
                     IWLKRLEL"
     misc_feature    212112..212768
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="gallidermin-class lantibiotic protection ABC
                     transporter, ATP-binding subunit; Region: galliderm_ABC;
                     TIGR03740"
                     /db_xref="CDD:163452"
     misc_feature    212112..212696
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    212208..212231
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(212217..212222,212226..212234,212319..212321,
                     212535..212540,212634..212636)
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    212310..212321
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(212367..212369,212466..212492)
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    212523..212540
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    212547..212558
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    212622..212642
                     /gene="srtF"
                     /locus_tag="Bsph_0194"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            212976..213920
                     /locus_tag="Bsph_0195"
                     /db_xref="GeneID:6021608"
     CDS             212976..213920
                     /locus_tag="Bsph_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="methanol dehydrogenase regulatory protein"
                     /protein_id="YP_001695959.1"
                     /db_xref="GI:169825801"
                     /db_xref="GeneID:6021608"
                     /translation="MNSQIQNVLENIEKVMIGKREVAELSLVALLARGHVLLEDVPGV
                     GKTMMVRSLAKSFDAQFKRIQFTPDLLPSDVVGISIYNPKTLEFEFRPGPIMGDVILA
                     DEINRTSPKTQSALLEGMEEASVTIDGKTLAINQPFFVMATQNPIEHEGTYPLPEAQL
                     DRFLLKIKMGYPTRGQEVEILRRAENGKAIEKIDAVLSVAQLIELQELVQGVYVEDSV
                     KNYMVELATQTRENSYVYLGVSPRATLALMKASQAYAFMKGRSYVIPDDVQYLVPFVF
                     SHRLVLKPDARYDNVTANEIIERIIAKTPVPTKRFAEQ"
     misc_feature    212976..213896
                     /locus_tag="Bsph_0195"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    213072..213488
                     /locus_tag="Bsph_0195"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    213093..213116
                     /locus_tag="Bsph_0195"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(213096..213119,213282..213284,213405..213407)
                     /locus_tag="Bsph_0195"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    213270..213287
                     /locus_tag="Bsph_0195"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    213459..213461
                     /locus_tag="Bsph_0195"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            213917..215098
                     /locus_tag="Bsph_0196"
                     /db_xref="GeneID:6023901"
     CDS             213917..215098
                     /locus_tag="Bsph_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695960.1"
                     /db_xref="GI:169825802"
                     /db_xref="GeneID:6023901"
                     /translation="MRQWKAFLEKSKHFLLVVFLMVVTFCYAMFQGGFVSWFVFFTVS
                     PFLVYALFFFVVRESILVVERKIEPSHIERGQSAKVTISVERKTRFPFAYMMMEELVD
                     SEGLVQAKLQSSAAIKFVGFRKKFNWHYELVNMPRGEHRYLGVTIAFYDFFGWAKKMV
                     VAEKEQTILVYPRLREMKYSALQTKYDVGPMMSPYSIVKDTTMSVGLREYVPGDRFSW
                     IHWKSFAKTQTLQSKEFEDRQSSELMLVLDAKKSTLFEDKIELVASMLNMIVQELGDI
                     SFIAAGEMTKVFPVIQGEKQLDQVMYHLAAIKPTENVKFRFYDQQAFKQVATLLYVTN
                     EVSDEFLHTLANIVKSCICFVVTKQPPVQSEVTLRYKHIQMVYVDPTDFYHVFTGVMK
                     P"
     misc_feature    213995..>214864
                     /locus_tag="Bsph_0196"
                     /note="Uncharacterized conserved protein (some members
                     contain a von Willebrand factor type A (vWA) domain)
                     [General function prediction only]; Region: COG1721"
                     /db_xref="CDD:224635"
     misc_feature    214532..214732
                     /locus_tag="Bsph_0196"
                     /note="Protein of unknown function DUF58; Region: DUF58;
                     pfam01882"
                     /db_xref="CDD:216761"
     gene            215095..217278
                     /locus_tag="Bsph_0197"
                     /db_xref="GeneID:6023902"
     CDS             215095..217278
                     /locus_tag="Bsph_0197"
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase-like cysteine protease"
                     /protein_id="YP_001695961.1"
                     /db_xref="GI:169825803"
                     /db_xref="GeneID:6023902"
                     /translation="MKQSLGEFLELAVAYIIVFFILREWLMPIMQLTNTGGFHLFLVF
                     IGLSLALSLFRVHPVLSGIVKLGYIIWCIVFIYSESPVLSGKTISFLLAEWKGNMAAI
                     ISGDFGLVSDAFRTVLFLVLIWMLVYLIHHWVSVRKNIFYFFVMTVFFIATLDTFSEY
                     NGKTAIVKVVILGLMMTGVLFVKRLWLQAGTTSNAFGKWKIVIPMLVSVILFGSIAFF
                     LPKTGPTWADPVPFIQGVTGQDGNGAGMKSVGYSQDDSQLGGPFQGDNTLIFTASSRD
                     RHYWRVETKDTYTSKGWILSEGNFGKNVYESNAPIMTSLQVGLPENERQIQLDIAASM
                     PFLIQTYGLLSVSAQDSTLFIQDEQTERMTIEQQNDTSKSLSNYTLSYSEPVYSMEQL
                     QLSLPATLETLDLSFDRFMQLPVELPQRVRDLALAITQDETTVYDQIKAVEGYFRTNG
                     FRYDKTQAAIPAENQDYVDQFLFDTKVGYCDNFSTSMVVLLRSIGIPARWVKGFAPGT
                     AGPMTDGLREYRITNDNAHSWVEAYIPGTGWMEFEPTIGFSGNANIDYDIPLDTSEQE
                     EILQPEQKPEQPQQQEQVSNKEQSKSTFSLDMLWAWMKKFAYVWGIGLILLLISGIAL
                     YLQRKTWLPKMHVRAYRKKTADWSTFDSSYHILLKQLSRIGLRMRDGETLHMFAERVD
                     ASLETDEMQKLTAVYEQHVYGKDKQEVDFIKLKESWEYLINRTIG"
     misc_feature    <216352..216738
                     /locus_tag="Bsph_0197"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    216358..216726
                     /locus_tag="Bsph_0197"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:216735"
     misc_feature    217054..>217203
                     /locus_tag="Bsph_0197"
                     /note="Domain of unknown function (DUF4129); Region:
                     DUF4129; pfam13559"
                     /db_xref="CDD:222220"
     gene            217528..219120
                     /locus_tag="Bsph_0198"
                     /db_xref="GeneID:6023903"
     CDS             217528..219120
                     /locus_tag="Bsph_0198"
                     /EC_number="6.3.5.2"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="YP_001695962.1"
                     /db_xref="GI:169825804"
                     /db_xref="GeneID:6023903"
                     /translation="MNDPLIIVEEVEILTASPLLKEQEKIVVLDFGSQFNQLITRRIR
                     EFGVFSELHPHTVTAEEIKEMNAAGIIFSGGPNSVYDENAFHVDPAIFELGLPILGIC
                     YGMQLMAHTNGGKVEGAETREYGKAEIKVTASNKLFGELPTEQIVWMSHGDHVTEVPA
                     GFEVIATSASCPIAAMANVERKLYAVQFHPEVRHSVYGNDLLRQFVFDVCEAKGDWSM
                     ANFIELEIAKIREIVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCMFVDHNLNRKG
                     EVEQVMKTFTEDFDMNLIKIDARKRFMDKLAGVSDPEKKRKIIGNEFIYVFDEEASKL
                     EGMDFLAQGTLYTDIIESGTSTAQTIKSHHNVGGLPEDMQFQLIEPLKTLFKDEVRAL
                     GLELGLDEKIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDFILREEIANAGLDRDIW
                     QYFTVLPDIRSVGVMGDARTYDYAIGIRAVTSIDGMTSDWARIPWDVLEKISVRLVNE
                     VKHVNRVVYDITSKPPATIEWE"
     misc_feature    217594..219117
                     /locus_tag="Bsph_0198"
                     /note="GMP synthase; Reviewed; Region: guaA; PRK00074"
                     /db_xref="CDD:234614"
     misc_feature    217603..218145
                     /locus_tag="Bsph_0198"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in GMP synthetase; Region: GATase1_GMP_Synthase;
                     cd01742"
                     /db_xref="CDD:153213"
     misc_feature    order(217624..217629,217747..217755,217831..217836,
                     217975..217977,218092..218094)
                     /locus_tag="Bsph_0198"
                     /note="AMP/PPi binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153213"
     misc_feature    order(217750..217752,217834..217836)
                     /locus_tag="Bsph_0198"
                     /note="candidate oxyanion hole; other site"
                     /db_xref="CDD:153213"
     misc_feature    order(217831..217833,218092..218094,218098..218100)
                     /locus_tag="Bsph_0198"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153213"
     misc_feature    order(217843..217845,217978..217980,218086..218088)
                     /locus_tag="Bsph_0198"
                     /note="potential glutamine specificity residues [chemical
                     binding]; other site"
                     /db_xref="CDD:153213"
     misc_feature    218236..219114
                     /locus_tag="Bsph_0198"
                     /note="The C-terminal domain of GMP synthetase. It
                     contains two subdomains; the ATP pyrophosphatase domain
                     which closes to the N-termial and the dimerization domain
                     at C-terminal end. The ATP-PPase is a twisted,
                     five-stranded parallel beta-sheet sandwiched...; Region:
                     GMP_synthase_C; cd01997"
                     /db_xref="CDD:238955"
     misc_feature    order(218236..218310,218314..218346,218350..218382,
                     218413..218526,218542..218589,218608..218637,
                     218650..218724,218740..218784)
                     /locus_tag="Bsph_0198"
                     /note="ATP Binding subdomain [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    order(218248..218256,218260..218271,218323..218325,
                     218329..218331,218683..218685)
                     /locus_tag="Bsph_0198"
                     /note="Ligand Binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    order(218809..218847,218872..218901,218908..218940,
                     218950..218997,219016..219042,219046..219114)
                     /locus_tag="Bsph_0198"
                     /note="Dimerization subdomain; other site"
                     /db_xref="CDD:238955"
     gene            219249..219962
                     /locus_tag="Bsph_0199"
                     /db_xref="GeneID:6023904"
     CDS             219249..219962
                     /locus_tag="Bsph_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695963.1"
                     /db_xref="GI:169825805"
                     /db_xref="GeneID:6023904"
                     /translation="MNAKEMILFRLGGIQMEKNKPIIHTLAVGMPKELIDSKGRSMIT
                     GIEKQKIQEVYLSAHGFDGDDVADKKHHGGPDRAVCLYPAEHYIQWEQELGKPLPTAA
                     FGENLTVTNMLEADTCIGDIYKIGDAVIQITQGRVPCSTIDKYTESNTLLKRMIETGY
                     TGFLGRVLEEGTICASSNIELVEKHPAQVSVLYCNEVYFKNKDADAMKHIRAVDALAE
                     DWKQKLEKRIQVLQSKVMN"
     misc_feature    219315..219935
                     /locus_tag="Bsph_0199"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2258"
                     /db_xref="CDD:225167"
     misc_feature    219423..219791
                     /locus_tag="Bsph_0199"
                     /note="MOSC domain; Region: MOSC; pfam03473"
                     /db_xref="CDD:217583"
     misc_feature    219810..219944
                     /locus_tag="Bsph_0199"
                     /note="3-alpha domain; Region: 3-alpha; pfam03475"
                     /db_xref="CDD:202656"
     gene            220438..221229
                     /locus_tag="Bsph_0200"
                     /db_xref="GeneID:6023905"
     CDS             220438..221229
                     /locus_tag="Bsph_0200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695964.1"
                     /db_xref="GI:169825806"
                     /db_xref="GeneID:6023905"
                     /translation="MFDELGTNYRREIIGGITTFLAMAYILAVNPGILENAGMDKGAV
                     FVATALAAAVGSLIMGIFAKFPISLAPGMGLNAFFAFTVVGAYGIPWQTGLTGVFFSG
                     IIFIILSLTGIRETVINAIPVQLKYAVSAGIGLFITFVGLQGAGIVVDSPATLVTLGT
                     FTGSTLLAVFGIVLSVILIIKLRSVGIFLGMVITAIIGMVTGIIEPPTAIVSAIPSVD
                     STFMVALEPLGDIKSLFNVKFLVVVLTFLFVDFFDTAGTLMAVAT"
     misc_feature    220441..>221103
                     /locus_tag="Bsph_0200"
                     /note="Xanthine/uracil/vitamin C permease [Nucleotide
                     transport and    metabolism]; Region: COG2252"
                     /db_xref="CDD:225161"
     gene            221278..221724
                     /locus_tag="Bsph_0201"
                     /db_xref="GeneID:6024016"
     CDS             221278..221724
                     /locus_tag="Bsph_0201"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695965.1"
                     /db_xref="GI:169825807"
                     /db_xref="GeneID:6024016"
                     /translation="MADALATTIGSLFGTSTTTAYVESTSGVAAGARSGFSAVVTAVL
                     FLVALFFSPLLAVVTPAVTAPALVIVGVLMVSSLRLIDWDKFEIAVPAFFTVLMMPLG
                     YSIATGIAIGFVFYPITMLLAGRRKEIHPMMYGLFFVFLAYFIWVR"
     misc_feature    <221278..221718
                     /locus_tag="Bsph_0201"
                     /note="Xanthine/uracil/vitamin C permease [Nucleotide
                     transport and    metabolism]; Region: COG2252"
                     /db_xref="CDD:225161"
     gene            222209..223753
                     /locus_tag="Bsph_rRNA0516S"
                     /db_xref="GeneID:6024017"
     rRNA            222209..223753
                     /locus_tag="Bsph_rRNA0516S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6024017"
     gene            224077..226988
                     /locus_tag="Bsph_rRNA0523S"
                     /db_xref="GeneID:6024018"
     rRNA            224077..226988
                     /locus_tag="Bsph_rRNA0523S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6024018"
     gene            227181..227287
                     /locus_tag="Bsph_rRNA055S"
                     /db_xref="GeneID:6024019"
     rRNA            227181..227287
                     /locus_tag="Bsph_rRNA055S"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:6024019"
     gene            227603..227719
                     /locus_tag="Bsph_0205"
                     /db_xref="GeneID:6022044"
     CDS             227603..227719
                     /locus_tag="Bsph_0205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695966.1"
                     /db_xref="GI:169825808"
                     /db_xref="GeneID:6022044"
                     /translation="MVSTFLGIKEYRFILVVLHSFLLLLILGIYIKALYGFY"
     gene            227869..228063
                     /locus_tag="Bsph_0206"
                     /db_xref="GeneID:6022045"
     CDS             227869..228063
                     /locus_tag="Bsph_0206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695967.1"
                     /db_xref="GI:169825809"
                     /db_xref="GeneID:6022045"
                     /translation="MGKKQIWYEVQENESIEECLERMRNDGYMAIGRKEEPLFHLVDG
                     EPTLLRQKIQFKAILTQDME"
     misc_feature    227887..228045
                     /locus_tag="Bsph_0206"
                     /note="NETI protein; Region: NETI; pfam14044"
                     /db_xref="CDD:206214"
     gene            complement(228070..228273)
                     /locus_tag="Bsph_0207"
                     /db_xref="GeneID:6022046"
     CDS             complement(228070..228273)
                     /locus_tag="Bsph_0207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695968.1"
                     /db_xref="GI:169825810"
                     /db_xref="GeneID:6022046"
                     /translation="MDLLIKAKSAFPHSPAFTVPGRDTRANPLAYMWDLFVFPYHILT
                     RDRIIVNAKMRTFFYNLKKTFGF"
     gene            228463..228951
                     /locus_tag="Bsph_0208"
                     /db_xref="GeneID:6022047"
     CDS             228463..228951
                     /locus_tag="Bsph_0208"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase
                     catalytic subunit"
                     /protein_id="YP_001695969.1"
                     /db_xref="GI:169825811"
                     /db_xref="GeneID:6022047"
                     /translation="MNPKIGVIMGSSSDWETMKHACDILDELQVPYEKKVVSAHRTPD
                     LMFEYAEAARKRGIQVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALNGLDSLLSI
                     VQMPGGVPVATVAIGKAGATNAGLLAAQILSTTDAELADKLDARREATKQQVLESTGD
                     LV"
     misc_feature    228463..228945
                     /locus_tag="Bsph_0208"
                     /note="Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase
                     [Nucleotide transport and metabolism]; Region: PurE;
                     COG0041"
                     /db_xref="CDD:223119"
     gene            228948..230072
                     /locus_tag="Bsph_0209"
                     /db_xref="GeneID:6022989"
     CDS             228948..230072
                     /locus_tag="Bsph_0209"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase ATPase"
                     /protein_id="YP_001695970.1"
                     /db_xref="GI:169825812"
                     /db_xref="GeneID:6022989"
                     /translation="MTKIIYPGQTIGIIGGGQLGRMMALAAKESGFKIAVLEPAMDSP
                     CGQVADVRIVAPYDDEAALEELAEVSDVITYEFENIDYEGLKRLSQMAYVPQGAELVR
                     ITQNRITEKDAIVRAGCPVAPYIVAKTYEELVANIDSIGYPCIVKTARGGYDGKGQQL
                     LTSTEDLPLAKELFMHSPCIAEGFVPFVKEVSVIVQRNGSGESYCQPVGENIHVHHIL
                     HETIVPARITESTAQAAEREALKIADYLHLVGTLAVEMFVLEDGGIVINELAPRPHNS
                     GHYSIEACNVSQFHQHIRAVCGWPLRKPELWAPSIMINVLGQHVVPLSNSIAKYPEWS
                     IHLYGKAEAKVNRKMGHVTIMTKNLEETLQQIESSGIWSE"
     misc_feature    228999..230048
                     /locus_tag="Bsph_0209"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; Reviewed; Region: PRK06019"
                     /db_xref="CDD:235674"
     misc_feature    229293..229799
                     /locus_tag="Bsph_0209"
                     /note="ATP-grasp domain; Region: ATP-grasp; pfam02222"
                     /db_xref="CDD:216935"
     gene            230086..231381
                     /locus_tag="Bsph_0210"
                     /db_xref="GeneID:6022990"
     CDS             230086..231381
                     /locus_tag="Bsph_0210"
                     /EC_number="4.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="YP_001695971.1"
                     /db_xref="GI:169825813"
                     /db_xref="GeneID:6022990"
                     /translation="MIERYTRPEMGAIWTEQNKYQAWLEVEILACEAWAEIGDIPKED
                     VAKIRENASFDVNRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAL
                     SYLIKQANDILRKDIVNFIDIIAVKAKEHKHTVMMGRTHGVHAEPTTFGLKLGLWYEE
                     MKRNLERFEAAAKVIETGKMSGAVGTYANIDPRVEQYVCDQLGLAASPISTQTLQRDR
                     HAQYLGALALIATSIEKFATEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSEN
                     MVGMSRLMRGYMVTAYENVALWHERDISHSSAERVILPDATITLNYMLNRFGNIVKNL
                     TVFPENMKRNMTRTFGLIYSQRILLALIDKGLVREEAYDTVQPLAMQAWDEQVQFRTL
                     VDASEKITSYLTKEELDECFDYNYHLQHVDMIFERLGLN"
     misc_feature    230086..231366
                     /locus_tag="Bsph_0210"
                     /note="adenylosuccinate lyase; Provisional; Region:
                     PRK07492"
                     /db_xref="CDD:181000"
     misc_feature    230095..231366
                     /locus_tag="Bsph_0210"
                     /note="Adenylsuccinate lyase (ASL)_subgroup 1; Region:
                     Adenylsuccinate_lyase_1; cd01360"
                     /db_xref="CDD:176464"
     misc_feature    order(230128..230133,230290..230292,230317..230319,
                     230344..230349,230353..230358,230500..230517,
                     230521..230523,230539..230544,230551..230553,
                     230560..230565,230581..230586,230602..230604,
                     230632..230643,230650..230652,230656..230658,
                     230704..230706,230710..230715,230734..230736,
                     230746..230748,230767..230769,230788..230790,
                     230800..230802,230806..230811,230815..230820,
                     230890..230895,230908..230910,230920..230922,
                     230929..230934,230938..230943,230950..230955,
                     230962..230970,230974..230997,231004..231009,
                     231013..231018,231028..231030,231148..231150,
                     231160..231162,231169..231174,231187..231192,
                     231337..231339,231343..231345,231355..231357)
                     /locus_tag="Bsph_0210"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176464"
     misc_feature    order(230287..230289,230350..230352,230506..230508,
                     230719..230721,230887..230889,230893..230895,
                     230908..230910)
                     /locus_tag="Bsph_0210"
                     /note="active site"
                     /db_xref="CDD:176464"
     gene            231511..232221
                     /locus_tag="Bsph_0211"
                     /db_xref="GeneID:6022991"
     CDS             231511..232221
                     /locus_tag="Bsph_0211"
                     /EC_number="6.3.2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="YP_001695972.1"
                     /db_xref="GI:169825814"
                     /db_xref="GeneID:6022991"
                     /translation="MTKGQLLYEGKAKKLYTTEEPNVLLVEYKDSATAFNGEKKEEIE
                     GKGILNNRITSLIFEKLQGNGIASHFVKQLSDTQQLVRKVDIIPIEVVVRNIVAGSLA
                     KRIGLEEGTPLKRPIVEFYYKDDELGDPFITTEHIDVLELATSAEVSAIYDKALAINK
                     VLQPIFADVNVTLIDFKLEFGRDADGHVLLADEISPDTCRLWDATTKQKLDKDVFRRD
                     LGNLTEVYTIILSRLGGK"
     misc_feature    231511..232218
                     /locus_tag="Bsph_0211"
                     /note="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase; Reviewed; Region: PRK09362"
                     /db_xref="CDD:181800"
     misc_feature    231526..232215
                     /locus_tag="Bsph_0211"
                     /note="bacterial and archaeal
                     5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide
                     (SAICAR) synthase; Region: SAICAR_synt_PurC; cd01415"
                     /db_xref="CDD:133470"
     misc_feature    order(231529..231534,231538..231543,231547..231549,
                     231553..231558,231580..231582,231586..231588,
                     231715..231717,231754..231756,231760..231762,
                     231766..231768,231877..231879,232045..232047,
                     232081..232086)
                     /locus_tag="Bsph_0211"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:133470"
     misc_feature    order(231532..231534,231538..231549,231553..231555,
                     231580..231582,231616..231618,231718..231720,
                     231751..231762,231766..231768,231778..231780,
                     231784..231786,231790..231792,231802..231810,
                     231871..231873,231877..231879,231895..231897,
                     232033..232041,232045..232047,232084..232086,
                     232099..232110)
                     /locus_tag="Bsph_0211"
                     /note="active site"
                     /db_xref="CDD:133470"
     misc_feature    order(231616..231618,231778..231780,231784..231786,
                     231790..231792,231802..231810,231871..231873,
                     231895..231897,232033..232041,232099..232110)
                     /locus_tag="Bsph_0211"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133470"
     gene            232224..232472
                     /gene="yexA"
                     /locus_tag="Bsph_0212"
                     /db_xref="GeneID:6022992"
     CDS             232224..232472
                     /gene="yexA"
                     /locus_tag="Bsph_0212"
                     /note="With PurL and PurQ catalyzes the conversion of
                     formylglycinamide ribonucleotide, ATP, and glutamine to
                     formylglycinamidine ribonucleotide, ADP, and glutamate in
                     the fourth step of the purine biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase
                     subunit PurS"
                     /protein_id="YP_001695973.1"
                     /db_xref="GI:169825815"
                     /db_xref="GeneID:6022992"
                     /translation="MKKVKIYVTLRESILDPQGSAVQGSLAKMGYGEVEDLRIGKYLE
                     LSINDTERDIDTLVKEMCEKVLTNVVIEDYRYEVEEAN"
     misc_feature    232230..232463
                     /gene="yexA"
                     /locus_tag="Bsph_0212"
                     /note="phosphoribosylformylglycinamidine synthase subunit
                     PurS; Reviewed; Region: PRK05974"
                     /db_xref="CDD:235659"
     gene            232475..233158
                     /locus_tag="Bsph_0213"
                     /db_xref="GeneID:6022993"
     CDS             232475..233158
                     /locus_tag="Bsph_0213"
                     /EC_number="6.3.5.3"
                     /note="catalyzes the formation of
                     2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine from
                     N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide and
                     L-glutamine in purine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase I"
                     /protein_id="YP_001695974.1"
                     /db_xref="GI:169825816"
                     /db_xref="GeneID:6022993"
                     /translation="MKFAVLVFPGSNCDIDMYHAIKDELGEEVEYVWHTATDLSGFDG
                     VLVPGGFSYGDYLRCGAMANQSNIMAEVKKVADAGKPVLGVCNGFQILTEAGLLPGAL
                     LRNTNLKFMCRTVQLKVENNNTLFTNQYEQGQIIHIPIAHGEGNYYCDEETLQSLKDN
                     NQIVFTYSGDNPNGSLEDIAGIINERGNVLGMMPHPERAVDALVGGADGLAVFKSIVK
                     QWRENHVNN"
     misc_feature    232475..233128
                     /locus_tag="Bsph_0213"
                     /note="phosphoribosylformylglycinamidine synthase I;
                     Provisional; Region: PRK03619"
                     /db_xref="CDD:235140"
     misc_feature    232481..233125
                     /locus_tag="Bsph_0213"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in Formylglycinamide ribonucleotide
                     amidotransferase; Region: GATase1_FGAR_AT; cd01740"
                     /db_xref="CDD:153211"
     misc_feature    order(232622..232627,232637..232639,232730..232732,
                     232742..232744,232895..232900,233051..233053,
                     233057..233068)
                     /locus_tag="Bsph_0213"
                     /note="putative active site [active]"
                     /db_xref="CDD:153211"
     misc_feature    order(232730..232732,233057..233059,233063..233065)
                     /locus_tag="Bsph_0213"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153211"
     gene            233145..235379
                     /locus_tag="Bsph_0214"
                     /db_xref="GeneID:6021862"
     CDS             233145..235379
                     /locus_tag="Bsph_0214"
                     /EC_number="6.3.5.3"
                     /note="catalyzes the formation of
                     2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine from
                     N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide and
                     L-glutamine in purine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase II"
                     /protein_id="YP_001695975.1"
                     /db_xref="GI:169825817"
                     /db_xref="GeneID:6021862"
                     /translation="MSTTKFEPTAQQIKDEKLYAGMGMSDEEFALVEGILERLPNWTE
                     TGLFSVMWSEHCSYKNSKPVLRKFPTKGPQVLQGPGEGAGIVDIGDEQAVVFKMESHN
                     HPSAIEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELKSARGKYLFEEVVAGIA
                     GYGNCIGIPTVGGEIQFDPCYEGNPLVNAMCVGLIDHKDIQRGIAAGVGNTVMYVGAK
                     TGRDGIHGATFASEELTEESENQRPAVQVGDPFMEKLLLEACLEVVKSDALVGIQDMG
                     AAGLTSSSAEMASKAGSGVEMNLDLVPQRETGMTAYEMMLSESQERMLLVVKKGREDE
                     IKAIFDKYDLDAVAIGRVTDDKMLRLLHNGQIVAEVPADALAEDAPVYHKPSAEPAYY
                     AQFQAIENTEPVVTDYKETLNALLKAPTIASKEWVYDQYDYQVRTSTVVKPGSDAAVI
                     CVRGTNKGLAMTTDCNSRYIYLDPEVGGAIAVAEAARNIVATGGTPLAITDCLNFGNP
                     EKPEIFWQIEKSADGISAACTALNAPVIGGNVSLYNERSGEAVYPTPTIGMVGLIEDL
                     AHVTTQEVKGAGDIVFVIGETTTEFGGSELQKLLNNGVISGKAPAIDLEIEAARQQAL
                     LKAIKAGIVQSAHDVAEGGLAVAIAEKTFSANGLGVEVTLTGSATTALFSESQSRFVV
                     TVKEEHAATFVEIIKDAHKIGVVTNDALVKINGDKGVLVEGTVEEFRSNWKGAIPCLL
                     NSEA"
     misc_feature    233178..235370
                     /locus_tag="Bsph_0214"
                     /note="phosphoribosylformylglycinamidine synthase II;
                     Provisional; Region: PRK01213"
                     /db_xref="CDD:234921"
     misc_feature    233274..234254
                     /locus_tag="Bsph_0214"
                     /note="PurL subunit of the formylglycinamide
                     ribonucleotide amidotransferase (FGAR-AT), first repeat.
                     FGAR-AT catalyzes the ATP-dependent conversion of
                     formylglycinamide ribonucleotide (FGAR) and glutamine to
                     formylglycinamidine ribonucleotide (FGAM), ADP; Region:
                     PurL_repeat1; cd02203"
                     /db_xref="CDD:100034"
     misc_feature    order(233421..233432,233436..233438,233511..233513,
                     233541..233543,233550..233552,233559..233561,
                     233664..233666,233697..233702,233712..233714)
                     /locus_tag="Bsph_0214"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100034"
     misc_feature    order(233499..233501,233511..233513,233658..233666)
                     /locus_tag="Bsph_0214"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100034"
     misc_feature    234480..235259
                     /locus_tag="Bsph_0214"
                     /note="PurL subunit of the formylglycinamide
                     ribonucleotide amidotransferase (FGAR-AT), second repeat.
                     FGAR-AT catalyzes the ATP-dependent conversion of
                     formylglycinamide ribonucleotide (FGAR) and glutamine to
                     formylglycinamidine ribonucleotide (FGAM), ADP; Region:
                     PurL_repeat2; cd02204"
                     /db_xref="CDD:100035"
     misc_feature    order(234516..234527,234531..234533,234606..234608,
                     234642..234644,234651..234653,234660..234662,
                     234759..234761,234801..234806,234816..234818)
                     /locus_tag="Bsph_0214"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100035"
     misc_feature    order(234594..234596,234606..234608,234753..234761)
                     /locus_tag="Bsph_0214"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100035"
     gene            235355..236779
                     /locus_tag="Bsph_0215"
                     /db_xref="GeneID:6021863"
     CDS             235355..236779
                     /locus_tag="Bsph_0215"
                     /EC_number="2.4.2.14"
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="YP_001695976.1"
                     /db_xref="GI:169825818"
                     /db_xref="GeneID:6021863"
                     /translation="MLAELRGLNEECGVFGIWGNPNPAHLSYYGLHALQHRGQEGAGI
                     VVSDGQHLRAVKGEGLVNDVFNEDKLKAVNGKAAIAHVRYTTAGGGGIENVQPLLFHS
                     STGSLSIAHNGNLVNATHLKQYLERQGSIFHSSSDTEVLAHLIKKSSHSPFRAKVKNA
                     LSLLKGAYSCLIMTKDEMLVARDPHGLRPLSLGKLGEGWIVASETCAFDLIGAEFVRS
                     VEPGELLIINDEGVKSDRFAEMEKRSMCAMEYVYLARPDSDIDGINVHMARKRMGKQL
                     ARECAHIEADVVTGVPDSSISAAIGFAEESGIPYELGLIKNRYVGRTFIQPTQELRER
                     GVKMKLSPVVQVVKGKRVVMVDDSIVRGTTSRRIVKMLKDAGAAEVHVVISSPPMTNP
                     CYYGIDTSTHEELIASSHNVDEIREVIGADSLTFLSVEGMVETIARPYEDENRGLCLA
                     CFTGKYPTEIFPDTILPHEKELLR"
     misc_feature    235355..236773
                     /locus_tag="Bsph_0215"
                     /note="amidophosphoribosyltransferase; Provisional;
                     Region: PRK07631"
                     /db_xref="CDD:181061"
     misc_feature    235388..236137
                     /locus_tag="Bsph_0215"
                     /note="Glutamine amidotransferases class-II (GN-AT)_GPAT-
                     type. This domain is found at the N-terminus of  glutamine
                     phosphoribosylpyrophosphate (Prpp) amidotransferase
                     (GPATase) . The glutaminase domain catalyzes amide
                     nitrogen transfer from glutamine to the...; Region:
                     GPATase_N; cd00715"
                     /db_xref="CDD:238367"
     misc_feature    order(235388..235390,235463..235468,235601..235603,
                     235688..235693,235763..235765)
                     /locus_tag="Bsph_0215"
                     /note="active site"
                     /db_xref="CDD:238367"
     misc_feature    order(235436..235441,235448..235450,235469..235471,
                     235652..235654,235769..235771,235778..235783,
                     235790..235795)
                     /locus_tag="Bsph_0215"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238367"
     misc_feature    236168..236506
                     /locus_tag="Bsph_0215"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(236228..236230,236234..236236,236420..236428,
                     236432..236446)
                     /locus_tag="Bsph_0215"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            236873..237928
                     /locus_tag="Bsph_0216"
                     /db_xref="GeneID:6021864"
     CDS             236873..237928
                     /locus_tag="Bsph_0216"
                     /EC_number="6.3.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="YP_001695977.1"
                     /db_xref="GI:169825819"
                     /db_xref="GeneID:6021864"
                     /translation="MSKAYEQAGVNIEAGYEAVKRMKSHVERTNRLGVMGTFGGFGGM
                     FDLSELNLKEPVLISGTDGVGTKLKLAFMVDKHDTIGVDCVAMCVNDIVAQGAEPLYF
                     LDYVALGKAEPAKIEQIVKGVADGCVQSGAALIGGETAEMPGLYEEDEYDLAGFAVGA
                     CEKSAIVTGERIVEGDVLIGIASSGVHSNGYSLVRKIVFADRQYAVDAIVENYEDLGP
                     IGEALLVPTKLYAKPVLAALKAADVHGCAHVTGGGFYENLPRMMPEGLATEIDLGSWP
                     VLRIFEFLKDKGQLEDKDLYNVFNMGIGFVIAAPAAEADKVMAAVEANGEKAYTIGRV
                     IKGNGVVFNGTHDGSLV"
     misc_feature    236882..237874
                     /locus_tag="Bsph_0216"
                     /note="phosphoribosylaminoimidazole synthetase;
                     Provisional; Region: PRK05385"
                     /db_xref="CDD:235439"
     misc_feature    237008..237877
                     /locus_tag="Bsph_0216"
                     /note="PurM (Aminoimidazole Ribonucleotide [AIR]
                     synthetase), one of eleven enzymes required for purine
                     biosynthesis, catalyzes the conversion of
                     formylglycinamide ribonucleotide (FGAM) and ATP to AIR,
                     ADP, and Pi, the fifth step in de novo purine
                     biosynthesis; Region: PurM; cd02196"
                     /db_xref="CDD:100032"
     misc_feature    order(237038..237049,237053..237055,237059..237061,
                     237077..237079,237143..237145,237155..237157,
                     237173..237175,237182..237184,237191..237193,
                     237284..237286,237296..237298,237302..237304,
                     237323..237328,237338..237340,237650..237652)
                     /locus_tag="Bsph_0216"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100032"
     misc_feature    order(237143..237145,237278..237286)
                     /locus_tag="Bsph_0216"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100032"
     gene            237928..238497
                     /locus_tag="Bsph_0217"
                     /db_xref="GeneID:6021865"
     CDS             237928..238497
                     /locus_tag="Bsph_0217"
                     /EC_number="2.1.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="YP_001695978.1"
                     /db_xref="GI:169825820"
                     /db_xref="GeneID:6021865"
                     /translation="MTAPTKIAVFASGSGSNFQAIQEAIERKELHAKIELVVTDKPGA
                     YVVTRAEHLGIPVLALNPKDFASKAAYEKVIVDALHECDVKWIVLAGYMRLISDVLLA
                     AFPQRIVNIHPSLLPAFPGKDAIGQALNHGVKITGVTVHFVDEGMDTGPIIAQAAVSV
                     IEGNREATEAAIHKQEHLLYTKALQQLLQ"
     misc_feature    237937..238494
                     /locus_tag="Bsph_0217"
                     /note="phosphoribosylglycinamide formyltransferase;
                     Reviewed; Region: purN; PRK05647"
                     /db_xref="CDD:235544"
     misc_feature    237943..238488
                     /locus_tag="Bsph_0217"
                     /note="Phosphoribosylglycinamide formyltransferase (GAR
                     transformylase, GART); Region: FMT_core_GART; cd08645"
                     /db_xref="CDD:187714"
     misc_feature    order(237958..237960,237973..237981,238192..238215,
                     238228..238230,238255..238266,238288..238290,
                     238348..238350,238354..238359,238366..238371,
                     238453..238455)
                     /locus_tag="Bsph_0217"
                     /note="active site"
                     /db_xref="CDD:187714"
     misc_feature    order(237973..237978,238195..238200,238258..238260,
                     238264..238266,238453..238455)
                     /locus_tag="Bsph_0217"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187714"
     misc_feature    order(238192..238194,238201..238203,238207..238215,
                     238228..238230,238255..238257,238354..238359,
                     238366..238371)
                     /locus_tag="Bsph_0217"
                     /note="cosubstrate binding site; other site"
                     /db_xref="CDD:187714"
     misc_feature    order(238255..238257,238261..238263,238369..238371)
                     /locus_tag="Bsph_0217"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187714"
     gene            238603..240129
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /db_xref="GeneID:6021866"
     CDS             238603..240129
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /note="Includes: Phosphoribosylaminoimidazolecarboxamide
                     formyltransferase (AICAR transformylase); IMP
                     cyclohydrolase (Inosinicase) (IMP synthetase) (ATIC)"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phospho ribosylaminoimidazole
                     carboxamide formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_001695979.1"
                     /db_xref="GI:169825821"
                     /db_xref="GeneID:6021866"
                     /translation="MTKRALISVSNKDGILEFAKELVALGYEILSTGGTKKMLQDNAV
                     AVTAVDEVTKFPEILDGRVKTLNPMIHGGLLGKFDDDSHQAQMNEHGIEPIEIVCVNL
                     YPFVETISKPNVTWDDAIENIDIGGPTMLRSAAKNHQYVTVIVDSNDYATVLEELKAG
                     GATTIETRRKLAAKVFRHTAAYDSYISNYLTEEEFPESLTMTYELKQNLRYGENPHQK
                     AAFYQKRLGSDFSLAYATQLHGKELSYNNIQDGNAALQIVKEFEMPAAVAVKHMNPCG
                     VGTGVTLEEAFDKAYEADPTSIFGGIIALNMEVDAATAEKLSHIFLEIIIAPAFSQEA
                     LDILTKKKNIRLLTIPFEQAKQDQFNVVSVEGGLLVQEPDRYGFANADIKVVTDREPT
                     KQEWEALQLGWSVVKHVKSNAIVVTDSQMTLGVGAGQMNRVGAAKIAFEQAGEKAKGA
                     ALASDAFFPMSDTVEAAAAAGITAIIQPGGSIKDQDSIDKANEYGITMIFTGVRHFKH
                     "
     misc_feature    238603..240126
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     misc_feature    238609..239172
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="Inosine monophosphate cyclohydrolase domain. This
                     is the N-terminal domain in the purine biosynthesis
                     pathway protein ATIC (purH). The bifunctional ATIC protein
                     contains a C-terminal  ATIC formylase domain that
                     formylates...; Region: IMPCH; cd01421"
                     /db_xref="CDD:238709"
     misc_feature    order(238630..238632,238636..238638,238696..238698,
                     238705..238707,238792..238797,238903..238905,
                     238972..238974)
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="purine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    order(238765..238767,238774..238779,238786..238791,
                     238798..238806,238813..238818,238825..238827,
                     238969..238977,238984..238986,238996..239001,
                     239008..239010,239107..239109,239116..239124,
                     239146..239154,239158..239163,239170..239172)
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    order(238792..238794,238972..238974)
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:238709"
     misc_feature    239002..239931
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     smart00798"
                     /db_xref="CDD:214822"
     misc_feature    <239944..240126
                     /gene="purH"
                     /locus_tag="Bsph_0218"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     cl03362"
                     /db_xref="CDD:243400"
     gene            240203..241462
                     /locus_tag="Bsph_0219"
                     /db_xref="GeneID:6024414"
     CDS             240203..241462
                     /locus_tag="Bsph_0219"
                     /EC_number="6.3.4.13"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="YP_001695980.1"
                     /db_xref="GI:169825822"
                     /db_xref="GeneID:6024414"
                     /translation="MNVLVIGSGGREHAIARQFNISPSVNQVFVAPGNDGMRGEVEVV
                     SIDTMDFAGLAQFAKENDITLTFVGPEQPLAEGIVDFFTARGLQIFGPTKMAAQLESS
                     KSYAKDVMSKYNIPTAAHKTFTDAEQAIAYIKEQGAPIVIKADGLAAGKGVVVAMTEQ
                     EAIEAVQDMIGNQRFGESSSRVVIEEFLDGEEFSFMSFVHKGQIYPMVIAQDHKRAYD
                     GDRGPNTGGMGAYSPVPQISQEVVDIAYQTIVKPTVKGMEADGASFTGILYAGLILTK
                     KGPKVIEFNARFGDPETQVVLPRMASDFGAFMVALMNEQPFDLQWSEDAMLGVVIAAE
                     GYPGDVEKGKTLPNLAEISKSYAVFHAGTKLVDGQFVGNGGRVLLVGAKAPTLQEAQE
                     KVYAGMTKETWDHFFFRKDIGWRTFKK"
     misc_feature    240203..241447
                     /locus_tag="Bsph_0219"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     misc_feature    240203..240502
                     /locus_tag="Bsph_0219"
                     /note="Phosphoribosylglycinamide synthetase, N domain;
                     Region: GARS_N; pfam02844"
                     /db_xref="CDD:217251"
     misc_feature    240503..241081
                     /locus_tag="Bsph_0219"
                     /note="Phosphoribosylglycinamide synthetase, ATP-grasp (A)
                     domain; Region: GARS_A; pfam01071"
                     /db_xref="CDD:216282"
     misc_feature    241181..241453
                     /locus_tag="Bsph_0219"
                     /note="Phosphoribosylglycinamide synthetase, C domain;
                     Region: GARS_C; pfam02843"
                     /db_xref="CDD:217250"
     gene            complement(241576..242022)
                     /locus_tag="Bsph_0220"
                     /db_xref="GeneID:6024415"
     CDS             complement(241576..242022)
                     /locus_tag="Bsph_0220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695981.1"
                     /db_xref="GI:169825823"
                     /db_xref="GeneID:6024415"
                     /translation="MTKGGSNMMQQANLSEKNAFCRFAMGTSLTAFGIAKVSRNPNCT
                     KGRLMIALGAMKMAEGIFKYCPAKALMSTNMQNAMNTSMQSMFSGQNSMSSEQIDKLM
                     KDFSSAIAGNSSGSQDTASTQSDTSTSTQNSSTRSNSTSNTAQNPS"
     gene            242202..243923
                     /locus_tag="Bsph_0221"
                     /db_xref="GeneID:6024416"
     CDS             242202..243923
                     /locus_tag="Bsph_0221"
                     /EC_number="3.5.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="YP_001695982.1"
                     /db_xref="GI:169825824"
                     /db_xref="GeneID:6024416"
                     /translation="MDPVWKITKIRQQLAVIDGKKAPDIVLKNARYLHSMMKQWIVGN
                     IWILGDRIVYAGDRMPPLIEGTQVVDCTGKTVVPGYIEPHVHPFQLYHPQSFADFCGQ
                     LGTTTFISDNLSFVLNLENKKAFSILDHLKKLPFSFYWWTRFDSQTELEQEEEVFSNT
                     SILEWLERSDVLLGGELTGWPKLLHGDDQMLYRMQMAKGLGKKIEGHFPGASERTLAR
                     MKLLGADGDHEAMTVEEVERRIMQGYAVTLRHSSIRPDLPHLLKGIVEKELPIFDHLM
                     MTTDGSPPSFHEDGVMDKCIQAALDAGVSPIDAYQMASYNVARYYNMSNLHGFIATGR
                     FASLNILQDEYHPVPESVLSKGVWLKRDGDRVHRLAAIDYSAIPAFHLDFSLDAQDFQ
                     FSMPFGIQLVNDVITKPYNSLITREGQLADHDECYLMLINRQGHWHVNTMIKGFATGV
                     QGFASSYSNTGDILLIGKNKEDMIKAFEEMKAMNGGIVLVEKGEVIADIPLSIGGLLY
                     DGDVLTLAEKEKALKQALAERGYHLGDAIYTLLFLQSTHLPYIRITPKGIFDVMKNKL
                     LLPAVMR"
     misc_feature    242205..243914
                     /locus_tag="Bsph_0221"
                     /note="Adenine deaminase [Nucleotide transport and
                     metabolism]; Region: AdeC; COG1001"
                     /db_xref="CDD:223933"
     misc_feature    242334..>242462
                     /locus_tag="Bsph_0221"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:241750"
     misc_feature    242409..>243272
                     /locus_tag="Bsph_0221"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:241750"
     misc_feature    order(242451..242453,242457..242459,242820..242822,
                     242883..242885,243039..243041)
                     /locus_tag="Bsph_0221"
                     /note="active site"
                     /db_xref="CDD:238617"
     misc_feature    243432..243899
                     /locus_tag="Bsph_0221"
                     /note="Adenine deaminase C-terminal domain; Region:
                     Adenine_deam_C; pfam13382"
                     /db_xref="CDD:222089"
     gene            243976..245037
                     /locus_tag="Bsph_0222"
                     /db_xref="GeneID:6024417"
     CDS             243976..245037
                     /locus_tag="Bsph_0222"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695983.1"
                     /db_xref="GI:169825825"
                     /db_xref="GeneID:6024417"
                     /translation="MLVFKTKKLWMTMAFSALVIGGCSKDTPKVKEDDERVTQEEKVV
                     EEQIQKPAFVAPLTGEAVQEEITQRPIVVTINNHPAARPQSGLAAADIIYEMLAEGNV
                     TRFLAVYQSELPENIGPVRSARSYFIDIAKGFNAFYVAHGYSPEAKTMLDNRVVDNIN
                     GMAYDGILFKRSSERVAPHNSYITSEKIRKGAEMVGASMNYSEKVLQAFYEPDERGKI
                     GIETSQVDIYYGNNEDFHNSYVYDHQSNYYERQSAGVDTKDMLTGEALSLANVLFFEM
                     DHQIVDDIGRQTIDLTSGGNAYVFQNGYLREVKWANVNGIPTAVEQSGEPVKLVPGKS
                     WVHFVPSSPGLQAMVKTQP"
     misc_feature    244141..244983
                     /locus_tag="Bsph_0222"
                     /note="Protein of unknown function (DUF3048); Region:
                     DUF3048; pfam11258"
                     /db_xref="CDD:221048"
     gene            245053..245373
                     /locus_tag="Bsph_0223"
                     /db_xref="GeneID:6024418"
     CDS             245053..245373
                     /locus_tag="Bsph_0223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695984.1"
                     /db_xref="GI:169825826"
                     /db_xref="GeneID:6024418"
                     /translation="MQIEKIRGHQTDQLFKAVLELKDIEECYKFFDDLCTISEIQSLA
                     QRFEVAHLLRLKKTYESIKKETGASTATISRVRRCFDYGNDTYDEMLGRLYPDEKPFQ
                     APKE"
     misc_feature    245071..245331
                     /locus_tag="Bsph_0223"
                     /note="Trp repressor protein; Region: Trp_repressor;
                     cl17266"
                     /db_xref="CDD:247820"
     gene            245606..246172
                     /locus_tag="Bsph_0224"
                     /db_xref="GeneID:6024460"
     CDS             245606..246172
                     /locus_tag="Bsph_0224"
                     /codon_start=1
                     /transl_table=11
                     /product="PcrB-like protein"
                     /protein_id="YP_001695985.1"
                     /db_xref="GI:169825827"
                     /db_xref="GeneID:6024460"
                     /translation="MTLDGVLDLLVRVRRFEVPIALEISTIDAITPGYDYYFIPTVLN
                     SDDPKWIKNLHHAAIKEFGDIMVWDELVAEGYCILNPDCKVAHVTGATTDLSIDDIVA
                     YARMAENFFKLPVFYLEYSGIYGNPEVVSAVKNELKHTKLFYGGGITSAKQAEEMAQY
                     ADTVVVGNIIYEDLKAALATVKAVKNTL"
     misc_feature    <245654..246124
                     /locus_tag="Bsph_0224"
                     /note="PcrB_like proteins. One member of this family, a
                     protein from Archaeoglobus fulgidus, has been
                     characterized as a (S)-3-O-geranylgeranylglyceryl
                     phosphate synthase (AfGGGPS). AfGGGPS catalyzes the
                     formation of an ether linkage between...; Region:
                     PcrB_like; cd02812"
                     /db_xref="CDD:239206"
     misc_feature    order(245732..245734,245747..245749,245759..245761,
                     245771..245773,245783..245785,245897..245899,
                     245906..245911,245921..245923,245930..245932,
                     245999..246001)
                     /locus_tag="Bsph_0224"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239206"
     misc_feature    order(245954..245956,245960..245962,245969..245971,
                     246038..246046,246107..246109)
                     /locus_tag="Bsph_0224"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239206"
     misc_feature    order(245954..245956,245960..245962,245966..245968)
                     /locus_tag="Bsph_0224"
                     /note="putative active site [active]"
                     /db_xref="CDD:239206"
     gene            246205..248454
                     /locus_tag="Bsph_0225"
                     /db_xref="GeneID:6024461"
     CDS             246205..248454
                     /locus_tag="Bsph_0225"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase pcrA"
                     /protein_id="YP_001695986.1"
                     /db_xref="GI:169825828"
                     /db_xref="GeneID:6024461"
                     /translation="MEQLTKNLLAGMNPEQERAVKTTEGPLLIMAGAGSGKTRVLTHR
                     IAYLIIEKEVYPSKVLAITFTNKAAREMRERIDGILGNGTGDSMWVSTFHSMCVRILR
                     RNIDQLGISRNFSILDSTDQLSVIKNVMKDENIDPKRFEPRAILNAISAAKNECITAD
                     DYAGHMNDKNPYEQTVARVYKGYEKRLRRNQSLDFDDLIMTTITLFKRVPEVLEYYQN
                     KFQYIHVDEYQDTNKSQYLLVQLLAKKFKNICVVGDSDQSIYRWRGADIGNILSFEKD
                     YPNAKVIMLEQNYRSTKRILQAANDVIQNNTTRYPKELRTENAEGEKIALYKAYNEQE
                     EAQFVVQTIQQLMEKENRTFDDFAILYRTNAQSRVMEEVLVKSNMVYQIVGGTKFYDR
                     KEIKDLLAYLRLIANNDDDLSLARIINEPKRSIGATSFEKMARYAIEQDRSIFDAMND
                     LIFMGLSGKAANSAEQFYAMIKGFTEMQEYLSVTEIVEQVIDKSGYRTMLQNEKTIEA
                     ESRLENIEEFLSVTKAFEERSDDKSLIAFLTDLALIADIDALDKEDASKGNIILMTMH
                     AAKGLEFPIVFIIGMEENIFPHSRSLDDQDEMEEERRLMYVGVTRAEERLYLTCAQSR
                     TIFGRSSFNNASRFLGEISEDITESISKAGAKTNVPFATSNRSSNYQKRTLGSVQQTQ
                     PATARLQSTGGDQYGWKAGDKAVHKKWGTGMVVSVKGEGDSTELDIAFPQPIGIKRLL
                     AQFAPIEKA"
     misc_feature    246226..248445
                     /locus_tag="Bsph_0225"
                     /note="ATP-dependent DNA helicase PcrA; Region: pcrA;
                     TIGR01073"
                     /db_xref="CDD:233261"
     misc_feature    246256..246495
                     /locus_tag="Bsph_0225"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:222005"
     misc_feature    <247891..248061
                     /locus_tag="Bsph_0225"
                     /note="Family description; Region: UvrD_C_2; pfam13538"
                     /db_xref="CDD:222209"
     gene            248469..250472
                     /locus_tag="Bsph_0226"
                     /db_xref="GeneID:6024462"
     CDS             248469..250472
                     /locus_tag="Bsph_0226"
                     /EC_number="6.5.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="YP_001695987.1"
                     /db_xref="GI:169825829"
                     /db_xref="GeneID:6024462"
                     /translation="MNEIEQRIAELNKLLHEYGYAYYVLDKPVVADSVYDQLLHELIA
                     LEEANPSLIFPDSPTQRVGGTVVEGFKKVTHDYPMLSLSNAFNEADLQEFDRKVRQAI
                     GDHFSYVCELKIDGLAISLKYENGVFVQGATRGDGVVGEEITANLKTIHAIPLRLKEP
                     ITIEVRGEAYMPKKSFEKLNAQRADNGEELFANPRNAAAGSLRQLDPKIAASRQLSTF
                     IYAIGGDGEIYGIDGHAEMLDYLEDLGFPSNKERQRCSTIEEVMAFIEHWTENRPHLA
                     YEIDGIVIKVDRYAQQDELGYTAKSPRWAIAYKFPAEEVVTTLLDIDLTVGRTGVVTP
                     TAILTPVQVAGTTVQRASLHNEDLIRDKDIRLGDTVIIRKAGDIIPQVVGVLIEQRPE
                     NSVPFEMPKNCPVCDSELIRIEGEVALRCVNPACFAQIAESIKYFVSRNAMNIDGLGD
                     KVVEQLLRADLIHDVSDLYHLTIEQLVELERMGEKSATNLVNAIQASKENSMERLLIG
                     LGIRHVGEKAAKIVSEQFGSMEAVMAATEEQLVAIYEIGDKMASSLVEYFSNDDARAV
                     IERLAEVGVNMTFKGKKVEVVVGDNPFAGKTIVLTGKLEQLTRNEAKAKIEELGGTVT
                     GSVSKKTDLVIAGEDAGSKLAKAEQLGIEVWNEDNLIEQLNLI"
     misc_feature    248469..250463
                     /locus_tag="Bsph_0226"
                     /note="NAD-dependent DNA ligase LigA; Validated; Region:
                     ligA; PRK07956"
                     /db_xref="CDD:236137"
     misc_feature    248484..249404
                     /locus_tag="Bsph_0226"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cd00114"
                     /db_xref="CDD:238062"
     misc_feature    order(248712..248714,248799..248801,248805..248807,
                     248868..248870,248970..248972,249129..249131,
                     249315..249317,249321..249323)
                     /locus_tag="Bsph_0226"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(248805..248807,248811..248816)
                     /locus_tag="Bsph_0226"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    248805..248807
                     /locus_tag="Bsph_0226"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    249411..249656
                     /locus_tag="Bsph_0226"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     misc_feature    249672..249746
                     /locus_tag="Bsph_0226"
                     /note="NAD-dependent DNA ligase C4 zinc finger domain;
                     Region: DNA_ligase_ZBD; pfam03119"
                     /db_xref="CDD:202542"
     misc_feature    250251..250442
                     /locus_tag="Bsph_0226"
                     /note="Breast Cancer Suppressor Protein (BRCA1),
                     carboxy-terminal domain. The BRCT domain is found within
                     many DNA damage repair and cell cycle checkpoint proteins.
                     The unique diversity of this domain superfamily allows
                     BRCT modules to interact forming homo...; Region: BRCT;
                     cd00027"
                     /db_xref="CDD:237994"
     misc_feature    order(250296..250298,250308..250310,250317..250319,
                     250326..250328,250332..250334)
                     /locus_tag="Bsph_0226"
                     /note="Dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237994"
     gene            250558..251721
                     /locus_tag="Bsph_0227"
                     /db_xref="GeneID:6024463"
     CDS             250558..251721
                     /locus_tag="Bsph_0227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695988.1"
                     /db_xref="GI:169825830"
                     /db_xref="GeneID:6024463"
                     /translation="MSKGALNIMKSFRLIPALVAAAMLVGCVPSNEGGTELTQETQQN
                     EKTETTIIPSIQIDDSYYKTLIPYKESASRGLVVSNIFTKYDMKEVEAGLMRLSHNEF
                     DTENYYFQEGQYLAESTVSSWLARSSQTEDGLNPPTTDTMTPEERATKAPIYLSHIVE
                     QNYLTKTKDNKVKLGGISIGLALNSIYYYQKEQYGEYYEKPISESELVEQGKKMAAEI
                     VSRLRTRDELKDIPIVVGLFKQQPRNQIIPGAYFSYGVAKAGQNNIADWEGIDENYVL
                     FPTDDSQDVYRDVSKNFKIFKQDVDKYFSNYTSVIGTGFYRNKEIQKLTIEIPIQFFG
                     KAEIIGFTQYLTGILINRFNNIHVEVSITSVNGPEALINKKANDTDPYVHVYE"
     misc_feature    250582..251718
                     /locus_tag="Bsph_0227"
                     /note="Protein involved in sex pheromone biosynthesis
                     [General function prediction only]; Region: CamS; COG4851"
                     /db_xref="CDD:227188"
     misc_feature    250747..251361
                     /locus_tag="Bsph_0227"
                     /note="N-terminal repeat domain of CamS sex pheromone
                     cAM373 precursor; Region: CamS_repeat_1; cd13441"
                     /db_xref="CDD:240444"
     misc_feature    order(250747..250749,250753..250761,250777..250782,
                     250786..250791,250807..250809,250816..250821,
                     250828..250830,250882..250884,250888..250890)
                     /locus_tag="Bsph_0227"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:240444"
     misc_feature    251371..251712
                     /locus_tag="Bsph_0227"
                     /note="C-terminal repeat domain of CamS sex pheromone
                     cAM373 precursor; Region: CamS_repeat_2; cd13440"
                     /db_xref="CDD:240443"
     misc_feature    order(251464..251469,251473..251478,251494..251496,
                     251524..251526,251530..251532,251551..251568,
                     251572..251577,251581..251589,251593..251598,
                     251632..251634,251638..251640,251668..251670,
                     251674..251676,251704..251712)
                     /locus_tag="Bsph_0227"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:240443"
     gene            251954..252241
                     /locus_tag="Bsph_0228"
                     /db_xref="GeneID:6024464"
     CDS             251954..252241
                     /locus_tag="Bsph_0228"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit C"
                     /protein_id="YP_001695989.1"
                     /db_xref="GI:169825831"
                     /db_xref="GeneID:6024464"
                     /translation="MAKLTKEEVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNE
                     LDTANVEPTTHVLPLVNVMREDVAVKGLDREVMMLNVREQEDGQVKVPAIM"
     misc_feature    251960..252238
                     /locus_tag="Bsph_0228"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit C;
                     Reviewed; Region: gatC; PRK00034"
                     /db_xref="CDD:178810"
     gene            252266..253729
                     /gene="gatA"
                     /locus_tag="Bsph_0229"
                     /db_xref="GeneID:6024219"
     CDS             252266..253729
                     /gene="gatA"
                     /locus_tag="Bsph_0229"
                     /EC_number="6.3.5.-"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     A"
                     /protein_id="YP_001695990.1"
                     /db_xref="GI:169825832"
                     /db_xref="GeneID:6024219"
                     /translation="MTLFERSAKELQAEIKAGNLSIADLTKEAYERIAKLDGDVQAFL
                     ASNEEKATAQAAEMDKVPFEERGPLFGLPIGVKDNIVTEGLETTCASKILEGFMPIYD
                     ATVVNKLREAGMITVGKLNMDEFAMGSSNENSYYKTTKNPWNLNHVPGGSSGASAASV
                     AAGEVPFSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPITRNV
                     EDNALLLEAIAGLDPNDSTSADVEVPNYAAALTGDVKGLRIAVPKEFLGEGVGEAARQ
                     SVLAALEVLKGLGATVEEVSLPHSKYALAAYYILSSSEASSNLSRFDGIRYGFRAENV
                     TNLMDLYKETRAQGFGDEVKRRIMLGTYSLSAGTYDAYYKKAQQARTLIKADYDKVFE
                     DFDVIIGPTSPTPAFKIGENVDDPMTMYANDILTIPMNLAGVPAISIPCGFDNGLPLG
                     LQIIGKYFDEATIYRVAHAFEQATEFHKQVPQMWEGK"
     misc_feature    252266..253711
                     /gene="gatA"
                     /locus_tag="Bsph_0229"
                     /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
                     and related amidases [Translation, ribosomal structure and
                     biogenesis]; Region: GatA; COG0154"
                     /db_xref="CDD:223232"
     misc_feature    252308..253678
                     /gene="gatA"
                     /locus_tag="Bsph_0229"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit A;
                     Reviewed; Region: gatA; PRK00012"
                     /db_xref="CDD:234572"
     gene            253731..255158
                     /locus_tag="Bsph_0230"
                     /db_xref="GeneID:6024220"
     CDS             253731..255158
                     /locus_tag="Bsph_0230"
                     /EC_number="6.3.5.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     B"
                     /protein_id="YP_001695991.1"
                     /db_xref="GI:169825833"
                     /db_xref="GeneID:6024220"
                     /translation="MNFETVIGLEVHVELKTNSKIFSPAPAHFGAEPNTNTTVIDLGY
                     PGVLPVLNKNVVDFAMRAALALNMEIEQETKFDRKNYFYPDNPKAYQISQFDKPIGKN
                     GWIDIEVDGYTKRIGITRLHMEEDAGKLSHAGDHSLVDFNRQGTPLVEIVSEPDIRTP
                     NEAYAYLEKLKSIIQYTDVSDCKMEEGSLRCDANISIRPYGQEEFGTKTELKNLNSFN
                     YVRRGLEHEELRQADVLLSGGVIEQETRRFDEKTGKTILMRVKEGTDDYRYFPEPDLV
                     RLSIDDAWLERVKSEIPELPDARKKRYVEELGLTPYDAGVLVISKEISDFFESMIVNG
                     ADAKLSANWLMGDVSAYLNAEQKDLKDTALTPENLAEMVKLITDGTISSKIGKKVFAE
                     LVENGGSAQEIVKAKGLVQISDEGALLAIVTEVLDNNAQSIEDFKNGKDRAIGFLVGQ
                     IMKATKGQANPPMVNKLLQQEIAKR"
     misc_feature    253731..255146
                     /locus_tag="Bsph_0230"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit B;
                     Validated; Region: gatB; PRK05477"
                     /db_xref="CDD:235489"
     misc_feature    253740..254594
                     /locus_tag="Bsph_0230"
                     /note="GatB/GatE catalytic domain; Region: GatB_N;
                     pfam02934"
                     /db_xref="CDD:217294"
     misc_feature    254703..255146
                     /locus_tag="Bsph_0230"
                     /note="GatB domain; Region: GatB_Yqey; pfam02637"
                     /db_xref="CDD:217159"
     gene            255319..255882
                     /locus_tag="Bsph_0231"
                     /db_xref="GeneID:6024221"
     CDS             255319..255882
                     /locus_tag="Bsph_0231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695992.1"
                     /db_xref="GI:169825834"
                     /db_xref="GeneID:6024221"
                     /translation="MKSEQQYFNEAISIQQYMDNMTTLKEESFRIYDSYVVPTNDGFI
                     ELLKDKKPKILTITEDWCGDAMLNNPIVRRVAEAAELDMRTVFRDADTDLIDRYLTNG
                     GRAIPIYLLLDSTGEVIGKWGPRAPELQELVVTKRASLPDKEDPTFEEAQKALYAEIR
                     EENITNPTYWTYVYDDFKKQVSNALQK"
     gene            255916..256869
                     /locus_tag="Bsph_0232"
                     /db_xref="GeneID:6024222"
     CDS             255916..256869
                     /locus_tag="Bsph_0232"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695993.1"
                     /db_xref="GI:169825835"
                     /db_xref="GeneID:6024222"
                     /translation="MNEIESYEAGRYVMKRARIIYNPTSGREAFKKHLPEVLEKLEVA
                     GYETSCHATTGEGDATLAAKDAVDRGFDIIIAVGGDGTLNEVVSGVSPFENRPKVGLI
                     PMGTTNDFARAVHIPRNIDEAVDIIIQGDTLPVDVGLLNGERYFINIAAGGRITELTY
                     EVPSKMKTMLGQLAYYLKAVEMIPSIKASHMRIEYDGEVFDGDAMMFLCGLTNSVGGF
                     EKLAPDASINDGYFTLLVLKKVSLPEFIQLAAMALRGEHLNDDRVIYKKASVVKVTTE
                     NEVHLNLDGEYGGDAPATFENLKRHIEIFVPLADIREEDRI"
     misc_feature    255955..256860
                     /locus_tag="Bsph_0232"
                     /note="putative lipid kinase; Reviewed; Region: PRK13337"
                     /db_xref="CDD:183982"
     misc_feature    255961..256338
                     /locus_tag="Bsph_0232"
                     /note="Diacylglycerol kinase catalytic domain; Region:
                     DAGK_cat; pfam00781"
                     /db_xref="CDD:216116"
     gene            257186..257308
                     /locus_tag="Bsph_0233"
                     /db_xref="GeneID:6024223"
     CDS             257186..257308
                     /locus_tag="Bsph_0233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695994.1"
                     /db_xref="GI:169825836"
                     /db_xref="GeneID:6024223"
                     /translation="MDKGKEVLLLYKSQEKKLIWLSFGVAIIMLLSILGRIFGS"
     gene            257320..258666
                     /locus_tag="Bsph_0234"
                     /db_xref="GeneID:6021256"
     CDS             257320..258666
                     /locus_tag="Bsph_0234"
                     /EC_number="1.10.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit 1"
                     /protein_id="YP_001695995.1"
                     /db_xref="GI:169825837"
                     /db_xref="GeneID:6021256"
                     /translation="MINESAVYWSRALTELTLSFHIIYATIGVGVPLMIMIAQWTGYK
                     KNDEHYILMARRWARGFVITVAVGVVTGTAIGLQLSLLWPNFMQLAGQTIALPLFLET
                     FAFFFEAIFLGIYLYTWDRFDSQKKHMLLLIPVAVGASMSAVFITIVNAFMNAPRGFD
                     IVDGELVNIQPFLAMFNPAMPTKVAHVLVTAYMTSAFVLAAIAGYRMLKGSKHVYHKK
                     SLLLLMKIGLIFSIAAAVIGDFSGKYLAEYQPEKLAAAEWHFETEGKASLVLFGVLDG
                     EEVKYAIKIPYALSVLAHFNPNEEVIGLDQFEEEDLPPLYIHYLFDIMVSIGMFMVLV
                     SLLYVVGKARGWQFIHSRWYRWIIVAGGPLSIIAIEAGWWLAEVGRQPWILYGLMRTP
                     EGATTSDHVDLMLLLFAGVYAVLAVGSIVVLVRMFKKNPIEREIEDRHSEKGGDIL"
     misc_feature    257344..258618
                     /locus_tag="Bsph_0234"
                     /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
                     Bac_Ubq_Cox; pfam01654"
                     /db_xref="CDD:216630"
     gene            258663..259688
                     /locus_tag="Bsph_0235"
                     /db_xref="GeneID:6021257"
     CDS             258663..259688
                     /locus_tag="Bsph_0235"
                     /EC_number="1.10.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit II"
                     /protein_id="YP_001695996.1"
                     /db_xref="GI:169825838"
                     /db_xref="GeneID:6021257"
                     /translation="MTLEILGISVLWIFLFGYVIVASIDFGAGFFNAYSLLIGKNHIL
                     TNIIKRYLSPVWEVTNVFLVFFFVGIVGFFPQTAFYYGTILLIPVSISLVLLAIRGSY
                     YAFESYGTRGHIGYTLTYGVAGLLIPASLSVVFAIAGGGYVDLVNGQPVLNYWTLYTS
                     PFAWSIVVLSIAAVLYISAVFLTWYAHKANDKEATKLMRKYALLWAAPLMVSALGIMY
                     EMKSINPESYGHMVNLWWMFAISAILFMITVLLLALRKKYGLAVALLIAQFAVAFFAY
                     GIAQYPYLLYPYLTIYDGFTSTQMAIALIIAFILGLCLLLPSLYLLMKLFLFNKNYVT
                     GKEDNHA"
     misc_feature    258663..259562
                     /locus_tag="Bsph_0235"
                     /note="Cytochrome bd-type quinol oxidase, subunit 2
                     [Energy production and conversion]; Region: AppB; COG1294"
                     /db_xref="CDD:224213"
     gene            259703..259825
                     /locus_tag="Bsph_0236"
                     /db_xref="GeneID:6021258"
     CDS             259703..259825
                     /locus_tag="Bsph_0236"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695997.1"
                     /db_xref="GI:169825839"
                     /db_xref="GeneID:6021258"
                     /translation="MQSFLIFYAPFIVVILGILCAFWWAPRDYHITKEQGKSRE"
     gene            259920..261299
                     /locus_tag="Bsph_0237"
                     /db_xref="GeneID:6021259"
     CDS             259920..261299
                     /locus_tag="Bsph_0237"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="YP_001695998.1"
                     /db_xref="GI:169825840"
                     /db_xref="GeneID:6021259"
                     /translation="MEDVRMSAPVKKNERLSVYIEDLTHDGNGVAKVDGYPLFIQGAL
                     PNETAEIHVMKTLKNYGFAKVVDIIKPSPDRVEAPCDYFKQCGGCQLQHLSYEGQLKW
                     KENMVRNVMQRIGKIDAPVLPVKGMKEPWHYRNKAQIPFSENEAGQAIAGFYKTKTHS
                     IVDMERCLIQTGEADAILVGLKKELVAIGMRPYNELSHEGMLRHVVIRKARATGEVMV
                     VLVTKKKKFPQKEAAIAVIQKLVPNVTSIMQNVNHEKTNVIFGDDTLNLWGKDVIIDT
                     IGDVRFEISARSFYQVNPEQTEVLYKQALDYANLQGDERVIDAYCGIGTISLFLAQKA
                     RAVMGVEIVPQAIEDAKRNAVLNGFTNTYFEAGPAEEVIPRWYKEGKEADVLVVDPPR
                     KGCDEALLTTILEQRPKRVVYVSCNPATLARDLRILENGGYQTQEIQPVDMFPHSTHC
                     EAVAWLELV"
     misc_feature    259944..260123
                     /locus_tag="Bsph_0237"
                     /note="Predicted RNA-binding protein, contains TRAM domain
                     [General function prediction only]; Region: COG3269"
                     /db_xref="CDD:225808"
     misc_feature    259953..261275
                     /locus_tag="Bsph_0237"
                     /note="SAM-dependent methyltransferases related to tRNA
                     (uracil-5-)-methyltransferase [Translation, ribosomal
                     structure and biogenesis]; Region: TrmA; COG2265"
                     /db_xref="CDD:225174"
     misc_feature    260862..>261092
                     /locus_tag="Bsph_0237"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(260874..260894,260940..260945,261018..261026,
                     261084..261086)
                     /locus_tag="Bsph_0237"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            261416..262384
                     /locus_tag="Bsph_0238"
                     /db_xref="GeneID:6021260"
     CDS             261416..262384
                     /locus_tag="Bsph_0238"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001695999.1"
                     /db_xref="GI:169825841"
                     /db_xref="GeneID:6021260"
                     /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRQVVSEAGRPDVFFTEF
                     TNSDSYCHPEGQKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSRGMAELGFKGIDIN
                     MGCPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGYKDVEEWEEWLTH
                     IFKQDIANLSIHLRTRKEMSQVDAHWELIPEIKKLRDCIAPNTLLTINGDIPDRQTGL
                     ELAEKYGIDGVMIGRGIFKNPFAFEKEPKEHSSKEYLDLLRLQLDLQDQYEEVLPRSI
                     TGLHRFFKIYVKGFRGASELRSQLMNTKSTDEVRALLDRFEANHVE"
     misc_feature    261425..262366
                     /locus_tag="Bsph_0238"
                     /note="tRNA-dihydrouridine synthase [Translation,
                     ribosomal structure and biogenesis]; Region: COG0042"
                     /db_xref="CDD:223120"
     misc_feature    261455..262147
                     /locus_tag="Bsph_0238"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    order(261464..261472,261545..261547,261638..261640,
                     261719..261721,261842..261844,261929..261931,
                     262037..262039,262043..262045,262109..262114)
                     /locus_tag="Bsph_0238"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(261638..261640,261728..261733,261842..261844,
                     261848..261850,261926..261931,261935..261940,
                     262040..262045,262112..262114)
                     /locus_tag="Bsph_0238"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(261728..261730,261848..261850,261929..261931,
                     261935..261937)
                     /locus_tag="Bsph_0238"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(261731..261733,261842..261844,261926..261928,
                     261938..261940,262040..262045)
                     /locus_tag="Bsph_0238"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            262577..264223
                     /locus_tag="Bsph_0239"
                     /db_xref="GeneID:6024234"
     CDS             262577..264223
                     /locus_tag="Bsph_0239"
                     /EC_number="1.1.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="aerobic glycerol-3-phosphate dehydrogenase"
                     /protein_id="YP_001696000.1"
                     /db_xref="GI:169825842"
                     /db_xref="GeneID:6024234"
                     /translation="MMSTASALQRQQTIEELQDREYDLLVIGGGITGCGIALDAIARG
                     LSVALVEMQDFAAGTSSRSTKLVHGGLRYLKQFEIKEVAELGKERAIVYENGPHVTTP
                     VWMLLPFHKGGTFGKYSTNLGLRVYDFLAGVKRAERRYMLSTGQTIEKEPLVKTEGLL
                     GGGMYVEYRTDDARLTIEVAKAAIERGATLLNYIKAENFLYNEQQKIRGIVATDLLTN
                     HPIEIRAKAVVNAAGPWVDDVRTIEGKQAGKHLILSKGVHIVFDESKFPLKQAVYFDT
                     PDGRMVFAIPRQGKTYVGTTDTFYEGDARNMDIYQEDRNYIMKAIHYMFPNVKVEDAD
                     IESSWAGVRPLIHEDGKNPSEISRKDEVWISPSGLVTIAGGKLTGYRKMAETVLNTIA
                     QELDQQFGIKSSPCTTKNIPISGGHMGGSNKFYAFLYDHTRLGKKIGLSEEEAKFLSQ
                     HYGSNVEIVFNYVKEGHSILPSWLYAQLMYGIHHEMVVHPNDFLVRRTGYMFFQMATV
                     QQYEEAILDEMAKQLNWTTQQRTQYEEDVKKEIKRATTAL"
     misc_feature    262604..264208
                     /locus_tag="Bsph_0239"
                     /note="Glycerol-3-phosphate dehydrogenase [Energy
                     production and conversion]; Region: GlpA; COG0578"
                     /db_xref="CDD:223651"
     misc_feature    262640..>262828
                     /locus_tag="Bsph_0239"
                     /note="ubiquinone biosynthesis hydroxylase family protein;
                     Provisional; Region: PRK07608; cl17314"
                     /db_xref="CDD:247868"
     gene            264295..264852
                     /locus_tag="Bsph_0240"
                     /db_xref="GeneID:6024235"
     CDS             264295..264852
                     /locus_tag="Bsph_0240"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake operon antiterminator regulatory
                     protein"
                     /protein_id="YP_001696001.1"
                     /db_xref="GI:169825843"
                     /db_xref="GeneID:6024235"
                     /translation="MHFDNQQVIPAARTVKQFDEIIASPFDYIVLLEVHISLLMSLKR
                     EAYRHGKKLIIHADLIHGLKTDNFAADFLCNDIRPAGIISTRSNMLMKAKARGIMAIQ
                     RVFLIDTIALEKSYSMIETAQPDYIELLPGIIPSMIQEIYERTQIPVITGGLVRTVDN
                     IEEALAGGAIAVTTSNRQLWENFKK"
     misc_feature    264301..264837
                     /locus_tag="Bsph_0240"
                     /note="Glycerol-3-phosphate responsive antiterminator
                     (mRNA-binding) [Transcription]; Region: GlpP; COG1954"
                     /db_xref="CDD:224865"
     gene            265015..265818
                     /locus_tag="Bsph_0241"
                     /db_xref="GeneID:6024236"
     CDS             265015..265818
                     /locus_tag="Bsph_0241"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator protein"
                     /protein_id="YP_001696002.1"
                     /db_xref="GI:169825844"
                     /db_xref="GeneID:6024236"
                     /translation="MSTFTAELVGTMILILFGGGVVAGAVLNKSKGFGGGWIVITFAW
                     GLGVAMAAYAVGGISGAHLNPALTIALATIGNFPWADVPSYIAAQMIGAFLGATLVYF
                     MYLPHWQATADADVKLAPFSTMPAIKHPLSNLLSEMIGTFILVLGILALGTNTITDGL
                     NPFLVGLLIIVIGMALGGPTGYAINPARDLGPRIAHFILPIAGKGDSGWSYAWIPVVG
                     PIIGGTFGALFFQQIFEGKNSLAFWIVAVIVIAIFIGAQLTVKNVQVED"
     misc_feature    265030..265707
                     /locus_tag="Bsph_0241"
                     /note="Major intrinsic protein (MIP) superfamily. Members
                     of the MIP superfamily function as membrane channels that
                     selectively transport water, small neutral molecules, and
                     ions out of and between cells. The channel proteins share
                     a common fold: the N-terminal...; Region: MIP; cd00333"
                     /db_xref="CDD:238204"
     misc_feature    order(265144..265146,265198..265206,265555..265560,
                     265567..265569,265576..265578)
                     /locus_tag="Bsph_0241"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    order(265204..265212,265567..265575)
                     /locus_tag="Bsph_0241"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            265838..267334
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /db_xref="GeneID:6024237"
     CDS             265838..267334
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /EC_number="2.7.1.30"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_001696003.1"
                     /db_xref="GI:169825845"
                     /db_xref="GeneID:6024237"
                     /translation="MSEKKYILALDQGTTSSRAILFDETGKIVHTAQQEFQQHFPQAG
                     WVEHHAEEIWSSILSCIATVLSEKGVSSSQIAGIGITNQRETTVVWDKHTGKPVYNAI
                     VWQSRQTNDICERLKESGYNDLFREKTGLLIDAYFSGTKVKWILDHVEGAREKAEAGE
                     LLFGTIDTWLIWKLSGGKVHVTDYSNASRTLMYNIHDLKWDEELLEILTVPASMLPEV
                     RPSSEVYGYTEEALFFGSAVPIAGAAGDQQAALFGQACFEEGMVKNTYGTGCFMLMNT
                     GEKAVKSNNGLLTTLAWGLDGKVTYALEGSIFVAGSAIQWLRDGLRMFRSASESEQYA
                     TRVESTDGVYVVPAFVGLGTPYWDSDVRGAIFGLTRGTAKEHFVRATLESLAYQTKDV
                     LAAMEADANIPLAKLRVDGGAVANDFLMQFQADLLDVPVDRPIINETTALGAAYLAGL
                     AVDYWHSTEEISKYWNLDRQFTPNMSNDHRDKIYGGWKKAVAAAQVFK"
     misc_feature    265838..267331
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    265853..267313
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    order(265853..265858,265862..265864,265868..265870,
                     265877..265882,265889..265891,265895..265897,
                     265901..265906,265913..265915,265919..265921,
                     265967..265969,266063..266089,266147..266152,
                     266156..266158,266165..266167,266177..266179,
                     266213..266215,266222..266233,266237..266239,
                     266243..266248,266387..266392,266399..266404,
                     266420..266425,266429..266431,266495..266506,
                     266558..266563,266579..266584,266639..266641,
                     266648..266650,266675..266677,266681..266683,
                     266699..266719,266732..266734,266738..266740,
                     266747..266749,266753..266755,266759..266764,
                     266780..266782,266885..266887,266906..266908,
                     266912..266917,266921..266923,267149..267151,
                     267155..267163,267167..267172,267176..267193,
                     267197..267202)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(265868..265870,265874..265882,265889..265891,
                     266084..266092,266147..266149,266243..266245,
                     266573..266578,266633..266641,266648..266650,
                     266768..266773,266777..266782,266816..266821,
                     266825..266827,267068..267076,267083..267085)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    order(265868..265870,265874..265882,265889..265891,
                     266633..266641,266768..266773,266777..266782,
                     266816..266821,266825..266827,267068..267076,
                     267083..267085)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(265868..265870,265877..265879,266573..266575)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    order(265868..265870,266573..266575)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(265877..265879,266084..266092,266147..266149,
                     266243..266245,266573..266578,266648..266650)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(265937..265939,265988..265990,265997..266002,
                     266012..266014,266021..266026,266123..266125,
                     266354..266356,266363..266365,266522..266524,
                     266528..266530)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(265955..265957,265964..265966,265973..265975,
                     266150..266152,266762..266764,266771..266773,
                     266780..266785,266792..266794,266861..266863,
                     266867..266869,266882..266884,266921..266947,
                     266957..266959,266966..266968)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(266537..266542,266546..266548)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(267044..267046,267050..267052,267254..267256,
                     267260..267262,267266..267277,267281..267283)
                     /gene="glpK"
                     /locus_tag="Bsph_0242"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            267534..267752
                     /locus_tag="Bsph_0243"
                     /db_xref="GeneID:6024238"
     CDS             267534..267752
                     /locus_tag="Bsph_0243"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696004.1"
                     /db_xref="GI:169825846"
                     /db_xref="GeneID:6024238"
                     /translation="MPFALAIGALATDADGGVLVGMHGFLFIQGLPFVILLIFLFEEG
                     EESVQFFIELCIFVVRNRGFREMSENCI"
     gene            267796..269157
                     /locus_tag="Bsph_0244"
                     /db_xref="GeneID:6021204"
     CDS             267796..269157
                     /locus_tag="Bsph_0244"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic serine protease DO-like"
                     /protein_id="YP_001696005.1"
                     /db_xref="GI:169825847"
                     /db_xref="GeneID:6021204"
                     /translation="MVVTMRPLKIKYKKLANPFQEFMQISPNNNALTKEVVFLRYIGI
                     PDSVDLYKEDILKMDEYFTKQSVFYLRLHRLEVINNKKDADRLSELWGEWQAAADSIQ
                     LLYETSLCGKLANNQLEWTKKLSFKNILHLFKEQQPHANDTLLKNFAVKFLYWMDYYL
                     PQIFSKENQASPKIVFIGDITQHESLFLYFLSTLGCDICYMNPKGDITNLYPIIAAAS
                     NLQSCSDYYEKEFIIPEMLSMKSIPPQQPTILPTPSSRMVTREECSYEQLASLATSVV
                     MIKTFGVDHKVICFGSGVVLHQEGYILTNLHVVSGGEYYSVLYENDSNEYTTHQFVKY
                     HDIHDLAILKVARTSQPLPVKMDGHLVRGQKIVAIGSPLGLFNSISDGIVAGFRDIRK
                     MSMVQFTAAISNGSSGGALLDMQGRLVGLITAGFDDGQNLNLAVPAHVIYQFAQNFIE
                     LPS"
     misc_feature    267901..>268413
                     /locus_tag="Bsph_0244"
                     /note="Domain of unknown function (DUF4356); Region:
                     DUF4356; pfam14266"
                     /db_xref="CDD:222637"
     misc_feature    <268666..>269109
                     /locus_tag="Bsph_0244"
                     /note="Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: DegQ; COG0265"
                     /db_xref="CDD:223343"
     misc_feature    268666..269058
                     /locus_tag="Bsph_0244"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:222077"
     gene            269471..270667
                     /locus_tag="Bsph_0245"
                     /db_xref="GeneID:6021205"
     CDS             269471..270667
                     /locus_tag="Bsph_0245"
                     /codon_start=1
                     /transl_table=11
                     /product="metabolite transport protein"
                     /protein_id="YP_001696006.1"
                     /db_xref="GI:169825848"
                     /db_xref="GeneID:6021205"
                     /translation="MDYRKKTVVASVAGLTLEGMDIMFISFAMTMIIAEFNIDLATGG
                     LISSITNIGMLLGGIIFGVLADKYGRVKVFTYTIILFAIGTALTGVATSIEQVYVYRF
                     IAGLGAGGEYGIGMALVAEAWPKNKQGRASSYVSVGAQYGVILAALLSAVILPTLGWR
                     ALFFIGVLPVIFAFIVRKNLHESPEWLASQKNESNMQKKGKLAQLFVTPRVTMTTLSL
                     ILMATVQIAGYNGLMIWLPSMLQKSQGLSVSSSALWTISTAVGMIIGMLTFGRFMDRF
                     GAKRAFGIFLLASACAVFLYSFATGAVAILMGGAIVGFFSNGMFAGYGALISSFYPVQ
                     IRSTATNTIFNFGRAIGGFSPIFVGYILQSYDMTVVMIYLAALYGISFMVMLTLKGST
                     EALQTA"
     misc_feature    269477..270556
                     /locus_tag="Bsph_0245"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    269492..270637
                     /locus_tag="Bsph_0245"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(269534..269536,269543..269551,269555..269560,
                     269609..269611,269618..269623,269630..269632,
                     269642..269647,269651..269656,269792..269797,
                     269804..269809,269816..269821,269828..269830,
                     269864..269869,269876..269881,269897..269899,
                     270146..270148,270155..270160,270167..270172,
                     270179..270181,270221..270223,270233..270235,
                     270245..270247,270254..270256,270266..270268,
                     270407..270409,270416..270421,270428..270430,
                     270440..270445,270452..270454,270485..270490,
                     270497..270502,270509..270514,270521..270523)
                     /locus_tag="Bsph_0245"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(270745..270948)
                     /locus_tag="Bsph_0246"
                     /db_xref="GeneID:6021206"
     CDS             complement(270745..270948)
                     /locus_tag="Bsph_0246"
                     /codon_start=1
                     /transl_table=11
                     /product="small acid-soluble spore protein 1"
                     /protein_id="YP_001696007.1"
                     /db_xref="GI:169825849"
                     /db_xref="GeneID:6021206"
                     /translation="MANNNRSSNKLLVPGVQEAVNQMKYEIAQEFGVQLGPEASSRAN
                     GSVGGEITKRLVEIAEKRSKGLL"
     misc_feature    complement(270763..270924)
                     /locus_tag="Bsph_0246"
                     /note="Small, acid-soluble spore proteins, alpha/beta
                     type; Region: SASP; pfam00269"
                     /db_xref="CDD:215831"
     gene            271136..271631
                     /locus_tag="Bsph_0247"
                     /note="This region contains a gene with one or more
                     premature stops or frameshifts, and is not the result of a
                     sequencing artifact; conserved hypothetical protein;
                     identified by sequence similarity"
                     /pseudo
                     /db_xref="GeneID:6021207"
     gene            271779..271973
                     /locus_tag="Bsph_0249"
                     /db_xref="GeneID:6021208"
     CDS             271779..271973
                     /locus_tag="Bsph_0249"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696008.1"
                     /db_xref="GI:169825850"
                     /db_xref="GeneID:6021208"
                     /translation="MIYFDILLVAIACVTMPFIVAVMLDIFYAERKKVRFSLRRTSLW
                     YMAMFALSFIPSVLLMTQNV"
     gene            272275..272436
                     /locus_tag="Bsph_0250"
                     /db_xref="GeneID:6020667"
     CDS             272275..272436
                     /locus_tag="Bsph_0250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696009.1"
                     /db_xref="GI:169825851"
                     /db_xref="GeneID:6020667"
                     /translation="MPISFGIGFLFAKTYKEEESHEVMEKHLIKKQTFTDGFHCCVIA
                     YSRHYYTKY"
     gene            272396..274087
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /db_xref="GeneID:6020668"
     CDS             272396..274087
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_001696010.1"
                     /db_xref="GI:169825852"
                     /db_xref="GeneID:6020668"
                     /translation="MLLLIAVITTQSIKELNNRMTVDLEQELTSVGLLTAMNLDSDEV
                     KDLLSEKGETNAKFTKVQKQLDLIQEQQGIMSWSYIWDVQDEGGVNPIGYTSNLNEVY
                     EAGEIFTDLANEHVETAKLAIQNNSTEVTDIFEDPFGSWRTVFSPIHDDNGQLIALLG
                     IDYSADYINTIIKASVIKQIVIAIIGILILLVLVYIIIDRLLKPLQKVVNVANQVANG
                     ELINVDLDITKDEIGNLSASIQTMVANLQHIILNIRNTSNHVSSAATQLTVNAGETYN
                     SSTNIANDVKQITQNAEASMTMTEETAAAMEETATGIQQIADSANTATESSISASQAS
                     ERGNQVVHQVIAQMELINESVEQIGTTINGLHVNTKKISDIVSLITAIADQTNLLALN
                     AAIEAARAGEHGKGFAVVADEVRRLAEQSSQSATEIYNLISSIQADSNASLTVMEKGK
                     EDVKVGMTFTNEVGEIFKEILTSSEEVANQIREISAASQQISASSEEVAASVNNIKQS
                     AELSADFSSNVSKSTQEQLTTMQEVKDASSALGQTAEELQALVTKFKLENDQDEH"
     misc_feature    <272732..272905
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; pfam08275"
                     /db_xref="CDD:219773"
     misc_feature    <272993..273139
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cl01054"
                     /db_xref="CDD:242275"
     misc_feature    273170..274060
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    273332..273844
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(273338..273343,273350..273355,273362..273364,
                     273371..273376,273380..273385,273392..273394,
                     273401..273406,273413..273415,273422..273427,
                     273434..273439,273446..273448,273455..273460,
                     273464..273469,273479..273481,273485..273490,
                     273497..273499,273506..273511,273518..273523,
                     273530..273532,273539..273541,273548..273553,
                     273560..273562,273572..273574,273581..273583,
                     273602..273604,273614..273616,273623..273625,
                     273632..273637,273644..273646,273653..273658,
                     273665..273670,273674..273679,273686..273691,
                     273728..273733,273740..273742,273749..273754,
                     273761..273763,273770..273775,273779..273784,
                     273791..273796,273803..273805,273812..273817,
                     273824..273826,273833..273838,273842..273844)
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    273548..273649
                     /gene="tlpC"
                     /locus_tag="Bsph_0251"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            274077..274829
                     /locus_tag="Bsph_0252"
                     /db_xref="GeneID:6020669"
     CDS             274077..274829
                     /locus_tag="Bsph_0252"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl- reductase"
                     /protein_id="YP_001696011.1"
                     /db_xref="GI:169825853"
                     /db_xref="GeneID:6020669"
                     /translation="MNIDFTGKNVLITGSSKGIGKAIALGFAQHGANIVINYIGDKPE
                     AEAVRMEAEKFGIKALTFHADVSKSEEVQDMYQYMDKHLGKIDILVNNAGFAQASSIT
                     DLTDEQWDRMIKVHLYGCFYNCREAAKRMKERDTGKIINISSDIGSLGCEEFTHYSAA
                     KGAINAFTKALARELAPTILVNAVAPSGTFTDILKEFGDNYVEEESAKYPLKRLAQPE
                     EIAKSVLFLASQHADFYTGQILTPNGGVVMNG"
     misc_feature    274083..274823
                     /locus_tag="Bsph_0252"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    274104..274799
                     /locus_tag="Bsph_0252"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(274116..274118,274122..274133,274188..274196,
                     274266..274274,274350..274358,274419..274421,
                     274500..274508,274545..274547,274557..274559,
                     274632..274643,274647..274652)
                     /locus_tag="Bsph_0252"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(274422..274424,274506..274508,274545..274547,
                     274557..274559)
                     /locus_tag="Bsph_0252"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            274851..276341
                     /locus_tag="Bsph_0253"
                     /db_xref="GeneID:6020670"
     CDS             274851..276341
                     /locus_tag="Bsph_0253"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium/proline symporter proline permease"
                     /protein_id="YP_001696012.1"
                     /db_xref="GI:169825854"
                     /db_xref="GeneID:6020670"
                     /translation="MLNIIIFSLYLVFIYYIGYKGYKRVNTAEDLIVAGWSMPLSVVT
                     GSLVAALLAAPFFFAAVGSGYTSGGFEGSATMGGLGTCMILGALIWTKPLRRLKGWTL
                     ADYYGLRYGSKKLGAYTGVVMAIAFGVFNAAALTVGGTYIIQQLLQIDFIPAALLFVS
                     LTAIYSVIGGLWAVAYTEIVQGALAIAGILGITIFILFYYPDVTFNPEWWNIHTLFDK
                     AGAEFWTLYLVLALGDIPAVDLGQRVAAAKSPKVAQRSMIIAGTIVIAISWIPGMLGE
                     AFKSIYPNSTNPETLMLTFAQGYFPPLLAAIFLTAMAAMGMSTVAACYVATSGIVTKN
                     IYLDFINRNPDPKKLLRFSRSVILSSALLGLVLAISFQKVIDLAYLAWDVIFVTIFWP
                     IVLGPFWKRVSTPAVWASISVGLIYYIVTSLTFVPSLTIQSEGFLGLLNELWQAPVFS
                     GVVITGITIVVVSLLVPPSQHVLEMHKIEKDKTLDDVGSKEELVGR"
     misc_feature    274860..276170
                     /locus_tag="Bsph_0253"
                     /note="Solute carrier 5 family, sodium/glucose
                     transporters and related proteins; solute-binding domain;
                     Region: SLC5sbd; cd10322"
                     /db_xref="CDD:212032"
     misc_feature    order(274995..274997,275004..275006,275793..275795,
                     275802..275807)
                     /locus_tag="Bsph_0253"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212032"
     gene            276487..277170
                     /locus_tag="Bsph_0254"
                     /db_xref="GeneID:6020671"
     CDS             276487..277170
                     /locus_tag="Bsph_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696013.1"
                     /db_xref="GI:169825855"
                     /db_xref="GeneID:6020671"
                     /translation="MNIIFFILLGIIYFFLANAIEVAIIKQLFFLIGLTLVSIGIIRY
                     IKERYIESQNYAEMKEASEEEMKAIPHTQCLISQDALKGLLLNEHTNMLIFAHREELE
                     EELKIIEIPFSKIYEVAMMEDEMFVLRTKNYLMSGSLLGEEENVAEEEEEVEEDDTVS
                     QLSLKFVVDHLSEPILEYMFMDQGEHPIARDEEEYEEAMELCEKWFQKISVIIKRHEL
                     ERVPIRHWQ"
     gene            complement(277229..278923)
                     /locus_tag="Bsph_0255"
                     /db_xref="GeneID:6020902"
     CDS             complement(277229..278923)
                     /locus_tag="Bsph_0255"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_001696014.1"
                     /db_xref="GI:169825856"
                     /db_xref="GeneID:6020902"
                     /translation="MKGIFQFKTLKAKILSAFILLLVLVVSFTAYTYTSNTAMEKQAK
                     ALVKEDLVVLNASNNLALSMSVRLSAALNYVLTGDEKYKETFNEYRQIAEDNNALLDK
                     YDTSEERTKTVELARDWSQIVKTEVFDVYQQGNKELALENLMDTQNLVSSVRNGYEQL
                     ANDREEAITAVGNDVVTTSSTNRTIGIIVSSILTIIGILIAIVTASTISKPIKVVANR
                     MKELADGNLQLDPLTVKTRDEIGTLMSAANDMNDQLKQTIQSIYTVSETVAASSEELA
                     QSSNEVQAGTEQITVTMQELASGTETQASTTGDLAETMTAFKRSIQETTQEGTELKDH
                     SSQVQDLTISGKNLMIQSTQQMAAINEIMLDSVKKVENLNDQSAEISKLVSVIDDISN
                     QTNLLALNAAIEAARAGEHGKGFAVVADEVRKLAEQVQFSVTDISTIVNRIQGETGTV
                     TTALQTGYEEVKRGTAQLDQTSETFEQISSAVEDMIDNITTISNNLNQLADGSETINA
                     SIDEMASISQESAAGVEQTTATVEETAATMDEIARSANLLAGLAEELNGQLKQFKI"
     misc_feature    complement(278156..278302)
                     /locus_tag="Bsph_0255"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(278162..278167,278174..278179,
                     278183..278188,278195..278200,278204..278209,
                     278258..278260,278264..278269,278276..278281,
                     278285..278290,278297..278302))
                     /locus_tag="Bsph_0255"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(277364..278062)
                     /locus_tag="Bsph_0255"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(277382..277966)
                     /locus_tag="Bsph_0255"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(277385..277390,277397..277399,
                     277406..277411,277418..277420,277427..277432,
                     277436..277441,277448..277453,277457..277462,
                     277469..277471,277478..277483,277490..277492,
                     277499..277504,277511..277516,277520..277525,
                     277532..277534,277541..277546,277553..277555,
                     277562..277567,277604..277609,277616..277621,
                     277625..277630,277637..277642,277649..277651,
                     277658..277663,277670..277672,277679..277681,
                     277691..277693,277712..277714,277721..277723,
                     277733..277735,277742..277747,277754..277756,
                     277763..277765,277772..277777,277784..277789,
                     277796..277798,277805..277810,277814..277816,
                     277826..277831,277835..277840,277847..277849,
                     277856..277861,277868..277873,277880..277882,
                     277889..277894,277901..277903,277910..277915,
                     277919..277924,277931..277933,277940..277945,
                     277952..277957))
                     /locus_tag="Bsph_0255"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(277646..277747)
                     /locus_tag="Bsph_0255"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(279188..280183)
                     /locus_tag="Bsph_0256"
                     /db_xref="GeneID:6020903"
     CDS             complement(279188..280183)
                     /locus_tag="Bsph_0256"
                     /EC_number="3.4.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="L-Ala--D-Glu endopeptidase"
                     /protein_id="YP_001696015.1"
                     /db_xref="GI:169825857"
                     /db_xref="GeneID:6020903"
                     /translation="MHRHFIFLLTFILLGITLCPADSFAKEEATEEEIVQQRMSYYVQ
                     FDELLIPWHFLAAIDQYERNLQSVRKDIPKRDGYLSIQFSDEYWSGALNPIKEDSKPE
                     TISYFGGMGLDGNNDGIASPKDDEDVIFSMASYLAKYGTTDEDFKLALWEYYGSEEAV
                     NQIFTISTLYRHYKTIELDAHTFPLNISSTYSYKGTWGANRGWGGRRIHEGTDIFANY
                     GTPVLSTSYGVVEVKGWNQFGGWRIGIRDNHNSYHYYAHLGSYHKDIEVGTIVEPGTV
                     LGYVGSSGYGKEGTSGKFPPHLHYGIYKFNGRTEWAFDPYPSLLQWERQAKSKKQ"
     misc_feature    complement(279227..>279625)
                     /locus_tag="Bsph_0256"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(279239..279565)
                     /locus_tag="Bsph_0256"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:216566"
     gene            280345..282294
                     /locus_tag="Bsph_0257"
                     /db_xref="GeneID:6020904"
     CDS             280345..282294
                     /locus_tag="Bsph_0257"
                     /codon_start=1
                     /transl_table=11
                     /product="protein prkA"
                     /protein_id="YP_001696016.1"
                     /db_xref="GI:169825858"
                     /db_xref="GeneID:6020904"
                     /translation="MSFTSYYVINQALNGGKAINILDKVKSYREEENRLKWEGTFADY
                     LNIVRERPEVAQTAHSRVYNMIKSAGVEERDGQKMYKFFGHEIFGLETAIERLVEEYF
                     HPAARRLDVRKRILLLMGPVSGGKSTIVTLLKRGLEQYSRTDEGAVYAIKGCPMHEDP
                     LHLIPHHLRNDFFEEYGIRIEGSLSPLNTMRLEKEYDGRIENVMIERISFSEDKRVGI
                     GTFTPSDPKSQDIADLTGSIDFSTIGEFGSESDPRAYRFDGELNKANRGMMEFQEMLK
                     LDEKFLWNLLSLTQEGNFKAGRFALISADELIVAHTNETEYRSFISNKKNEALHSRII
                     VMPIPYNLKVSQEEHIYEKMIKESDMSHVHIAPHALKAAAIFSVLTRLEVPKKQGVDL
                     IKKMRLYDGENVEGFNSVDLEELKKEFPNEGMNGIDPRYIINRISSAIIRKEVPSINA
                     LDVLRALKDGLDQHASISQEDREKYMNYIAVARKEYDEIAKNEVQKAFVYSYEESAKT
                     LMNNYLDNVEAFCNKNKLFDPLTGEEMNPDEKLMRSIEEQIGISENAKKAFREEILIR
                     ISAYARKGKRFDYNSHERLREAIQKKLFADLKDVVKITTSSKMPDESQLKKINEVVAR
                     LVDEHGYNTTSANELLQYVGSLLNR"
     misc_feature    280402..282291
                     /locus_tag="Bsph_0257"
                     /note="Putative Ser protein kinase [Signal transduction
                     mechanisms]; Region: PrkA; COG2766"
                     /db_xref="CDD:225357"
     misc_feature    281521..282270
                     /locus_tag="Bsph_0257"
                     /note="PrkA serine protein kinase C-terminal domain;
                     Region: PrkA; pfam06798"
                     /db_xref="CDD:219180"
     gene            282471..283628
                     /locus_tag="Bsph_0258"
                     /db_xref="GeneID:6020905"
     CDS             282471..283628
                     /locus_tag="Bsph_0258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696017.1"
                     /db_xref="GI:169825859"
                     /db_xref="GeneID:6020905"
                     /translation="MTEHENKGFVISQENWSLHRKGHQDQQRHMEKVKDAIKNNLPDL
                     VSEESIVMSNGREVIKIPIRSLDEFKIRYNYDNSKHVGQGQGDSNIGDVVARDGSKAN
                     QAQGKGKEAGDKPGQDYYEAEVSIEEIQNVLFRELELPNLQQKEKAEIVTEKIDFNDI
                     RKKGLMGNVDKKRTILNALKRNAMQGKAEITPIHNDDLRFKTWDEVVKPESKAVVLAM
                     MDTSGSMGAFEKYCARSFFFWMTKFLRSKYGTVEIEFIAHHTEAKVVTEEEFFTKGES
                     GGTICSSAYKKALELIEEKYSPSRYNIYPVHFSDGENISMDNEKCLKLVAELMNVSSM
                     FGYGEVNQHNRFSTLMYTYKKIDDPKFRHHILRKKGDVYDALKSFFKKNEE"
     misc_feature    282495..283610
                     /locus_tag="Bsph_0258"
                     /note="sporulation protein YhbH; Region: spore_yhbH;
                     TIGR02877"
                     /db_xref="CDD:234046"
     gene            283674..285077
                     /locus_tag="Bsph_0259"
                     /db_xref="GeneID:6020906"
     CDS             283674..285077
                     /locus_tag="Bsph_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="stage V sporulation protein R"
                     /protein_id="YP_001696018.1"
                     /db_xref="GI:169825860"
                     /db_xref="GeneID:6020906"
                     /translation="MDTKELHRAIDEITEIASGFGLDFYPMRYEICPADIIYTFGAYG
                     MPTRFSHWSFGKQFHKMKLQYDLGLSQIYELVINSNPCYAFLLDTNTLTQNKLIIAHV
                     LAHCDFFKNNVRFSNTRRDMVESMTATAERIAGYEREYGKDEVEQFLDAVLAIQEHID
                     PSILRPKLSWSEEDELEEEKAPIKSPYDDLWSLEEKDKVYKPIRRRLKQFPPKPEKDL
                     LLFLEEHSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWASFWHQRIMRELNLTT
                     PETIEYAKLNAGVVQPSKTSINPYYLGIKIFEDIENRYNNPTEEMKRLGVQPNTGREK
                     IFEVREVESDISFIRNYLSKDLAKREDLYLFQKKGNEYRITDKDYEMVRDQLVSMRVN
                     GGFPYILVKNGDYLRNGELYLMHGYEGMELDPHYLENVLPYIYQLWGRPVHLETYVDG
                     KPMLYSYDGTKNYKRNV"
     misc_feature    283677..284900
                     /locus_tag="Bsph_0259"
                     /note="SpoVR like protein; Region: SpoVR; pfam04293"
                     /db_xref="CDD:218010"
     misc_feature    283683..285056
                     /locus_tag="Bsph_0259"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: SpoVR; COG2719"
                     /db_xref="CDD:225340"
     gene            complement(285131..285565)
                     /locus_tag="Bsph_0260"
                     /db_xref="GeneID:6023436"
     CDS             complement(285131..285565)
                     /locus_tag="Bsph_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696019.1"
                     /db_xref="GI:169825861"
                     /db_xref="GeneID:6023436"
                     /translation="MKGGQTMQSFNSRKFNDPEEPENNSTEKHARNHITFNFTFNIGN
                     TDFHFEQRAEGGGQINEDVGTNANQGGQNASDGSHTRNVNSQFADGNGRSGIAGNNND
                     EAGGQQGIKVRDSLVIDSDIHSSSNHSESHEEDNDLTEETEE"
     gene            285686..286603
                     /locus_tag="Bsph_0261"
                     /db_xref="GeneID:6023437"
     CDS             285686..286603
                     /locus_tag="Bsph_0261"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696020.1"
                     /db_xref="GI:169825862"
                     /db_xref="GeneID:6023437"
                     /translation="MGFEYLGNWNGEGKLKTFKKVYIEITSVCNLACSFCPPTARAKG
                     LIKVEQFNKILDEIRPHTKYIYLHVKGEPLLHPRIDQLLDAAHAKGFKVNITTNGTLI
                     KKNREKILGKPALRQINFSLHSFDGHEGSENREKYLGDILDFVRESREYKTIISYRLW
                     NLQKDHVSDVAARRNRETLEILENEYNLDFRIEEKVEPGKGVKIGPNIYLNQDHEFRW
                     PSLLEPEDEGKGFCHALRSQAAILVDGTVVPCCLDGEGVINLGNVHEKSFAEIVDGER
                     ATNIIDGFSRREAVEELCRKCGYRQKFGM"
     misc_feature    285713..286369
                     /locus_tag="Bsph_0261"
                     /note="putative 7-cyano-7-deazaguanosine (preQ0)
                     biosynthesis protein QueE, clostridial; Region:
                     rSAM_QueE_Clost; TIGR03963"
                     /db_xref="CDD:188478"
     misc_feature    285752..>286096
                     /locus_tag="Bsph_0261"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(285770..285772,285776..285778,285782..285784,
                     285788..285796,285890..285892,285896..285901,
                     285971..285979,286046..286048)
                     /locus_tag="Bsph_0261"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    286379..286576
                     /locus_tag="Bsph_0261"
                     /note="Domain of unknown function (DUF4008); Region:
                     DUF4008; pfam13186"
                     /db_xref="CDD:221965"
     gene            complement(286634..287032)
                     /locus_tag="Bsph_0262"
                     /db_xref="GeneID:6023438"
     CDS             complement(286634..287032)
                     /locus_tag="Bsph_0262"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_001696021.1"
                     /db_xref="GI:169825863"
                     /db_xref="GeneID:6023438"
                     /translation="MNHMSDFLKLVGEQLRIIRLSKGLSQEEVAERTGKLGFSKGRVS
                     NIEHGQSNITLSTLETLMKALDIPPEELFNFQKLSGVTDIEEKNLMLDIHRSLLRERN
                     LDEVKYVVRITKDFLDTIDSQSKKNSPNGQ"
     misc_feature    complement(<286772..287002)
                     /locus_tag="Bsph_0262"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(286817..286999)
                     /locus_tag="Bsph_0262"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(286889..286891,286973..286975,
                     286985..286987))
                     /locus_tag="Bsph_0262"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(286892..286894,286976..286978))
                     /locus_tag="Bsph_0262"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(286886..286891,286901..286903,
                     286910..286912,286952..286957))
                     /locus_tag="Bsph_0262"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            287224..287910
                     /locus_tag="Bsph_0263"
                     /db_xref="GeneID:6023439"
     CDS             287224..287910
                     /locus_tag="Bsph_0263"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696022.1"
                     /db_xref="GI:169825864"
                     /db_xref="GeneID:6023439"
                     /translation="MEDESKVKYLLEEIAKIKIGKVVTSKKRFAMDGIPYITEEVLRK
                     LSLEDNTSLLPKVDSTLKEPFSFSLVPAQSILLNKMNLKEAYIYQCKTDVCISHDIMA
                     IIPKESILIGDYLFHFMKWYQNNKERCNVYSLMIDLPSIAIQHNVVQLINAVEQLLKN
                     KGSLVTAVNELPKYFDNISRQVKQHSDSLHEGFEQLNDQYIAMLDHIFNGDFLNDFQE
                     YHVFQSICSE"
     gene            complement(287960..289630)
                     /locus_tag="Bsph_0264"
                     /db_xref="GeneID:6023440"
     CDS             complement(287960..289630)
                     /locus_tag="Bsph_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="YP_001696023.1"
                     /db_xref="GI:169825865"
                     /db_xref="GeneID:6023440"
                     /translation="MSTKKQLLSIFALGGINEIGKNMYVVQYADDMILIDCGAKFPDE
                     TLLGIDLIIPDITYLLENKEKVKALIVTHGHEDHIGGIPYLLKKLNVPVYATRFTLGL
                     IELKLKEHKLLRETDLIEIHADSALHLGEIDVSFFRTNHSIPDCLGIVLATPEGNVVH
                     TGDFKFDLTPVNNQFADIHKMAEIGSKGVLVLISESTNAERPGLTPSEQLVGHHIEEA
                     FFHAERKIIISTFASNVNRIQQIVHATIAANRKLALLGRSMVNVVDVAIERGYLFVPD
                     DLLIDAREVKYLPPEEVVVLCTGSQGEPLAALARLANGNHREVKVLPDDMVILAASPI
                     PGNEKGVSRIVDHLFQLGAKVIYGSSSHTGMHVSGHGYQEDLKLMLTFMKPQFFIPIH
                     GEFRMLHQHRLLAEAVGVQKGHTFIMKNGDVVDIENAVARQTRKVPSGDTYVDGIGIG
                     EVEGIVLRDRKQLSEDGMLVIVLTLSKADGAIISEPDTISRGFVYAKDFEELLNKVNV
                     LTKEIIMELQQESRQIHVLRREIKKAVGQYLFTKTKRKPMILPIIIEI"
     misc_feature    complement(287969..289624)
                     /locus_tag="Bsph_0264"
                     /note="mRNA degradation ribonucleases J1/J2
                     (metallo-beta-lactamase superfamily) [Translation,
                     ribosomal structure and biogenesis; Replication,
                     recombination and repair]; Region: COG0595"
                     /db_xref="CDD:223668"
     misc_feature    complement(288992..289567)
                     /locus_tag="Bsph_0264"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     misc_feature    complement(288443..>288538)
                     /locus_tag="Bsph_0264"
                     /note="RNA-metabolising metallo-beta-lactamase; Region:
                     RMMBL; pfam07521"
                     /db_xref="CDD:203663"
     gene            289840..290604
                     /locus_tag="Bsph_0265"
                     /db_xref="GeneID:6022364"
     CDS             289840..290604
                     /locus_tag="Bsph_0265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696024.1"
                     /db_xref="GI:169825866"
                     /db_xref="GeneID:6022364"
                     /translation="MSDFVQHAIFEHRFWLEIMQNHAQFIHDALYPSEQDDIQRANSF
                     IQQFSRLLTYVSSIDATNAVAFTITVDDNVEQFKQFKLHLLRHQLSGDIGIHLTPTFV
                     NHMVNELEEYQNVLSYLRKGEVPPIFHELHHHLIWLLDASGHAGIIQDNLDGVEKRLK
                     QKSHEFAKHFEQFYLKAVELTGYLRTNMHSFPALSRFNKDVELEMTLFKTFLKELEEM
                     ELSAEVLGTFTAPMADHMWREEQYYLMKLVQSRGEG"
     misc_feature    289849..290193
                     /locus_tag="Bsph_0265"
                     /note="Domain of unknown function (DUF2935); Region:
                     DUF2935; pfam11155"
                     /db_xref="CDD:192714"
     misc_feature    290215..290586
                     /locus_tag="Bsph_0265"
                     /note="Domain of unknown function (DUF2935); Region:
                     DUF2935; pfam11155"
                     /db_xref="CDD:192714"
     gene            complement(290643..291137)
                     /gene="ykuD"
                     /locus_tag="Bsph_0266"
                     /db_xref="GeneID:6022365"
     CDS             complement(290643..291137)
                     /gene="ykuD"
                     /locus_tag="Bsph_0266"
                     /codon_start=1
                     /transl_table=11
                     /product="spore protein ykuD-like protein"
                     /protein_id="YP_001696025.1"
                     /db_xref="GI:169825867"
                     /db_xref="GeneID:6022365"
                     /translation="MIHTVKPGETLIQISRDYRTPVASIIAANPGIQSGTLYVDQPII
                     IPGFPDPETIPYRIEISTENRWLRLYRNSILQKQYPIAVGRMLHETPVGSFIIINKDP
                     NPGGPFGTMWMSLSKEHYGIHGTNDPSSIGHAVSHGCIRMQNPDVEELASIVPIGTEV
                     VIHP"
     misc_feature    complement(291003..291134)
                     /gene="ykuD"
                     /locus_tag="Bsph_0266"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    complement(290649..>291080)
                     /gene="ykuD"
                     /locus_tag="Bsph_0266"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     misc_feature    complement(290652..290975)
                     /gene="ykuD"
                     /locus_tag="Bsph_0266"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:217702"
     gene            291261..291494
                     /locus_tag="Bsph_0267"
                     /db_xref="GeneID:6022366"
     CDS             291261..291494
                     /locus_tag="Bsph_0267"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696026.1"
                     /db_xref="GI:169825868"
                     /db_xref="GeneID:6022366"
                     /translation="MKEFKITYFFDEIHYVRRFIFIESQQEAEKLVKSERDQYISFTD
                     SRGIYHELHTRHVRVIQISEYHRIDKSAKRNDT"
     gene            291537..291749
                     /locus_tag="Bsph_0268"
                     /db_xref="GeneID:6022367"
     CDS             291537..291749
                     /locus_tag="Bsph_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696027.1"
                     /db_xref="GI:169825869"
                     /db_xref="GeneID:6022367"
                     /translation="MMDKEQIPHEKKIFMNLNSKDKPDMVESDTISLFDLHEDMQTVD
                     AIPVEELNKRVEREGDELIELQPDEL"
     gene            291762..291959
                     /locus_tag="Bsph_0269"
                     /db_xref="GeneID:6022368"
     CDS             291762..291959
                     /locus_tag="Bsph_0269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696028.1"
                     /db_xref="GI:169825870"
                     /db_xref="GeneID:6022368"
                     /translation="MNRENGDAQFSVSGTNIDEVKQKNAESGLSYNEVKALLAKQGGH
                     GTAVFSDTNVDEVKQEIHKHQ"
     gene            292320..292904
                     /locus_tag="Bsph_0270"
                     /db_xref="GeneID:6020683"
     CDS             292320..292904
                     /locus_tag="Bsph_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696029.1"
                     /db_xref="GI:169825871"
                     /db_xref="GeneID:6020683"
                     /translation="MARPIELSNVTQIYLEEYQRILKKMMQGMTYVTITCSISENFIK
                     QIIPYQIAAIQMSENVLRFTTNIPVQNLALEIIRTHTEMLESIEALQNRCCVVQNSEY
                     ELYEYMCAYKEITEAMFNAMCAPPVSNSININYLREMIVHHQGGIRLAQNVLRFCICQ
                     ELIPILKCMIQTLCEQLEAMEKLLDSLQNCDCEC"
     misc_feature    292440..292871
                     /locus_tag="Bsph_0270"
                     /note="Domain of unknown function (DUF305); Region:
                     DUF305; pfam03713"
                     /db_xref="CDD:217686"
     gene            292949..293074
                     /locus_tag="Bsph_0271"
                     /db_xref="GeneID:6020684"
     CDS             292949..293074
                     /locus_tag="Bsph_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696030.1"
                     /db_xref="GI:169825872"
                     /db_xref="GeneID:6020684"
                     /translation="MVLALFLHENSLSKNNEEMSIKARLKIHVLVSGIMALAKSY"
     gene            293142..293282
                     /locus_tag="Bsph_0272"
                     /db_xref="GeneID:6020685"
     CDS             293142..293282
                     /locus_tag="Bsph_0272"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696031.1"
                     /db_xref="GI:169825873"
                     /db_xref="GeneID:6020685"
                     /translation="MWEYYTGRKNEAEKYLQEISEKYFVVIEKLKALNEILLDGKKQY
                     IH"
     gene            complement(293328..293933)
                     /locus_tag="Bsph_0273"
                     /db_xref="GeneID:6020686"
     CDS             complement(293328..293933)
                     /locus_tag="Bsph_0273"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696032.1"
                     /db_xref="GI:169825874"
                     /db_xref="GeneID:6020686"
                     /translation="MLYALLGDLHSNIEDTKAVLTHIQQTAKEAKIIGLGDLYECTIS
                     KKKAQTMSGLSLQRAAIVESKFEELLTFPSIRGNQEERITQVTGIERFRALPEIMEID
                     GATLMHGHQFKWSVSWQPTFPSFQKPLFFFGHSHESGLYHQQKKLPIRIRYGQPIVLQ
                     DKQYGVNVGSVVDHREWCLYDSEKRTVTFMCVPSVDKGTMS"
     misc_feature    complement(293379..293933)
                     /locus_tag="Bsph_0273"
                     /note="Calcineurin-like phosphoesterase superfamily
                     domain; Region: Metallophos_2; pfam12850"
                     /db_xref="CDD:221807"
     gene            294179..295675
                     /locus_tag="Bsph_0274"
                     /db_xref="GeneID:6020687"
     CDS             294179..295675
                     /locus_tag="Bsph_0274"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty-acid-CoA ligase"
                     /protein_id="YP_001696033.1"
                     /db_xref="GI:169825875"
                     /db_xref="GeneID:6020687"
                     /translation="MTMYMTDILEKYAVQQPSKIATLYNGNKLSYREFYKHVERFAAY
                     LQEQNYKKEDVIALYTLNTDLFLIAYLGVQLAGYVAMPINTKLAAPEVEFIFNHSQAK
                     GLIYDERLAETLENVSYSFQHIIGFQDMNHILTNTNLVRAVVPLEAHDTAVVMYTSGT
                     TGKPKGVMLTHQNIVATADIWSSSMNMLNTDKMFICTPLFHCAGLHVFAMPMFYQGGT
                     VLIEEAFSPTKTLEQIAVTEATIFFGVPSMYTIILNTPGFKEHSFNHLRLLCYGAAPM
                     PYELVKQVKEAFSNVKVQNLYGQTENTPAATSLLDTDALTKIGSVGKPLEQTEVRVVD
                     SEGKLVPAGEVGEICVRGPQVMKGYLRNPEETARTIIDGWLYSGDLGRFDEEGYLYIV
                     DRKKDMIIRGGENIYPIEVEEVLYQLPEILEAAVVGLPHEVYGEVPKAFVVFKEGKYL
                     DEEIILSYCQSRLAKYKVPYEIECLTELPRNASGKVLKHTLRPKVRTI"
     misc_feature    294185..295666
                     /locus_tag="Bsph_0274"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    294197..295654
                     /locus_tag="Bsph_0274"
                     /note="Prokaryotic long-chain fatty acid CoA synthetases
                     similar to Escherichia coli FadD; Region:
                     FC-FACS_FadD_like; cd05936"
                     /db_xref="CDD:213302"
     misc_feature    order(294638..294640,294647..294664,294668..294673)
                     /locus_tag="Bsph_0274"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(294647..294649,294992..294997,295061..295078,
                     295313..295315,295349..295351,295358..295360,
                     295391..295393,295631..295633)
                     /locus_tag="Bsph_0274"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(294647..294649,294767..294772,294911..294913,
                     294917..294922,294929..294931,294992..294997,
                     295061..295078,295313..295315,295349..295351,
                     295358..295360,295382..295393,295574..295576)
                     /locus_tag="Bsph_0274"
                     /note="putative active site [active]"
                     /db_xref="CDD:213302"
     misc_feature    order(294767..294769,294917..294922,294929..294931,
                     294992..294994,295382..295390,295556..295558,
                     295574..295576)
                     /locus_tag="Bsph_0274"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     gene            295901..296842
                     /locus_tag="Bsph_0275"
                     /db_xref="GeneID:6020855"
     CDS             295901..296842
                     /locus_tag="Bsph_0275"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696034.1"
                     /db_xref="GI:169825876"
                     /db_xref="GeneID:6020855"
                     /translation="MLLSSCQPFSQQDAENKNQLTVLTVEFNSGAPIANLYITVTDVQ
                     NGNVVEEAIGSEEGEAIFSKLKEGREYAIAATTLENSATNDGYTTIENFTYDTTKPYF
                     RLQTHFTRDEQELDVPVVMQNPELPHGCEITSLTAVLNYYGMNVSKLEMADNYLPKEE
                     IRTIGNQRFGPNPNEAFAGNPRDKARGMYVFAAPIVKAAEAAIAEKQADLRVTDMRNA
                     SQADILQLVREGVPVVTWVTLDLSKPKKNANRGWIYKGATTSQDAFMNLHAVVLTGHL
                     GDKVVVMDPLKGYVTYNVDQFFKSYHELGEQAVAVHK"
     misc_feature    296246..296758
                     /locus_tag="Bsph_0275"
                     /note="Peptidase_C39 like family; Region: Peptidase_C39_2;
                     pfam13529"
                     /db_xref="CDD:222201"
     misc_feature    order(296270..296272,296288..296290,296702..296704,
                     296750..296752)
                     /locus_tag="Bsph_0275"
                     /note="putative active site [active]"
                     /db_xref="CDD:239073"
     gene            296900..298132
                     /locus_tag="Bsph_0276"
                     /db_xref="GeneID:6020856"
     CDS             296900..298132
                     /locus_tag="Bsph_0276"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696035.1"
                     /db_xref="GI:169825877"
                     /db_xref="GeneID:6020856"
                     /translation="MAIEHAFLPVLLGDEMNAYGMARAFYEAYGVKPLALNHTNMEKI
                     QQSDLLTFREVPRLHIEERFVTALKAIAQEFTEKKLLLLACDEFYVKKIVEHKDELIE
                     DFLVPYVNTSLAHQLLTRESMYELCAQFGFQYPAMHVCTVNDYEDYEMSLDYPIVIKP
                     MNMTKYATCIFPGKKKVYIAHDKEEKDSIFHAIYKESAYRDDLMIQQYIPGEDANMRV
                     VNAYVGQDGKTKLLAVGNPILEEHSPEGIGRYVAIMTAYNPALMENVKLFLEAIQFQG
                     FATFDMKYDERDGHYKLLSIELHNELSNYYVTASGYNLMQYVADDYVRGSKQPLTYVQ
                     NKHLWTIVPNGVLFKYVQNEQLIIEAKSLIRQGMATDSIFNYKDMNAKRWLNVTVDNL
                     NFYRKYKKYFNNKGLSNS"
     misc_feature    297266..297787
                     /locus_tag="Bsph_0276"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:247809"
     gene            298129..298830
                     /locus_tag="Bsph_0277"
                     /db_xref="GeneID:6020857"
     CDS             298129..298830
                     /locus_tag="Bsph_0277"
                     /EC_number="5.1.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate racemase"
                     /protein_id="YP_001696036.1"
                     /db_xref="GI:169825878"
                     /db_xref="GeneID:6020857"
                     /translation="MKKQTLGIIGGVGPLATMFIGEMIVRRTKAQKDQEHLHTIIDND
                     TNIPDRTAFILDNTKENPVPVIMEDAKKLASVGADMIAIPCNTAHTFYDEIQAGSPIP
                     VLHMIRETAKRASELGAERVGILATTGTLTSRMYQEALEEYGITPVVPDNEMRAHVMT
                     IIYDFVKAGKDVTQDDWQPIEDAMLALNCDRIVLGCTELSIVNRDLKLSNVYIDSLIV
                     LAECAILACGYELID"
     misc_feature    298129..298800
                     /locus_tag="Bsph_0277"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:241919"
     misc_feature    298138..298800
                     /locus_tag="Bsph_0277"
                     /note="aspartate racemase; Region: asp_race; TIGR00035"
                     /db_xref="CDD:213495"
     gene            299049..300197
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /db_xref="GeneID:6020858"
     CDS             299049..300197
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase-like protein"
                     /protein_id="YP_001696037.1"
                     /db_xref="GI:169825879"
                     /db_xref="GeneID:6020858"
                     /translation="MSVISLLKEELQAKWNFEATMKIQEEMIPAMLEGKDIVAESPTG
                     SGKTLAYVLPLLNKVNGAKKQTQGLIVAPSQELAMQIVEVIREWTAGTDITVQQLIGG
                     ANSARQIEKLKKKPTIVVGTPGRLNELARAGKLKLKEIETVVLDECDQLLSREYRVVI
                     KSFIEGSAFGRQVVVVSATITEEIELVASRMMFEPVRFKIKPEDMLKVGKVTHSFVKV
                     EERDKTEFLRRLSHTEGLRALAFVNNIDQLLMKETKLQYRSAPIVTLHSDMKKEERKK
                     ALDAFRKGDARILIATDIAARGLDIAGLTHVIHVDVPRTIEQYLHRSGRTGRAGADGE
                     VLTLLSYRDEKTYKKWTREIPGKPVQKIWHDGKLKEGNSKTIGQKGGK"
     misc_feature    299067..299645
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:247805"
     misc_feature    299094..299672
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    299178..299192
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    299484..299495
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    299676..300062
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(299775..299786,299844..299849,299922..299930)
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(299946..299948,300009..300011,300021..300023,
                     300030..300032)
                     /gene="yfmL"
                     /locus_tag="Bsph_0278"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            300199..301428
                     /locus_tag="Bsph_0279"
                     /db_xref="GeneID:6020859"
     CDS             300199..301428
                     /locus_tag="Bsph_0279"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="YP_001696038.1"
                     /db_xref="GI:169825880"
                     /db_xref="GeneID:6020859"
                     /translation="MTFEEKLQAYAELAVKVGVNIQPGQYLLVNTSVEALDFARLVVK
                     EAYKAGAGRVHVNFSDDEMDRAYFEHASDEEFNRFPEWVVQMRDELIERKGALLWIDA
                     ADPDKLTGISADRLATHQKVSGAALKNYRNAVMKDLIAWSIIAVPSPKWAAKVFPQLT
                     ADEQVPALWEAIFKTVHIGEGNAVENWHQHVTNLESRAELLNNKKYAKLHYTAPGTDL
                     TIALAPQHKWVTGGSKTPEGHVFIANMPTEEVYTLPMKQGVDGYVSNSKPLVYQGNII
                     DGFKLTFKEGKIIKAEAEVGQDLLQELIQVDEGSSYLGEVALVPHESPISASGILYFN
                     TLFDENASNHLAIGEAYPTCLEGGRDLENGQLEALGANISVTHEDFMVGNGEMDIDGI
                     LPDGTIEPIFRKGSWAF"
     misc_feature    300202..301419
                     /locus_tag="Bsph_0279"
                     /note="Thermophilic metalloprotease (M29); Region:
                     Peptidase_M29; pfam02073"
                     /db_xref="CDD:145308"
     misc_feature    300214..301422
                     /locus_tag="Bsph_0279"
                     /note="Leucyl aminopeptidase (aminopeptidase T) [Amino
                     acid transport and metabolism]; Region: AmpS; COG2309"
                     /db_xref="CDD:225191"
     gene            301440..302372
                     /locus_tag="Bsph_0280"
                     /db_xref="GeneID:6020591"
     CDS             301440..302372
                     /locus_tag="Bsph_0280"
                     /codon_start=1
                     /transl_table=11
                     /product="YcsK"
                     /protein_id="YP_001696039.1"
                     /db_xref="GI:169825881"
                     /db_xref="GeneID:6020591"
                     /translation="MENGGEQMKHIGSLIGMIILLLTGWSSSAFAQTENYIAIGDSLA
                     AGQTPFQQIDAGYSDLIAMRLQSMNQLKFYTKELAFPGYTTAHVLEKIKTEEARDLLA
                     NATLVTVSAGANDLLSLIRLNPMAGTLTFSQLQTDYALNTVRKNIIAILNELAERAPK
                     AQVYVVGYYFAYPAVHLTQKEGTNAQLVKLNKILQQQAELAGAGYVNVYDSFGLNATN
                     YLPNYTDVHPNMEGYRQMANAFLKAYSGSDALSIAPSQLPKPNPVSFEEILQERASAQ
                     PKQQKVTSSQSVRSVRSIQGFHGYTAFMEKLEKR"
     misc_feature    301545..302168
                     /locus_tag="Bsph_0280"
                     /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase; cd00229"
                     /db_xref="CDD:238141"
     misc_feature    order(301563..301565,301683..301685,301779..301781,
                     302118..302120)
                     /locus_tag="Bsph_0280"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    order(301563..301565,302118..302120)
                     /locus_tag="Bsph_0280"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    order(301563..301565,301683..301685,301779..301781)
                     /locus_tag="Bsph_0280"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     gene            302482..303639
                     /locus_tag="Bsph_0281"
                     /db_xref="GeneID:6020592"
     CDS             302482..303639
                     /locus_tag="Bsph_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease sbcD-like protein"
                     /protein_id="YP_001696040.1"
                     /db_xref="GI:169825882"
                     /db_xref="GeneID:6020592"
                     /translation="MKIFHTADWHLGKLVQGVYMTEDQQYILQQFIQAIDEEKPDVII
                     IAGDLYDRSMPPIEAVNLLNDTLAKIVLEKKIPILAVAGNHDSAGRLNFGSRLMRDSG
                     LYIKGQFTKDHAPIIINDQYGEVHFHLVPFADPASIRSIFEEEAIRSHQDAMQKIIEH
                     ITAGMDTSKRNIFVGHAFVTKYGEEEANTSDSERPLSIGGSDCVNAALFKPFHYTALG
                     HLHKAHFVLNETIRYAGSPLKYSLSEHLHEKGFLIIDLDEHGNSTVTKRKLMPRRDLR
                     VVEGELEELLMLPPSDDYVFVRLTDATSVSSPMERIRTVFPHALHVERKILRQEKPSE
                     LQVVEAEKLEDIDLFRSFFTDIIGIQPDEDTERLFTEMLQELLDKERETVK"
     misc_feature    302482..303630
                     /locus_tag="Bsph_0281"
                     /note="DNA repair exonuclease [DNA replication,
                     recombination, and repair]; Region: SbcD; COG0420"
                     /db_xref="CDD:223497"
     misc_feature    302485..303210
                     /locus_tag="Bsph_0281"
                     /note="Mre11 nuclease, N-terminal metallophosphatase
                     domain; Region: MPP_Mre11_N; cd00840"
                     /db_xref="CDD:163616"
     misc_feature    order(302503..302505,302509..302511,302623..302625,
                     302731..302736,303007..303009,303136..303144)
                     /locus_tag="Bsph_0281"
                     /note="active site"
                     /db_xref="CDD:163616"
     misc_feature    order(302503..302505,302509..302511,302623..302625,
                     302731..302733,303007..303009,303136..303138,
                     303142..303144)
                     /locus_tag="Bsph_0281"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163616"
     misc_feature    order(302515..302535,302632..302634,302740..302742,
                     302746..302751,302878..302883)
                     /locus_tag="Bsph_0281"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:163616"
     misc_feature    303292..303540
                     /locus_tag="Bsph_0281"
                     /note="Type 5 capsule protein repressor C-terminal domain;
                     Region: SbcD_C; pfam12320"
                     /db_xref="CDD:221528"
     gene            303636..306716
                     /locus_tag="Bsph_0282"
                     /db_xref="GeneID:6020593"
     CDS             303636..306716
                     /locus_tag="Bsph_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease sbcCD subunit C"
                     /protein_id="YP_001696041.1"
                     /db_xref="GI:169825883"
                     /db_xref="GeneID:6020593"
                     /translation="MKPLKLTITAFGPYKNTEIIDFQQLGEHRLFAISGKTGAGKTTI
                     FDAICYALYGAGSGEDRQDTALLRSGFADDDVYTAVELIFEMHGRVYQILRQPGHIKG
                     KNKTATGKKVELAEVREGMLDYNIVEKQQTLEVDKKIQEIIGLTKDQFSQIVMLPQGE
                     FRKLLTSDSTNKEVILRKIFKTDRFGAMTKLLDAKRKEAESDLERAKQLKEHLLGQIV
                     GALPQRSSPLFKQIADNTENMFQLKQALEEELTYYKKCFEDIQRQYEEAYNHHQKEQE
                     FYRLAKTLNEQFEEQSKRQERLQMLLDEQDKYHAKEREIALAEQAERLLLLEQQCMDL
                     RAEQNLKEQAYQQAQSSQLQTKELLQRAQEKYEAEEAKESERQLLLQQEMQLQALLPK
                     FEAYDSHVQQLQIAEQYVKTAKQGAADNIVLIEKESAQLEQLSQSIEHYEKQMEPYEG
                     YLEKLPKLQEQVTLLMQMENYTKTVEIAKQDVIATKARYQDSRLELQQLEQRWLTSQA
                     SVLAQQLKEGQPCPVCGSTAHQQTHNEKLEIVELAQVETLRVKVSSDERLYLEKEAML
                     RSAQQLQQETLKQLDAHSIKQQDQAQIIASLEKMEKEITSLRVINQQLAQTRKNQKEQ
                     RLTIEQLQNKQLKLEEYLSEQMKSWTRLQAIVEEQHKQMPTNIPTLPQLKQTLTDVSQ
                     QKMDFQKLWQESQHHLHAMKEADSNAKLAVEIAKQNFEELKLKMNDKREQFSTSMQEA
                     GFVSYEDYAAAKRSATQLEELRRACSDYTLQVHTLKIQISEGEKHLQGKEEQDLALME
                     ATVKSLRIAYEDAFKQLQQIDGFVKSCQSFMNKVEETERELRLLESEAGRVKELYGLL
                     NGQNSKKLSFERYIQINYLDQITEAANIRLNHLSNGQFELRRSDRLEKHAKQSGLGLD
                     VYDAYTDQLRDVKTLSGGEKFNASLSLALGMADVIQSFQGNIHIETMFIDEGFGSLDE
                     ESLNKAIDTLIDLQDSGRMIGVISHVPELKSAMPAVLHVEKTLNGHSQTHFEIK"
     misc_feature    303636..>304133
                     /locus_tag="Bsph_0282"
                     /note="ATP-binding cassette domain of sbcCD; Region:
                     ABC_sbcCD; cd03279"
                     /db_xref="CDD:213246"
     misc_feature    303648..304286
                     /locus_tag="Bsph_0282"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:222160"
     misc_feature    303738..303761
                     /locus_tag="Bsph_0282"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213246"
     misc_feature    order(303747..303752,303756..303764,304107..304109)
                     /locus_tag="Bsph_0282"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213246"
     misc_feature    304098..304109
                     /locus_tag="Bsph_0282"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213246"
     misc_feature    <305166..306692
                     /locus_tag="Bsph_0282"
                     /note="ATPase involved in DNA repair [DNA replication,
                     recombination, and repair]; Region: SbcC; COG0419"
                     /db_xref="CDD:223496"
     misc_feature    <306405..306686
                     /locus_tag="Bsph_0282"
                     /note="ATP-binding cassette domain of sbcCD; Region:
                     ABC_sbcCD; cd03279"
                     /db_xref="CDD:213246"
     misc_feature    306420..306449
                     /locus_tag="Bsph_0282"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213246"
     misc_feature    306513..306530
                     /locus_tag="Bsph_0282"
                     /note="Walker B; other site"
                     /db_xref="CDD:213246"
     misc_feature    306537..306548
                     /locus_tag="Bsph_0282"
                     /note="D-loop; other site"
                     /db_xref="CDD:213246"
     misc_feature    306612..306632
                     /locus_tag="Bsph_0282"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213246"
     gene            complement(306757..306888)
                     /locus_tag="Bsph_0283"
                     /db_xref="GeneID:6020594"
     CDS             complement(306757..306888)
                     /locus_tag="Bsph_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696042.1"
                     /db_xref="GI:169825884"
                     /db_xref="GeneID:6020594"
                     /translation="MFLMKVSKVVKTAVKLAPIVIPIVKKVMAAKKGTTSTVSPRKK"
     gene            307003..307125
                     /locus_tag="Bsph_0284"
                     /db_xref="GeneID:6020595"
     CDS             307003..307125
                     /locus_tag="Bsph_0284"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696043.1"
                     /db_xref="GI:169825885"
                     /db_xref="GeneID:6020595"
                     /translation="MANEMNQTIITVLLLEVGSKLKVENTKTMKNNIPNTKGIK"
     gene            307629..308189
                     /locus_tag="Bsph_0285"
                     /db_xref="GeneID:6020733"
     CDS             307629..308189
                     /locus_tag="Bsph_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696044.1"
                     /db_xref="GI:169825886"
                     /db_xref="GeneID:6020733"
                     /translation="MDKKRLLMLVEIAIFAAIGLVLDQVSFKVWAQGGSVSLVMVPIM
                     LIAIRWGLVAGLTTGLLVGVMQTMFGAYIVHWLQGLLDYGVAFTVVGLAAIVRRPLLE
                     AASQLNKTKMALYIILGTVFAGFLRYVAHTTAGAVFFAEYAGDQNAWIYSIIYNGTYM
                     LPAKVLTAIVGVLLFTAAPQLMQRKA"
     misc_feature    307653..308177
                     /locus_tag="Bsph_0285"
                     /note="Thiamine transporter protein (Thia_YuaJ); Region:
                     Thia_YuaJ; pfam09515"
                     /db_xref="CDD:220276"
     gene            308361..309116
                     /locus_tag="Bsph_0286"
                     /db_xref="GeneID:6020734"
     CDS             308361..309116
                     /locus_tag="Bsph_0286"
                     /EC_number="3.4.11.18"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="YP_001696045.1"
                     /db_xref="GI:169825887"
                     /db_xref="GeneID:6020734"
                     /translation="MIVKTQEEIEAFKKIGRICAEIRETMKSATKPGVTTLELDEIAG
                     RMFAEAGAISGPKGEYDFPGYTCISVNEEVAHGIPGKRVIQEGDIVNIDVSGSLDGYF
                     ADTGISFVVGDGYEDKEKLCRVAKDAFDRAMTKVKAGSKLNQIGKAVEREANANGLTV
                     IMNLTGHGLGRSLHDEPNHILNYYDAWDSTIMKEGMVLAVEPFISAKAEHIVEAGDGW
                     TFITPDKSLVAQIEHSVIVTKDKPIILTSLDED"
     misc_feature    308385..309101
                     /locus_tag="Bsph_0286"
                     /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
                     known as methionyl aminopeptidase and Peptidase M.
                     Catalyzes release of N-terminal amino acids,
                     preferentially methionine, from peptides and arylamides;
                     Region: MetAP1; cd01086"
                     /db_xref="CDD:238519"
     misc_feature    order(308586..308588,308637..308639,308670..308672,
                     308859..308861,308961..308963,309054..309056)
                     /locus_tag="Bsph_0286"
                     /note="active site"
                     /db_xref="CDD:238519"
     gene            complement(309145..309924)
                     /locus_tag="Bsph_0287"
                     /db_xref="GeneID:6020735"
     CDS             complement(309145..309924)
                     /locus_tag="Bsph_0287"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696046.1"
                     /db_xref="GI:169825888"
                     /db_xref="GeneID:6020735"
                     /translation="MSDSTILICLFPIQFNTKGEESMPRFLLMTISYIVSLILTFSSF
                     FMKLNGQSSLEISNRFSVVFAPVDGSHLIWIVIYLFIGYWLVMNIKKTSMKQSALFSC
                     INILQALMIYVWHHELFIVSLGITLLLVLYLFMLYNTYPLHDKSLSGRIPFAIYLAWM
                     TFIFITNISFTLTAYGWNGFGLSTPLWAVILLTLGGVIALHIRFHHFDIMYPSVFIWA
                     YIGIALHNGFDELLVTTAALFLCGVLFVGILFIKKNPAYQK"
     gene            310058..310867
                     /locus_tag="Bsph_0288"
                     /db_xref="GeneID:6020736"
     CDS             310058..310867
                     /locus_tag="Bsph_0288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696047.1"
                     /db_xref="GI:169825889"
                     /db_xref="GeneID:6020736"
                     /translation="MTQNLKNLDLSIELDKKMYKKKLKVLQYEMLNAQQFLLKNKIGL
                     ILVFEGMDAAGKGGAIKRLIERVDPRGYVVHPISAPQPHELRYNYLQRFWRKLPQHGQ
                     IAVFDRSWYGRVLVERIEGFATKEEWSRAYEEINNFEKILTEGDYIIIKFWLHVSDEE
                     QLKRFKEREQNPYKSWKLTEEDWRNREKSPQYIEAANEMFDKTDKKNAPWILVAGNDK
                     KYARVQVLQETLAHIEREALKRGLHLTNVLDNPLLEDADSSSLNTLNEKKK"
     misc_feature    310070..310774
                     /locus_tag="Bsph_0288"
                     /note="Polyphosphate kinase 2 (PPK2); Region: PPK2;
                     cl11971"
                     /db_xref="CDD:245821"
     gene            311043..311630
                     /gene="yjcK"
                     /locus_tag="Bsph_0289"
                     /db_xref="GeneID:6020737"
     CDS             311043..311630
                     /gene="yjcK"
                     /locus_tag="Bsph_0289"
                     /EC_number="2.3.1.128"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine
                     N-acetyltransferase-like protein"
                     /protein_id="YP_001696048.1"
                     /db_xref="GI:169825890"
                     /db_xref="GeneID:6020737"
                     /translation="MVLKIWNLLRKKGGNVVTIKGEKCYIRTFQENDARSLTGLVSRN
                     KYFWSTYEPLQRPEYYTIDAQYKKIQESLYLMDSKREFTFGIFEHGTNNLIGHIALYA
                     VKRLPYSSAFVGYAMDEIYVGKGIVTEAVNMVVRFAFDQIGLHRVEAYVSTQNNPSMR
                     VLEKAGFQQEGLLRKLLYINGHWVDHYMYARLEDE"
     misc_feature    311115..311627
                     /gene="yjcK"
                     /locus_tag="Bsph_0289"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    311118..311627
                     /gene="yjcK"
                     /locus_tag="Bsph_0289"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:247736"
     gene            complement(311701..312264)
                     /gene="ytiB"
                     /locus_tag="Bsph_0290"
                     /db_xref="GeneID:6024658"
     CDS             complement(311701..312264)
                     /gene="ytiB"
                     /locus_tag="Bsph_0290"
                     /EC_number="4.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase-like protein"
                     /protein_id="YP_001696049.1"
                     /db_xref="GI:169825891"
                     /db_xref="GeneID:6024658"
                     /translation="MTMLQDILGFNKEFVQEKKYEPFITTKYPDKRIVVLSCMDTRLV
                     ELLPKAMNLRNGDVKIVKSAGALVSHPFGAVMRSLLVAVYGLQADEVYVVGHYDCGMS
                     AVDPDAMLSEMVKRGINPETIKMLEYSGFDLKEFLRGFGDVATSVKKSVDTIRNHPLM
                     VKDVPVHGLIIDPNTGHLDLIEDGNHQ"
     misc_feature    complement(311722..312180)
                     /gene="ytiB"
                     /locus_tag="Bsph_0290"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeD; cd03379"
                     /db_xref="CDD:239474"
     misc_feature    complement(order(311752..311754,311968..311970,
                     311977..311979,312007..312009,312022..312024,
                     312088..312090,312097..312099,312139..312147,
                     312151..312153,312172..312174,312178..312180))
                     /gene="ytiB"
                     /locus_tag="Bsph_0290"
                     /note="active site clefts [active]"
                     /db_xref="CDD:239474"
     misc_feature    complement(order(311968..311970,311977..311979,
                     312145..312147,312151..312153))
                     /gene="ytiB"
                     /locus_tag="Bsph_0290"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:239474"
     misc_feature    complement(order(311731..311733,311737..311739,
                     311743..311748,311752..311754,312022..312027,
                     312034..312039,312079..312081,312085..312087,
                     312091..312099,312112..312117,312139..312150))
                     /gene="ytiB"
                     /locus_tag="Bsph_0290"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239474"
     gene            312263..312388
                     /locus_tag="Bsph_0291"
                     /db_xref="GeneID:6024659"
     CDS             312263..312388
                     /locus_tag="Bsph_0291"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696050.1"
                     /db_xref="GI:169825892"
                     /db_xref="GeneID:6024659"
                     /translation="MKIAPFLTKNILEQNFNYANNKDFFQTIFTIKKQTSYTLAA"
     gene            complement(312441..312575)
                     /locus_tag="Bsph_0292"
                     /db_xref="GeneID:6024660"
     CDS             complement(312441..312575)
                     /locus_tag="Bsph_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696051.1"
                     /db_xref="GI:169825893"
                     /db_xref="GeneID:6024660"
                     /translation="MFITTVLGFSAVLLISTGFFIHYLQVGLDSKSSVTVDPKPNEKF
                     "
     gene            complement(312714..313955)
                     /locus_tag="Bsph_0293"
                     /db_xref="GeneID:6024661"
     CDS             complement(312714..313955)
                     /locus_tag="Bsph_0293"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="YP_001696052.1"
                     /db_xref="GI:169825894"
                     /db_xref="GeneID:6024661"
                     /translation="MNLLLSFNTKLLKYAELAIKVGVNIQKDQYLYISCSTDNLKLAQ
                     IITKLAYKNGAKQVFVDLSDDELVRARYEGAPKDSFDFFPPWKVQEREWLAENGAAFL
                     SISSQNPDLLKGIERDRIMAFQKASGQALANYYQLLQSDKFSWSVIAAPSKAWAAKVF
                     PDLPEDQQMDALWEAIFAATRIDLEHSVEAWLAHDKELHDKAEYLNSKQYKSLHYTAP
                     GTDLTIELPAHHIWTGGSSVNEQGQTFMANIPTEEIFTAPLKTGINGFVSSTKPLSYG
                     GNIINNFTLTFKDGRIIDVKAEEGQEILASLIETDEGAHYLGEIALVPHHSPISQSNL
                     LFYNTLFDENASNHLAIGSAYAFCIEGGKDMSSDELAAHGINQSLTHVDFMIGSNKMN
                     IDGITHDNQKEPIFRDGNWAF"
     misc_feature    complement(312723..313940)
                     /locus_tag="Bsph_0293"
                     /note="Thermophilic metalloprotease (M29); Region:
                     Peptidase_M29; pfam02073"
                     /db_xref="CDD:145308"
     misc_feature    complement(312720..313934)
                     /locus_tag="Bsph_0293"
                     /note="Leucyl aminopeptidase (aminopeptidase T) [Amino
                     acid transport and metabolism]; Region: AmpS; COG2309"
                     /db_xref="CDD:225191"
     gene            314203..314949
                     /gene="motA"
                     /locus_tag="Bsph_0294"
                     /db_xref="GeneID:6024662"
     CDS             314203..314949
                     /gene="motA"
                     /locus_tag="Bsph_0294"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein motA"
                     /protein_id="YP_001696053.1"
                     /db_xref="GI:169825895"
                     /db_xref="GeneID:6024662"
                     /translation="MVMKGVSLTAFYNPAAILIIIFGTISAVTIAFPMQELKRVPKLF
                     KILFKETKLANDIEIIKMFSQWADLARREGLLALESKASEIEDPFLKNGLTLAIDGQN
                     ADYIRDVLTEEVEAMEERHASGSAIFTQAGTYAPTLGVLGAVVGLIAALADMNDIEKL
                     GHAISAAFMATLLGIFTGYVLWHPFANKLKRKSALEVKQKRMMIEGILSVLEGEAPRV
                     IEQKLSSYLTMEERRQISGESGAGGLGKES"
     misc_feature    314203..314931
                     /gene="motA"
                     /locus_tag="Bsph_0294"
                     /note="flagellar motor protein MotA; Validated; Region:
                     PRK08124"
                     /db_xref="CDD:181238"
     misc_feature    314206..314883
                     /gene="motA"
                     /locus_tag="Bsph_0294"
                     /note="MotA/TolQ/ExbB proton channel family; Region:
                     MotA_ExbB; cl00568"
                     /db_xref="CDD:241954"
     gene            314990..315697
                     /gene="motB"
                     /locus_tag="Bsph_0295"
                     /db_xref="GeneID:6020728"
     CDS             314990..315697
                     /gene="motB"
                     /locus_tag="Bsph_0295"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein motB"
                     /protein_id="YP_001696054.1"
                     /db_xref="GI:169825896"
                     /db_xref="GeneID:6020728"
                     /translation="MPYADILTLLLAVFIILFASSSVDQEKLERMSAVFSQVFDGGTS
                     FLEQPAPVPSPNADSDQTPQQNSAYLKDQQELAEIKDSVDNFIAVNEMEGQFATEMTD
                     EGLLVTIRDSILFDPGQATIKPEYIPIAKELADVLVSNPPRNIVITGHTDNVPAGPNF
                     SSNLELSLMRASNFYMVLLDSNSQLKSENFSAKGYGENRAIAPNDTAEGRAKNRRVEV
                     LIQPLVTEDGSEAKNTQ"
     misc_feature    314993..315649
                     /gene="motB"
                     /locus_tag="Bsph_0295"
                     /note="Flagellar motor protein [Cell motility and
                     secretion]; Region: MotB; COG1360"
                     /db_xref="CDD:224279"
     misc_feature    <314993..315106
                     /gene="motB"
                     /locus_tag="Bsph_0295"
                     /note="Membrane MotB of proton-channel complex MotA/MotB;
                     Region: MotB_plug; pfam13677"
                     /db_xref="CDD:222312"
     misc_feature    315317..315649
                     /gene="motB"
                     /locus_tag="Bsph_0295"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(315338..315343,315440..315445,315452..315454,
                     315473..315478,315485..315487,315617..315619,
                     315629..315631)
                     /gene="motB"
                     /locus_tag="Bsph_0295"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(315753..315935)
                     /locus_tag="Bsph_0296"
                     /db_xref="GeneID:6020729"
     CDS             complement(315753..315935)
                     /locus_tag="Bsph_0296"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696055.1"
                     /db_xref="GI:169825897"
                     /db_xref="GeneID:6020729"
                     /translation="MIDQMKDKLRMVNVDAMKSEHFDEANYENLTYLYEMVMKRESFS
                     PSEMQAIVAELGALRK"
     misc_feature    complement(315756..315935)
                     /locus_tag="Bsph_0296"
                     /note="Protein of unknown function (DUF1128); Region:
                     DUF1128; pfam06569"
                     /db_xref="CDD:148273"
     gene            316153..316479
                     /locus_tag="Bsph_0297"
                     /db_xref="GeneID:6020730"
     CDS             316153..316479
                     /locus_tag="Bsph_0297"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696056.1"
                     /db_xref="GI:169825898"
                     /db_xref="GeneID:6020730"
                     /translation="MGQSKLLVSIVAGAAIGAALSMLDRTTREKTIDTTKKMKEAVTY
                     YATNREELQVLVEEKVLAAKVLCENVSDNVNTIAEKVEEFKELPTTIQSMIDDTKSAF
                     TLPHKE"
     gene            316502..317419
                     /locus_tag="Bsph_0298"
                     /db_xref="GeneID:6020731"
     CDS             316502..317419
                     /locus_tag="Bsph_0298"
                     /codon_start=1
                     /transl_table=11
                     /product="transport protein"
                     /protein_id="YP_001696057.1"
                     /db_xref="GI:169825899"
                     /db_xref="GeneID:6020731"
                     /translation="MEKKKATMQNAFGFVKSFVSPEGEVIDVMTSKGFVQDLIGRVKR
                     VEISALSAQLAYFFLLSFFPLLIFLVTLLPYLNLETTQVYSFLVNVLPDEVYKLIENT
                     LNEILTNRNSSLLSIGVLGTIWSASKGINALIRALNKAYDTEGRAGILDRGLSLVFTV
                     ALVVVMAVALLLPVFGQQIGHFLFSIVGIEEQFESVWHNLRWSIPPILIFIVLMGIYW
                     FVPNTSPRLKILGVWPGAMFATLAWLVVTYAFSFYINNFANYSATYGSIGGVIILMLW
                     LYFTGIILIFGGVLNATMQKRALQKEINR"
     misc_feature    316637..317392
                     /locus_tag="Bsph_0298"
                     /note="Virulence factor BrkB; Region: Virul_fac_BrkB;
                     pfam03631"
                     /db_xref="CDD:217647"
     gene            complement(317482..319386)
                     /locus_tag="Bsph_0299"
                     /db_xref="GeneID:6020732"
     CDS             complement(317482..319386)
                     /locus_tag="Bsph_0299"
                     /EC_number="3.6.3.3"
                     /codon_start=1
                     /transl_table=11
                     /product="cadmium-transporting ATPase"
                     /protein_id="YP_001696058.1"
                     /db_xref="GI:169825900"
                     /db_xref="GeneID:6020732"
                     /translation="MEHSNRENINLIEKIKEHAELIAALMAGVFILLAWRLDISGQTT
                     ASVLLYVIAFCVGGFAKAKEGIEETIEERKLNVELLMVLAAIGSAAIGYWTEGAILIF
                     IFAVSGALETYAMNKSHREISALMNLQPEEAWLVRGSFEPMKVSVSTLQIGDHLLIKP
                     GERIPADGIIFKGQSSIDESAISGEPLPVLKREGDEIFAGTVNLNGAITMEMTKANSE
                     TLFQKIIQLVQSAQSEKSPSQQFIEKFEGTYVKFVLLGVAIMMFLPHFVLGWDWTTTF
                     YRAMVLLVVASPCALVAAIMPATLAAISNGAKNGVLFKGGLHLEHLSVLGALAVDKTG
                     TLTQGKPVVTDFIVRDGFDRNMALAILAGIETQSNHPLAQAITSYAKAEGITALPSAT
                     IEDIPGWGIKGTVHNKEYQVGKPDFVNAQHANDFANGAAAKLAAQGKTVIFIRDQNGI
                     VALTALKDTVRNEAKKAVSLLKELGIQVVMLTGDNEKTAKVIAKEAGVTEYVAECLPE
                     TKVTEMKRLLSQYQFVGMVGDGINDAPALATATTGIAMGEGTDVALETADVVLMKNDL
                     SKIAYAVRLSRKMQRIVKQNIIFSIGVIILLIASNFLQVVDLPLGVIGHEGSTILVIL
                     NGLRMLNKNV"
     misc_feature    complement(317503..319158)
                     /locus_tag="Bsph_0299"
                     /note="heavy metal translocating P-type ATPase; Region:
                     ATPase-IB_hvy; TIGR01525"
                     /db_xref="CDD:233447"
     misc_feature    complement(318427..319092)
                     /locus_tag="Bsph_0299"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:215733"
     misc_feature    complement(317641..>318000)
                     /locus_tag="Bsph_0299"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     gene            complement(319646..321202)
                     /locus_tag="Bsph_0300"
                     /db_xref="GeneID:6025300"
     CDS             complement(319646..321202)
                     /locus_tag="Bsph_0300"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase class I, aerobic"
                     /protein_id="YP_001696059.1"
                     /db_xref="GI:169825901"
                     /db_xref="GeneID:6025300"
                     /translation="MGGNTRMNLQTLEKSLYDLITETSTNLPKDVRRAIKKAKEAENA
                     GTRAAMSLDTISNNIIMAEDNVSPICQDTGLPTFKIYTPVGVNQLEIKAAIKKAINDT
                     TADAKLRPNAVDSLTGANSGNNLGDGLPVMKFEQWENDYITIKLILKGGGCENKNIQY
                     SLPCEIDGLGRAGRDLDGIRKCILHSVYQAQGQGCSAGFIGVGIGGDRSSGYDLAKEQ
                     LFRHVEDTNPNPDLAKLEEYVVKTSNTFGIGTMGFGGEATLLGCKIGVMHRIPASFYV
                     SVAYNCWAYRRMAVDIDPQTGEIIKWHYQEGEKITFKEDEVAATTEDNTTNVVELTAP
                     ITEEQIRSLKVGDVVSITGRMYTGRDAIHHHLMSHDAPVDLNGQVIYHCGPVMAKDEE
                     GNWTVKAAGPTTSIREEPYQGDIMKKFGIRAVIGKGGMGPKTLKALNEHGGVYLNAIG
                     GAAQYYADCIKGVDGVDLMEFGIPEAMWHLNVEKFTAVVTMDSHGNSLHADVDKSSLE
                     KLALHAERVF"
     misc_feature    complement(320327..321169)
                     /locus_tag="Bsph_0300"
                     /note="Fumarate hydratase (Fumerase); Region: Fumerase;
                     pfam05681"
                     /db_xref="CDD:218689"
     misc_feature    complement(319688..320314)
                     /locus_tag="Bsph_0300"
                     /note="Fumarase C-terminus; Region: Fumerase_C; pfam05683"
                     /db_xref="CDD:218690"
     gene            321270..322175
                     /locus_tag="Bsph_0301"
                     /db_xref="GeneID:6025301"
     CDS             321270..322175
                     /locus_tag="Bsph_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696060.1"
                     /db_xref="GI:169825902"
                     /db_xref="GeneID:6025301"
                     /translation="MRAKFTHSLIVFGEGVDFIERLFYNDSNPHLGGICMSAKTLLEL
                     PEEFDQYRPLIEETMKPVVLIDAYAGKTTLFQSKFAGDPYFPLAMEYPKNASGQPLKL
                     LAQVNFAELPKHLPHFPEEGIVQFYIDGYDDVLGMDFDNGKNQEGFRVIFHDTVIHDE
                     AQLIQDFSFVEKEDEEMYFPVEREMTLSFKTGFEPLTIDDYRANEIYSSILKAIEDNE
                     TVEDAFYDALTGDGLKIGGYPFFTQEDPRAYGNYTDSSILLLQIDSVGDDILWGDCGV
                     GNFFITEEELKNKDFSNVLYNWDCH"
     misc_feature    321498..322169
                     /locus_tag="Bsph_0301"
                     /note="Domain of unknown function (DUF1963); Region:
                     DUF1963; pfam09234"
                     /db_xref="CDD:220149"
     gene            complement(322218..322403)
                     /locus_tag="Bsph_0302"
                     /db_xref="GeneID:6025302"
     CDS             complement(322218..322403)
                     /locus_tag="Bsph_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696061.1"
                     /db_xref="GI:169825903"
                     /db_xref="GeneID:6025302"
                     /translation="MSKPITDKKQQVTYLRERLEMFLEVLDALDPETAELDDIDRLIQ
                     MMDDLEDKMEQFNAREQ"
     gene            322847..323950
                     /gene="yfkF"
                     /locus_tag="Bsph_0303"
                     /db_xref="GeneID:6025303"
     CDS             322847..323950
                     /gene="yfkF"
                     /locus_tag="Bsph_0303"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696062.1"
                     /db_xref="GI:169825904"
                     /db_xref="GeneID:6025303"
                     /translation="MLLPLISIIFERDGVSSALNGLNATGLYIGTLLISPFIEQPLRK
                     WGYKPIILMGGAFVFISLLAFPLWKSVTFWFVLRLLIGVGDHALHYATQTWITSTADH
                     KSLGKGMAIYGLSFSIGFAVGPLMVKLIEIAEALPFIVSSIMCLIAWSFVFFLQNEKP
                     ERLTGDLHARGWKRYKMAILFGWIAFLGPFVYGFLESSLNALFPVYALRKGFEVGMIP
                     IILSVFTFGGILTQVPLGALGDKVGRRNILMVGSFGGAIIFAIASFLEQSQMAVAIAF
                     FLTGTLVGSMFSLGITFMADLTPKELLPTGNLLCGIALSIGSLTGPFLGGVYLEYVKN
                     YSFLLLVAILLLIVAFILLIFGRLKNKQTLMAK"
     misc_feature    322847..323842
                     /gene="yfkF"
                     /locus_tag="Bsph_0303"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    322847..323812
                     /gene="yfkF"
                     /locus_tag="Bsph_0303"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:219516"
     misc_feature    order(322850..322858,322862..322867,322916..322918,
                     322925..322930,322937..322939,322949..322954,
                     322958..322963,323099..323104,323111..323116,
                     323123..323128,323135..323137,323171..323176,
                     323183..323188,323204..323206,323423..323425,
                     323432..323437,323444..323449,323456..323458,
                     323495..323497,323507..323509,323519..323521,
                     323528..323530,323540..323542,323684..323686,
                     323693..323698,323705..323707,323717..323722,
                     323729..323731,323762..323767,323774..323779,
                     323786..323791,323798..323800)
                     /gene="yfkF"
                     /locus_tag="Bsph_0303"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            324187..324822
                     /locus_tag="Bsph_0304"
                     /db_xref="GeneID:6025304"
     CDS             324187..324822
                     /locus_tag="Bsph_0304"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696063.1"
                     /db_xref="GI:169825905"
                     /db_xref="GeneID:6025304"
                     /translation="MTEMKKLSIHRALTELKMLQQRIEGATNEVSSVVANRKSNQKIN
                     GIEIVEYEKQMQASYDKVMGLISYRNNIKALVVQSNASTKVIVGKEEMTVAEAIERKQ
                     SIQYEKNLLEVMQHQYRSAIHTVAKENDALPAKLETYLINILGNKDKQSPEEVKLHTE
                     TFMKRNEFEIIDPLNVRQRIETLSSRIEEFESEVDAVLSESNATTFIEVQA"
     gene            complement(325153..326541)
                     /locus_tag="Bsph_0305"
                     /db_xref="GeneID:6024763"
     CDS             complement(325153..326541)
                     /locus_tag="Bsph_0305"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="YP_001696064.1"
                     /db_xref="GI:169825906"
                     /db_xref="GeneID:6024763"
                     /translation="MERLTQQTTMTVGQKFPLIIRRLGINGEGVGFYKRNVIFVKGAI
                     PGEEITAQVTKTQRNFAEAEILSIHKASKHRQEAPCPVYNECGGCQLQHMTYEKQLLE
                     KRDIVIQALERYAKPLAETVEVRKTLGMDNPWHYRNKSQFQVRKEGKRVYAGLFAEGS
                     NKLLNINDCLVQHPVTSKITVATRKILQKLNITIYDGRTLDGLVRTIVVRTGIRTGET
                     QVVLVTTRKEIPHLAELITRIKKIDPSIVSIAQNINREKTSLIFGDETIVLDGKETIH
                     EELGELAFDLSARAFFQLNPTQTVHLYDEIKKAAALTGKESVVDAYCGVGTVGLWLAD
                     QAAEVRGMDVIPESIQDARKNARNHGFKHTKYAVGTAESVLSKWRKEGFTPDVITVDP
                     PRTGLASEFIQTVLKLRPKRFVYTSCNPSTLAKDLQQLSKHYHVEYIQPVDMFSQTAQ
                     VECVAKLVLKNK"
     misc_feature    complement(326344..326511)
                     /locus_tag="Bsph_0305"
                     /note="TRAM domain; Region: TRAM; pfam01938"
                     /db_xref="CDD:110897"
     misc_feature    complement(325186..326475)
                     /locus_tag="Bsph_0305"
                     /note="23S rRNA (uracil-5-)-methyltransferase RumA;
                     Region: rumA; TIGR00479"
                     /db_xref="CDD:129571"
     misc_feature    complement(325288..325590)
                     /locus_tag="Bsph_0305"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(325369..325371,325429..325437,
                     325510..325515,325561..325581))
                     /locus_tag="Bsph_0305"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(326570..327394)
                     /locus_tag="Bsph_0306"
                     /db_xref="GeneID:6024764"
     CDS             complement(326570..327394)
                     /locus_tag="Bsph_0306"
                     /note="Hypothetical 30.6 kDa protein in fumA 3'region
                     precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696065.1"
                     /db_xref="GI:169825907"
                     /db_xref="GeneID:6024764"
                     /translation="MWKQHIVGAVIATFIIAAGISINPYFAAGSDEHHWGFKRAKNGE
                     QAEAGAQLDQLLDKYGAIYKGKADKKIAYLTFDNGYENGFTESILDTLKKEDVPATFF
                     LTGHYLDSASDLVKRMVKDGHTIGNHSYGHPNMARLTPEGMRAEWRKFDGKLREMTGI
                     DRTTYARPPEGTFNAKLLEVGNAEGYRHIFWSVAFKDWMKDERRGADYAYNALMEQLH
                     PGAVILMHTVAQDNAEALPMFIAEAKKQGYTFLSLDDLVLEYEDFPVALQSSAPSL"
     misc_feature    complement(326636..327298)
                     /locus_tag="Bsph_0306"
                     /note="Catalytic NodB homology domain of the carbohydrate
                     esterase 4 superfamily; Region: CE4_SF; cl15692"
                     /db_xref="CDD:247041"
     misc_feature    complement(326624..327295)
                     /locus_tag="Bsph_0306"
                     /note="delta-lactam-biosynthetic de-N-acetylase; Region:
                     spore_pdaA; TIGR02884"
                     /db_xref="CDD:131930"
     gene            complement(327451..328407)
                     /gene="yfhF"
                     /locus_tag="Bsph_0307"
                     /db_xref="GeneID:6024765"
     CDS             complement(327451..328407)
                     /gene="yfhF"
                     /locus_tag="Bsph_0307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696066.1"
                     /db_xref="GI:169825908"
                     /db_xref="GeneID:6024765"
                     /translation="MIKLLVKYIFEKGVLLMKIVIAGGTGFVGKAFIKLAQENGHSIF
                     VLTRSPSSEKNGIQYVQWLQDESLPIEALEGADAFVNLAGVSLNNGRWTKKQKKDIYW
                     SRMHATLEIVRIIEKLRKKPKVLVNASAVGFYPHSTEVIYNENFSDAATNFLGSTVDD
                     WERHAKRAEHLGIRVALARFGVILGRKSGALPPMLLPYQMHIGGTIGSGKQWLSWVHI
                     EDVARALYFAILHEEIHGPFNVTAPHATRMKEFGQTIAMVMNRRHWMPVPSFAIRFAL
                     GEQSTLVLEGQHVQPALLEKHHFTFKFPHLTEALEDLLIAQN"
     misc_feature    complement(327466..328356)
                     /gene="yfhF"
                     /locus_tag="Bsph_0307"
                     /note="atypical (a) SDRs, subgroup 8; Region: SDR_a8;
                     cd05242"
                     /db_xref="CDD:187553"
     misc_feature    complement(327478..328353)
                     /gene="yfhF"
                     /locus_tag="Bsph_0307"
                     /note="TIGR01777 family protein; Region: yfcH"
                     /db_xref="CDD:233570"
     misc_feature    complement(order(327859..327870,327934..327936,
                     327946..327948,328018..328026,328099..328101,
                     328156..328164,328261..328269,328324..328335,
                     328339..328341))
                     /gene="yfhF"
                     /locus_tag="Bsph_0307"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187553"
     misc_feature    complement(order(327934..327936,327946..327948,
                     328021..328023,328096..328098))
                     /gene="yfhF"
                     /locus_tag="Bsph_0307"
                     /note="putative active site [active]"
                     /db_xref="CDD:187553"
     gene            328507..329319
                     /gene="recX"
                     /locus_tag="Bsph_0308"
                     /db_xref="GeneID:6024766"
     CDS             328507..329319
                     /gene="recX"
                     /locus_tag="Bsph_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_001696067.1"
                     /db_xref="GI:169825909"
                     /db_xref="GeneID:6024766"
                     /translation="MLAMRMITKIARQKNNPERYNIYLNEEYAFPVDEAILLQFSLTK
                     GKVLDEFEIQEIAYEDEIRKAFNKGLNFLSYQMRSEHEVKKKLLTLEFGEAVVLEAIQ
                     KLKSYGFINDENYSKALLDTKKATMKKGPRAIRQDLMKKGINKNLQDEVLATYSFEEQ
                     IKLALQLAEKIIRSEKRKTPAQVKAKIQDYLLRKGYAFPIVEEVLNQIELEQDEDNWQ
                     PLLDAQGEKVWKKYVSKYTGYELKMKVKQTLYQKGFPIEVIDRFIEEKENEE"
     misc_feature    328525..329316
                     /gene="recX"
                     /locus_tag="Bsph_0308"
                     /note="recombination regulator RecX; Provisional; Region:
                     recX; PRK14135"
                     /db_xref="CDD:237619"
     gene            329316..329645
                     /locus_tag="Bsph_0309"
                     /db_xref="GeneID:6024767"
     CDS             329316..329645
                     /locus_tag="Bsph_0309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696068.1"
                     /db_xref="GI:169825910"
                     /db_xref="GeneID:6024767"
                     /translation="MNEKNYAAMSEHELREEIAFLKEKARKAEQLGIINEFAVYERKA
                     LMAAAYLVDLNTIVPGEMYRIDRSDNEFFQVDYLKGRFAWGHRLGGDKYQEALPVSML
                     SPVKVGK"
     misc_feature    329322..329627
                     /locus_tag="Bsph_0309"
                     /note="Protein of unknown function (DUF1811); Region:
                     DUF1811; pfam08838"
                     /db_xref="CDD:149785"
     gene            329646..329915
                     /gene="yfhJ"
                     /locus_tag="Bsph_0310"
                     /db_xref="GeneID:6021984"
     CDS             329646..329915
                     /gene="yfhJ"
                     /locus_tag="Bsph_0310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696069.1"
                     /db_xref="GI:169825911"
                     /db_xref="GeneID:6021984"
                     /translation="MEEKIEKLTAELLAKNPQMSVGRARVWVELLWSDFESTSAKAGH
                     DYRGPDYTENLVRQLITSYGDKLHAFAGRNPKYAHLLDASDDMIQ"
     misc_feature    329649..329873
                     /gene="yfhJ"
                     /locus_tag="Bsph_0310"
                     /note="WVELL protein; Region: WVELL; pfam14043"
                     /db_xref="CDD:206213"
     gene            complement(329951..330913)
                     /gene="yfhP"
                     /locus_tag="Bsph_0311"
                     /db_xref="GeneID:6021985"
     CDS             complement(329951..330913)
                     /gene="yfhP"
                     /locus_tag="Bsph_0311"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696070.1"
                     /db_xref="GI:169825912"
                     /db_xref="GeneID:6021985"
                     /translation="MGIAIGGLALADPIVANHSMTFTAVMAGTIIGSQAPDVDTVLKL
                     RNNAIYIRHHRGITHSLPAVAIWPILITAVISLILQDVNVFHLWLWTFLAVALHVFVD
                     IFNAYGTQAIRPFSRKWVALGVINTFDPIIFSLHCLGIVLWAFGANPVWTFSIMYIII
                     VIYYLLRFAVQKAVKNAVHSTIQDEEYVIVAPTMRFFHWRIAAKSKTHYYVGRAYGRT
                     VNIYDKFEIKPLPNTALIHAAMKDPNLAAFVSFSPMYRWEISELENGLLEVRLIDLRY
                     RSDNRYPFVAVAHLNDDNEIVTSYTGWIFTEDKLQKKLQIGASN"
     misc_feature    complement(330455..330913)
                     /gene="yfhP"
                     /locus_tag="Bsph_0311"
                     /note="Predicted membrane-bound metal-dependent hydrolases
                     [General function prediction only]; Region: COG1988"
                     /db_xref="CDD:224899"
     gene            331138..332181
                     /locus_tag="Bsph_0312"
                     /db_xref="GeneID:6021986"
     CDS             331138..332181
                     /locus_tag="Bsph_0312"
                     /EC_number="3.2.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="YP_001696071.1"
                     /db_xref="GI:169825913"
                     /db_xref="GeneID:6021986"
                     /translation="MNYPYVTEFRHSLVEWFNAEKRDLPWRHTTDPYKIWVSEVMLQQ
                     TRVDTVIPYYNRFMESFPTLDLLAEAPQDYLLKHWEGLGYYSRVRNLQAGAREVLENY
                     GGVVPDNRHEISKLKGVGPYTAGAILSIAYNKPEHAVDGNVMRVLSRVLNINEDIAVP
                     KTKKIFEAAVEELIDPTNASSFNQGLMELGALICTPTSPKCLLCPVREYCTAFNEGEP
                     EKLPVKSKKMKMKHLSYNILVCQDEQGRFLMEQRPEEGLLAKLWQFPMIDTTSQITEE
                     SFLKECFINVQARHELLSFKHVFSHLTWHINSYYMKCKSSSTGDWFTQEQIEQLPMPV
                     PMLKIWEEVKNNK"
     misc_feature    331156..332169
                     /locus_tag="Bsph_0312"
                     /note="A/G-specific DNA glycosylase [DNA replication,
                     recombination, and repair]; Region: MutY; COG1194"
                     /db_xref="CDD:224115"
     misc_feature    331234..331707
                     /locus_tag="Bsph_0312"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    order(331267..331275,331282..331284,331396..331398)
                     /locus_tag="Bsph_0312"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    331483..331506
                     /locus_tag="Bsph_0312"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(331513..331515,331684..331686,331696..331698)
                     /locus_tag="Bsph_0312"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    331555..331557
                     /locus_tag="Bsph_0312"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    331717..331767
                     /locus_tag="Bsph_0312"
                     /note="Iron-sulfur binding domain of endonuclease III;
                     Region: EndIII_4Fe-2S; pfam10576"
                     /db_xref="CDD:204516"
     misc_feature    331864..332160
                     /locus_tag="Bsph_0312"
                     /note="DNA glycosylase (MutY in bacteria and hMYH in
                     humans) is responsible for repairing misread  A*oxoG
                     residues to C*G by removing the inappropriately paired
                     adenine base from the DNA backbone. It belongs to the
                     Nudix hydrolase superfamily and is important...; Region:
                     DNA_Glycosylase_C; cd03431"
                     /db_xref="CDD:239523"
     misc_feature    order(331903..331911,332026..332028,332035..332040)
                     /locus_tag="Bsph_0312"
                     /note="DNA binding and oxoG recognition site [nucleotide
                     binding]"
                     /db_xref="CDD:239523"
     gene            332270..332446
                     /locus_tag="Bsph_0313"
                     /db_xref="GeneID:6021987"
     CDS             332270..332446
                     /locus_tag="Bsph_0313"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696072.1"
                     /db_xref="GI:169825914"
                     /db_xref="GeneID:6021987"
                     /translation="MKKQNNQNFQPNKNMQRQSEEFGYETDVNEVQKQNAKAEQKKAP
                     ASGRFSKTNQDLGE"
     gene            332715..333275
                     /locus_tag="Bsph_0314"
                     /db_xref="GeneID:6021988"
     CDS             332715..333275
                     /locus_tag="Bsph_0314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696073.1"
                     /db_xref="GI:169825915"
                     /db_xref="GeneID:6021988"
                     /translation="MGFKMALPVEGETIQIHSYKHNGRIHRVWQETMVLKGTKNIVIG
                     ANERTLVTESDGRTWLTREPSICYFHAEHWFNIICMLREDGVYYYCNLSSPFVFDNNA
                     IKYIDYDLDIKVFPDMSYTLLDEDEYELHRKEMSYPDVIDKILKRNVDKLISWIQQKR
                     GPFAPDFIDVWTNRYKFQLDMQSDDC"
     misc_feature    332727..333242
                     /locus_tag="Bsph_0314"
                     /note="hypothetical protein; Provisional; Region:
                     PRK13662"
                     /db_xref="CDD:184219"
     gene            333480..335204
                     /locus_tag="Bsph_0315"
                     /db_xref="GeneID:6024181"
     CDS             333480..335204
                     /locus_tag="Bsph_0315"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug export ATP-binding/permease"
                     /protein_id="YP_001696074.1"
                     /db_xref="GI:169825916"
                     /db_xref="GeneID:6024181"
                     /translation="MRFVKPYSWEIVLTIVIGIVKFAIPLFIPLLIKIVLDDIIAADD
                     LTDGEKTKELLYWLGGTIIVFFIIRPPIEYYRQYFAQHVSNKVLFDIRKEIYAHLQRL
                     SLKYYANTRAGDVISRVINDVEQTKNFVMTGLMNVWLDLATIVIAVIIMLTMDIKLTL
                     VALLAFPFYALSVKYFFGKLRDLTRKRSQALAGVQSYLHERVAGMSIVKSFTLEKHEQ
                     TLFDQANGEFLEKALDQTKWNAKSFAVVNTITDVAPLLVIAYAGYQVINGTLSVGTMV
                     AFIAYIERLYGPLRRLVSSSTTLTQSIASMDRMFDLMDEPYEVKNKVGARELPAATGE
                     VRFDNVSFQYEKDGVSILKNINFTINPGETVAFVGMSGGGKSTIISLIPRFYDATDGF
                     VTIDGQDVRDVTLHSLRSQIGIVLQDNILFSDSVKENILMGKPDATDEQVIEAAKAAN
                     AHDFIMTLPNGYDTKVGERGVKLSGGQKQRVAIARVFLKNPPILILDEATSALDLESE
                     ALIQESLEELAHERTTIIIAHRLSTITHADKIFVIDHGQLIESGTHEQLMMEQGTYYD
                     LFQVQHLE"
     misc_feature    333492..335201
                     /locus_tag="Bsph_0315"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    333510..334346
                     /locus_tag="Bsph_0315"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:216049"
     misc_feature    334482..335183
                     /locus_tag="Bsph_0315"
                     /note="ATP-binding cassette domain of the bacterial lipid
                     flippase and related proteins, subfamily C; Region:
                     ABCC_MsbA; cd03251"
                     /db_xref="CDD:213218"
     misc_feature    334584..334607
                     /locus_tag="Bsph_0315"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213218"
     misc_feature    order(334593..334598,334602..334610,334728..334730,
                     334968..334973,335064..335066)
                     /locus_tag="Bsph_0315"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213218"
     misc_feature    334719..334730
                     /locus_tag="Bsph_0315"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213218"
     misc_feature    334896..334925
                     /locus_tag="Bsph_0315"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213218"
     misc_feature    334956..334973
                     /locus_tag="Bsph_0315"
                     /note="Walker B; other site"
                     /db_xref="CDD:213218"
     misc_feature    334980..334991
                     /locus_tag="Bsph_0315"
                     /note="D-loop; other site"
                     /db_xref="CDD:213218"
     misc_feature    335052..335072
                     /locus_tag="Bsph_0315"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213218"
     gene            335504..336517
                     /locus_tag="Bsph_0316"
                     /db_xref="GeneID:6024182"
     CDS             335504..336517
                     /locus_tag="Bsph_0316"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_001696075.1"
                     /db_xref="GI:169825917"
                     /db_xref="GeneID:6024182"
                     /translation="MRKKLLEIKGLKTTFFTDNGQIPAVDDIDFSVQEGEILGIVGES
                     GSGKSVTSLSIMGLIPSPPGKITGGEILLDGKNLVNYTEKQMQKIRGKDIAMIFQEPM
                     TSLNPLFTIGDQLKEAILIHNPKWSRKKAFARAVEIVKLVGLPRAEELLKDYPHQLSG
                     GMRQRVMIAMALVCDPQVLIADEPTTALDVTIQAQILQLMKDLNKRLNTAVLLITHDL
                     GVVAETCERVIVMYAGQVVEEAPIQEIFANPKHPYTQGLIQSVPDMRFKKENLYSIPG
                     SVPKPGSIQVGCRFAARCEYAMERCLQETPPLFEAAEQHKSRCFLLEKQEVEQRVESV
                     IKG"
     misc_feature    335516..336472
                     /locus_tag="Bsph_0316"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    335516..336223
                     /locus_tag="Bsph_0316"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    335627..335650
                     /locus_tag="Bsph_0316"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(335636..335641,335645..335653,335798..335800,
                     336047..336052,336149..336151)
                     /locus_tag="Bsph_0316"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    335789..335800
                     /locus_tag="Bsph_0316"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    335975..336004
                     /locus_tag="Bsph_0316"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    336035..336052
                     /locus_tag="Bsph_0316"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    336059..336070
                     /locus_tag="Bsph_0316"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    336137..336157
                     /locus_tag="Bsph_0316"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    336206..336466
                     /locus_tag="Bsph_0316"
                     /note="oligopeptide/dipeptide ABC transporter, ATP-binding
                     protein, C-terminal domain; Region: oligo_HPY; TIGR01727"
                     /db_xref="CDD:213647"
     gene            336501..337400
                     /locus_tag="Bsph_0317"
                     /db_xref="GeneID:6024183"
     CDS             336501..337400
                     /locus_tag="Bsph_0317"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_001696076.1"
                     /db_xref="GI:169825918"
                     /db_xref="GeneID:6024183"
                     /translation="MLLKVDGLKKYFPIRKGVLNTQTGDVKAVDDVSFEVFEGETLGI
                     VGESGCGKSTTGRLLMRLLEPTEGNIEFAGKMISELSNNEMRKARRDIQMIFQDPYAS
                     LNPRHNIGKILEEPLIVHGIGSAKERKQKVLELLEIVGLNEYHVKRYPHQFSGGQRQR
                     IGIARALMTNPRLIIADEPVSALDVSIQAQVLNLLQKLQKDLKLTYIFISHDLGVVRH
                     ISNRVGVMYLGKLVELTASEGLYAEPLHPYTQALLSSVPVPDPTFEREQIIITGDIPS
                     ASNPPSGCTFHTRCPFKMEHAHR"
     misc_feature    336501..337385
                     /locus_tag="Bsph_0317"
                     /note="ABC-type oligopeptide transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     AppF; COG4608"
                     /db_xref="CDD:226967"
     misc_feature    336504..337199
                     /locus_tag="Bsph_0317"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    336636..336659
                     /locus_tag="Bsph_0317"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(336645..336650,336654..336662,336789..336791,
                     337029..337034,337131..337133)
                     /locus_tag="Bsph_0317"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    336780..336791
                     /locus_tag="Bsph_0317"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    336957..336986
                     /locus_tag="Bsph_0317"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    337017..337034
                     /locus_tag="Bsph_0317"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    337041..337052
                     /locus_tag="Bsph_0317"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    337119..337139
                     /locus_tag="Bsph_0317"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    337188..>337397
                     /locus_tag="Bsph_0317"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:244611"
     gene            337503..339119
                     /locus_tag="Bsph_0318"
                     /db_xref="GeneID:6024184"
     CDS             337503..339119
                     /locus_tag="Bsph_0318"
                     /note="initiation of sporulation, competence development;
                     KO:K02035"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide ABC transporter binding protein"
                     /protein_id="YP_001696077.1"
                     /db_xref="GI:169825919"
                     /db_xref="GeneID:6024184"
                     /translation="MKKKKLWTLGVMLLLILSTILAACGGSDTKDTGSKDTSTGGDTA
                     SSGEPKILVYGRGGDSVALDPAVVTDGESFTVTANIYETLVNFGEQDVTIQPGLAKSW
                     EASEDGLTYTFQLQEGVKFHDGTDFNAEAVVKNIERWKSGADKHPYFSSQFLVGDKQV
                     IESVNAEGDYTVVFKLSQPQAPFLKNLAMSPFAIASPTAFEADEEGLSANPVGTGPFK
                     FVSWVRNDSITIEKNPDYYIDGYPKLDKVIYRSIPENSARLNDLLAGNIDVADGISPS
                     DKGTIEGDANLQLIERPSMNVGYLGLTVTRPPFDNVKVRQAVNYAIDKQALVDAFYEG
                     LAEPAKNPMPPVISGYNDEVAGYTYDPEKAKALLAEAGYDGKEIELWAMPVPRPYMPD
                     GQKVAEAIQKNLEDVGIKSKIVSFEWATYLEKAQNGEADAFLLGWTGDNGDADNFLYT
                     LLDGDNIGSNNYTFYDNQELHKLLTAAQTEVDEDKRNELYKQAQVIISEDAPWVPLAH
                     STPILAANKKVTNYIAHPTGSDRLGAVDIQ"
     misc_feature    337503..339113
                     /locus_tag="Bsph_0318"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    337656..339068
                     /locus_tag="Bsph_0318"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    order(338754..338756,338766..338768,338805..338816,
                     338820..338822)
                     /locus_tag="Bsph_0318"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            339336..340349
                     /locus_tag="Bsph_0319"
                     /db_xref="GeneID:6024185"
     CDS             339336..340349
                     /locus_tag="Bsph_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide ABC transporter permease"
                     /protein_id="YP_001696078.1"
                     /db_xref="GI:169825920"
                     /db_xref="GeneID:6024185"
                     /translation="MMNMLHYMGRRLFQLIPVLLGMTFIVFMLIRAIPGNPAQVILGQ
                     QATKEAVEALNASLGLDKPWYTQYFSYLAGIFQGDLGVSLRTKLPVSDEIFPYLAATA
                     ELAFFAMIIAIVIGVNAGIISAWFQNSWFDYTAMIVALIGVSVPVFWLGLMEQWTFSS
                     KLGWLPTSGREDVRNPITAITHFYLLDTLIQGRFDQFVEVLKRLILPGVALATIPMAI
                     IARITRSSMLEVMRSDYVRTARAKGQKMFIVVYKHALKNAVIPVLTVIGLQTGLLLGG
                     AILTETIFSWPGIGRYIYDAIGFRDYPVIQSGILIVAFIFIMINLIVDLLYTVVDPRI
                     KYK"
     misc_feature    339345..340343
                     /locus_tag="Bsph_0319"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    <339945..340286
                     /locus_tag="Bsph_0319"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(339960..339962,340176..340178,340200..340202,
                     340209..340211,340239..340241)
                     /locus_tag="Bsph_0319"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(339975..339980,339984..339986,339990..339992,
                     339999..340004,340008..340010,340020..340025,
                     340032..340034,340083..340085,340125..340130,
                     340137..340139,340158..340169,340176..340181,
                     340206..340211,340239..340244,340251..340256,
                     340260..340265,340272..340277,340284..340286)
                     /locus_tag="Bsph_0319"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(340035..340073,340089..340094,340104..340106)
                     /locus_tag="Bsph_0319"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            340362..341258
                     /locus_tag="Bsph_0320"
                     /db_xref="GeneID:6020596"
     CDS             340362..341258
                     /locus_tag="Bsph_0320"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter permease"
                     /protein_id="YP_001696079.1"
                     /db_xref="GI:169825921"
                     /db_xref="GeneID:6020596"
                     /translation="MMTGAIDIKKEAAPVRERAVGPWLEGWRSFKKSKVSLVGAGIVI
                     FFVLLAVIGPFIAPQGINEQDLTKRLLAPSADHWFGTDDFGRDIFSRIIHGARISLWV
                     GFFSVILSVIIGSLLGIIAGYYGKWIDTIISRIFDIMLAFPSMLLAIAVVSVLGPSLQ
                     NALIAIAIINIPNFGRLIRSKVLSVKEEEYIVAAKAIGMRDSRILFSHILPNSITPII
                     VQGTLAIATAIIEAAALGFLGLGAQAPAPEWGKMLADARKFLLNAPWTMIFPGLAIML
                     TVLGFNLMGDGLRDALDPKMKN"
     misc_feature    340425..341252
                     /locus_tag="Bsph_0320"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    340425..340583
                     /locus_tag="Bsph_0320"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:221848"
     misc_feature    340647..>341030
                     /locus_tag="Bsph_0320"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(340695..340700,340707..340712,340725..340727,
                     340755..340766,340770..340799,340806..340811,
                     340815..340817,340881..340883,340890..340895,
                     340899..340901,340911..340916,340923..340925,
                     340974..340976,341016..341021,341028..341030)
                     /locus_tag="Bsph_0320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    340773..340817
                     /locus_tag="Bsph_0320"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(340926..340964,340980..340985,340995..340997)
                     /locus_tag="Bsph_0320"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            341523..342140
                     /locus_tag="Bsph_0321"
                     /db_xref="GeneID:6020597"
     CDS             341523..342140
                     /locus_tag="Bsph_0321"
                     /codon_start=1
                     /transl_table=11
                     /product="stress response protein SCP2"
                     /protein_id="YP_001696080.1"
                     /db_xref="GI:169825922"
                     /db_xref="GeneID:6020597"
                     /translation="MAINLQKGQRVDLTKGNAGLNKIKVGLGWDPVGQEKSGGFLGGL
                     FSSRNSGSGRSVDCDASVLMLQDDKVLAGDDVIYFGKLTSNCGSVRHSGDNLTGDGDG
                     DDEVITIELSSVPTQFNKLVFVVNIYDAAGRNQHFGMIRNAYIRVYDDRTGSELIRYN
                     LSDDYSNLTTLICGEIYRHQTEWKFAAVGSGTNDLKLGDVVRRYQ"
     misc_feature    341526..342137
                     /locus_tag="Bsph_0321"
                     /note="Uncharacterized proteins involved in stress
                     response, homologs of TerZ and putative cAMP-binding
                     protein CABP1 [Signal transduction mechanisms]; Region:
                     TerZ; COG2310"
                     /db_xref="CDD:225192"
     misc_feature    341580..342134
                     /locus_tag="Bsph_0321"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(341691..341693,341697..341699,341835..341837)
                     /locus_tag="Bsph_0321"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            342173..342754
                     /locus_tag="Bsph_0322"
                     /db_xref="GeneID:6020598"
     CDS             342173..342754
                     /locus_tag="Bsph_0322"
                     /codon_start=1
                     /transl_table=11
                     /product="general stress protein 16U (GSP16U)"
                     /protein_id="YP_001696081.1"
                     /db_xref="GI:169825923"
                     /db_xref="GeneID:6020598"
                     /translation="MGISLQKGQKVDLTKTNPGLTNVIVGLGWDTNKYDGGNDFDLDS
                     SVFLLADTGKVADQNDFIFYNNTTGGNGSVEHSGDNLTGIGEGDDEVVKVALAQVPAH
                     VQRLAFTVTIHDAESRNQNFGMVSNAYIRIVNAASNQELIRYDLGEDFSIETAIVVGE
                     LYRHNGEWKFNAVGAGYQGGLAALCNDYGLNVN"
     misc_feature    342179..342739
                     /locus_tag="Bsph_0322"
                     /note="Uncharacterized proteins involved in stress
                     response, homologs of TerZ and putative cAMP-binding
                     protein CABP1 [Signal transduction mechanisms]; Region:
                     TerZ; COG2310"
                     /db_xref="CDD:225192"
     misc_feature    342230..342739
                     /locus_tag="Bsph_0322"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(342293..342295,342299..342301,342440..342442)
                     /locus_tag="Bsph_0322"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            342788..343363
                     /locus_tag="Bsph_0323"
                     /db_xref="GeneID:6020599"
     CDS             342788..343363
                     /locus_tag="Bsph_0323"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696082.1"
                     /db_xref="GI:169825924"
                     /db_xref="GeneID:6020599"
                     /translation="MAIQLSKGQRIDLTKQDPGLNNIGIGLGWDVKQFDGGQDFDLDA
                     SVFLLDASGKCRNEQDFIFYNNLASPDQSVVHAGDNRTGEGDGDDEKILVNLKQVSPQ
                     IDKIVVTVTIYDAEGRHQNFGQVLNAYVRLTNEESGAEVLRYDLGEDFSIETAVVFCE
                     LYRHNGEWKFAAIGSGYQGGLAALINAYGLQ"
     misc_feature    342791..343354
                     /locus_tag="Bsph_0323"
                     /note="Uncharacterized proteins involved in stress
                     response, homologs of TerZ and putative cAMP-binding
                     protein CABP1 [Signal transduction mechanisms]; Region:
                     TerZ; COG2310"
                     /db_xref="CDD:225192"
     misc_feature    342845..343354
                     /locus_tag="Bsph_0323"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(342908..342910,342914..342916,343055..343057)
                     /locus_tag="Bsph_0323"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            343473..343658
                     /locus_tag="Bsph_0324"
                     /db_xref="GeneID:6020600"
     CDS             343473..343658
                     /locus_tag="Bsph_0324"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696083.1"
                     /db_xref="GI:169825925"
                     /db_xref="GeneID:6020600"
                     /translation="MMHTIALVFLCLIERVSELETSAYILIPTIVWNMFAHIFGFHLL
                     HEAFFIILIAAFLLSSY"
     gene            343781..344974
                     /locus_tag="Bsph_0325"
                     /db_xref="GeneID:6022526"
     CDS             343781..344974
                     /locus_tag="Bsph_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding protein"
                     /protein_id="YP_001696084.1"
                     /db_xref="GI:169825926"
                     /db_xref="GeneID:6022526"
                     /translation="MQHFATEAETIFYKKPQPFTKWATPDILSYALGATLYMPASMPN
                     IVGLIQSQKYKELTSLVIDLEDAVGDSELGDCEAKLLEDISELYKLYHQKQLLLQDIP
                     LLFIRVRHVEQFNYLTSSLKEKQEVLTGYVFPKFTATQGAQYFELLEKTILENNLTLY
                     GMPILESREVLYKESRMEALLAIKSVLQQYQSRVLNIRIGATDFCGIYGIRRRMDSTI
                     YDISLIRDCIADIVNVLGREEDGFVISGPVWEYFSNQRVLKPALRMTPFSEKGALETR
                     KALLDDCLDGLIKEVLMDKQNGIVGKTVIHPSHIRVVHALYAISYEEYLDALSIVEHN
                     DGSKGVMKSHYANKMNEIKPHMRWAQRILKQAHVYGVYHETVDFASLLLNSELGGHMY
                     ATTNE"
     misc_feature    343880..344902
                     /locus_tag="Bsph_0325"
                     /note="HpcH/HpaI aldolase/citrate lyase family; Region:
                     HpcH_HpaI; cl17231"
                     /db_xref="CDD:247785"
     gene            344955..346313
                     /locus_tag="Bsph_0326"
                     /db_xref="GeneID:6022527"
     CDS             344955..346313
                     /locus_tag="Bsph_0326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696085.1"
                     /db_xref="GI:169825927"
                     /db_xref="GeneID:6022527"
                     /translation="MQQQMSKLTILPNYSIDIEITHNPHDFALTDLFQMAARINKKRQ
                     FLFISTVLGKHLAVRPQIPLLTGALLAMMYDQQGNNQKVNTITPVVQALKEGINLEEL
                     QNSMKGSVELAHKTLFIGFAETATALGHAVFNAFQSNAMYIHTTREVIPHIEPFVTFE
                     EEHSHATSHRIYTEEPNVLQQAKRIVLIDDEITTGNTVINIIETLKKKFPDVKQYVVL
                     SILDWRSEQQRIVFQQLEEQWEISIKFISIMCGTFNCTGVPSLTSVQPKVTTIATRDI
                     TLLPIKDSIDRLFYYSVAENGKINNQPYLKATGRFMLTSKQHFEQMNMLQAIAKQLKE
                     LRTDGPALVIGTGEFMYVPMQIASYLGEGVYFQSSTRSPIYCTDDVDYTITEKIVFES
                     PENNGVENYLYNVQSQLYTELFLIIERISNKEVVDRMVAALQSVSGAKVYVICMHELE
                     GV"
     misc_feature    <345501..345608
                     /locus_tag="Bsph_0326"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(345519..345527,345531..345545)
                     /locus_tag="Bsph_0326"
                     /note="active site"
                     /db_xref="CDD:206754"
     misc_feature    345615..346256
                     /locus_tag="Bsph_0326"
                     /note="Protein of unknown function (DUF3706); Region:
                     DUF3706; pfam12500"
                     /db_xref="CDD:221607"
     gene            346310..347413
                     /locus_tag="Bsph_0327"
                     /db_xref="GeneID:6022528"
     CDS             346310..347413
                     /locus_tag="Bsph_0327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696086.1"
                     /db_xref="GI:169825928"
                     /db_xref="GeneID:6022528"
                     /translation="MMTSTLQPDNMGSYAREDVIFLLRDIGNVFLEMGNEKREQLIQA
                     GTHYSEMLPMEYQPSKTYMKLFYKTLDAFADRIAIAVGVVAERIVKSRGLENLILVSL
                     ARAGTPIGILIKRYISMNYKVDVPHYSISILRGRGFDEAAIRYILSEHPQGCLQFIDG
                     WTGKGAITKELIQSCQTFNEQYQTQLKADLAVLADPGHCATIFGTREDFLIPSACLNS
                     TVSGLVSRTVLNLQFMDKDDFHGAKYYKELEDMDVSNLYINRIVACFKQVRNEITSQL
                     QDEATSLITWAGMKSVQNIQLDFDMENINLIKPGVGETTRVLLRRIPWKILINPQYKD
                     ELEHILLLAHEKNVVLEEYSHMSYACCGLIKEL"
     misc_feature    346346..347404
                     /locus_tag="Bsph_0327"
                     /note="Protein of unknown function (DUF2983); Region:
                     DUF2983; pfam11202"
                     /db_xref="CDD:221025"
     gene            347476..348237
                     /locus_tag="Bsph_0328"
                     /db_xref="GeneID:6022529"
     CDS             347476..348237
                     /locus_tag="Bsph_0328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696087.1"
                     /db_xref="GI:169825929"
                     /db_xref="GeneID:6022529"
                     /translation="MMEMFPPISDKVVVEHKANEKMSMMTKETAILLQQVHQQTLFVP
                     VTTRALHQYKRIHFINDLNPSFAITSNGGTILEKGQPCDKWTKTLGRRIEDSSIPRED
                     MLQIFHTIKSDTWLQRSFYIDDLFYVHHVNLDVLQQDDLRAMTQEFDTHGWYVFLQGK
                     KLYFMPKVLTKEAAIQYMMEFCTYDVHIAAGDSMMDYGMLKMADVAFTPNHGDLKDKQ
                     PETLLNTTYSPYEGEAFTKHLLQAVLQHTTQQTVV"
     misc_feature    347641..348096
                     /locus_tag="Bsph_0328"
                     /note="Predicted hydrolases of the HAD superfamily
                     [General function prediction only]; Region: Cof; COG0561"
                     /db_xref="CDD:223635"
     gene            348597..350228
                     /locus_tag="Bsph_0329"
                     /db_xref="GeneID:6022530"
     CDS             348597..350228
                     /locus_tag="Bsph_0329"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696088.1"
                     /db_xref="GI:169825930"
                     /db_xref="GeneID:6022530"
                     /translation="MQTITIKTIVERNQDDWLQAFQDSPKNRAFYEETPQQICFSRMA
                     LRVLGVPIEEDEYFNSLYTLSQNQNIHILSEELNKHIEQKDFQAIQNILSQHQQTPKG
                     LTINRLVAMMYGYQLIPKHDDSIMNRHLQLTTIKVIELFQHQQSLGLLSNEFRRFLID
                     LVKWLKNHWIQWAKALKPTDDFPKVVWYGEATVSQRYFLLLLMELGCDVLIFHPAKVD
                     EFAEVDPNDDFSISYSYTSQTSLQPFPDKLRDRQATVGYRSSQHFEQLMHDQQSGVYR
                     PWQFKDFMPRSLTLRMTYDDIFIYAKEKALVRPQFDVNGNEVVIPVIFAKISGVSSQR
                     EEYWHFMHQLLINPQTIFVQEFPFTKTSKANFHFHYKHCLVNGELSAERIIQSDWWQY
                     GELSLELQQAIAYTIKTSCEQPMLKQQPNETLYDLQLFVFKQLTMIPQEILRLLQSFD
                     YSQEIPKIIMYQAPQQPALSREDIALLAFLNRFGMDIIFYNPTGQLDLEKHLLEDTYD
                     VHRLEHMLFDLPYEEPSQQKAAPDKIIKKLFNRFF"
     misc_feature    348699..350213
                     /locus_tag="Bsph_0329"
                     /note="Domain of unknown function (DUF4356); Region:
                     DUF4356; pfam14266"
                     /db_xref="CDD:222637"
     gene            350266..351285
                     /locus_tag="Bsph_0330"
                     /db_xref="GeneID:6020828"
     CDS             350266..351285
                     /locus_tag="Bsph_0330"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="YP_001696089.1"
                     /db_xref="GI:169825931"
                     /db_xref="GeneID:6020828"
                     /translation="MTLEQLTLETADAVKQQLREHEEVQQIAHQIDIKNQLELIELGK
                     EPATKLSKFADQVLAIVTQSATFESNELFKQLESLMLTFDKKDFAEQKGFFKKLFTRK
                     SKNEEDVYAKYNVLGRDIEKIHYQFVLMEEELAKDNRLLARLYKEDLMFYLDIEKYIV
                     ATDMKLHEVQTTLIPLYEEQGEAGNQVAKMELNRLQTIAEMLQQKIDELEKSRMVAIL
                     TAPQIEMLRHGNNELIEQIHGAFVKTIPVFKMGLMNAVNERRQQLQNQSASAFENRVK
                     QFGEASNEAVHLSTALAQQTDKTQTLEEMWDTIVTGIANYQHLRSEQTSKRKLAEQQL
                     LALRP"
     misc_feature    350332..351279
                     /locus_tag="Bsph_0330"
                     /note="Toxic anion resistance protein (TelA); Region:
                     TelA; pfam05816"
                     /db_xref="CDD:218762"
     gene            complement(351377..352465)
                     /locus_tag="Bsph_0331"
                     /db_xref="GeneID:6020829"
     CDS             complement(351377..352465)
                     /locus_tag="Bsph_0331"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696090.1"
                     /db_xref="GI:169825932"
                     /db_xref="GeneID:6020829"
                     /translation="MKLGARVFKTGVAIVFALFIAELLKLPSPVFAGIAAIFAIQPSI
                     YRSYQTIVEQVQANIIGATIAVFFGLLFGHHVVAIGIAVIIAIGLMLKFKLEKSLSLA
                     LVSVVAIMEFQGEDFLTFGLIRFVTILVGVLAAFVVNLVFLPPKYEIKLFRKIYILQD
                     DIIRWTRLAVRQASEHTSTKGALSKFKSRMLRVDTLYDLYKEERNYFKNKKYVKARKL
                     VVYRQMILTSKKSLELLQRLHNHENELAKLPTQFHLMIQERLDSLLTYHEQLLLKYTG
                     KLKPEHSEWSKSIDYVQRNELMEIFIKQVNFAREEGDTEFSSYHLLYILSRILDYEEN
                     LEHLDTLIVSYQSYHGHEINVEFEEEFI"
     misc_feature    complement(351623..352465)
                     /locus_tag="Bsph_0331"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4129"
                     /db_xref="CDD:226614"
     misc_feature    complement(352082..352465)
                     /locus_tag="Bsph_0331"
                     /note="Bacterial protein of unknown function (DUF939);
                     Region: DUF939; pfam06081"
                     /db_xref="CDD:147958"
     gene            complement(352598..353887)
                     /locus_tag="Bsph_0332"
                     /db_xref="GeneID:6020830"
     CDS             complement(352598..353887)
                     /locus_tag="Bsph_0332"
                     /EC_number="5.4.3.8"
                     /note="converts (S)-4-amino-5-oxopentanoate to
                     5-aminolevulinate"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde aminotransferase"
                     /protein_id="YP_001696091.1"
                     /db_xref="GI:169825933"
                     /db_xref="GeneID:6020830"
                     /translation="MNHAKSEAVHAEALQHIVGGVNSPSRSYKAVGGGSPVAMVRGKG
                     AYFWDVDGNRYIDYLAAYGPIVTGHGHPHIAKAITHAAENGTLFGTPTEYEVTFANML
                     KEAIPSMDKVRFNNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHFDLVLVAAGSGP
                     ATLGTPDSAGVTTSTAEEVITVPFNNPEAFTEAMNTWGDEIAAILIEPIVGNFGIVEP
                     NPGFLELVHATAKEKGALTIYDEVITAFRFHYGGAQNLLGLTPDLTALGKVIGGGLPI
                     GAYGGRKEIMDTVAPLGPAYQAGTMAGNPASMQAGIACLEVLQTPGIYDEMDRLGGIL
                     EEGILAAAKEHGVTITLNRLKGALTIYFTDVKVENYEQAENSNGEIFGRFFKLMLEQG
                     VNLAPSKYEAWFLTTEHTEADILETIKAVNYAFSQLS"
     misc_feature    complement(352604..353887)
                     /locus_tag="Bsph_0332"
                     /note="glutamate-1-semialdehyde aminotransferase;
                     Provisional; Region: PRK12389"
                     /db_xref="CDD:183493"
     misc_feature    complement(352625..353857)
                     /locus_tag="Bsph_0332"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(353084..353086,353159..353164,
                     353168..353170,353267..353269,353444..353446,
                     353450..353455,353531..353539))
                     /locus_tag="Bsph_0332"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(353084..353086,353159..353161,
                     353168..353170,353267..353269,353450..353455,
                     353531..353536))
                     /locus_tag="Bsph_0332"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(353084..353086)
                     /locus_tag="Bsph_0332"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            354017..354493
                     /locus_tag="Bsph_0333"
                     /db_xref="GeneID:6020831"
     CDS             354017..354493
                     /locus_tag="Bsph_0333"
                     /EC_number="1.11.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin bcp"
                     /protein_id="YP_001696092.1"
                     /db_xref="GI:169825934"
                     /db_xref="GeneID:6020831"
                     /translation="MTLQEGQKVPDFSLMNEKGETVQLTDFKGQNVILYFYPKDMTPG
                     CTTEACDFRDRFEDFSHLNAVVLGVSPDDANKHTKFIDKHGLPFSLLVDEDHAVAEAY
                     GVWVLKKMYGREFMGIERSTFLIDSEGKLMKAWRKVRVKNHIEEVYAYLAEQEATT"
     misc_feature    354017..>354409
                     /locus_tag="Bsph_0333"
                     /note="Peroxiredoxin [Posttranslational modification,
                     protein turnover, chaperones]; Region: AhpC; COG0450"
                     /db_xref="CDD:223527"
     misc_feature    354035..354457
                     /locus_tag="Bsph_0333"
                     /note="Peroxiredoxin (PRX) family, Bacterioferritin
                     comigratory protein (BCP) subfamily; composed of
                     thioredoxin-dependent thiol peroxidases, widely expressed
                     in pathogenic bacteria, that protect cells against
                     toxicity from reactive oxygen species by reducing...;
                     Region: PRX_BCP; cd03017"
                     /db_xref="CDD:239315"
     misc_feature    order(354140..354142,354149..354151,354374..354376)
                     /locus_tag="Bsph_0333"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239315"
     gene            354490..355434
                     /locus_tag="Bsph_0334"
                     /db_xref="GeneID:6020832"
     CDS             354490..355434
                     /locus_tag="Bsph_0334"
                     /EC_number="1.1.1.95"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="YP_001696093.1"
                     /db_xref="GI:169825935"
                     /db_xref="GeneID:6020832"
                     /translation="MRIYFTFEPRPDLREPLLAEFPQVDFIFESGITNEELQKADVLV
                     TYGENLTTESIQQATKLKWIFVASAGIEKMPAQAIMERGILVSNVRGIHKTPMAESML
                     AHILAIKRALPWMYEQQKKGEWSKKAKQTELRDSTALILGPGAIGSEVGRLLQAFGVT
                     TIGCNRSGNEASNMDKMISFEQLIEVLPSADIVISVLPKTQETTHLLNEEHFIAMKSS
                     AIFMNFGRGNLVDEKVLIQALEDGEIGYAVLDVFEEEPLSSDNPLWALPNVIVSPHVS
                     SHSSRYVERSLEIFKTSLTKWLRGDRDLENVMELSRGY"
     misc_feature    354490..355431
                     /locus_tag="Bsph_0334"
                     /note="Putative D-isomer specific 2-hydroxyacid
                     dehydrogenase; Region: 2-Hacid_dh_1; cd05300"
                     /db_xref="CDD:240625"
     misc_feature    354490..355431
                     /locus_tag="Bsph_0334"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    order(354694..354696,354766..354768,354778..354780,
                     354913..354927,354979..354987,355075..355083,
                     355096..355098,355159..355167,355237..355242,
                     355309..355311,355315..355320)
                     /locus_tag="Bsph_0334"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240625"
     misc_feature    order(354694..354696,354766..354768,354925..354927,
                     355159..355164,355309..355311,355318..355320)
                     /locus_tag="Bsph_0334"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240625"
     misc_feature    order(355165..355167,355252..355254,355309..355311)
                     /locus_tag="Bsph_0334"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240625"
     gene            355547..355996
                     /locus_tag="Bsph_0335"
                     /db_xref="GeneID:6020833"
     CDS             355547..355996
                     /locus_tag="Bsph_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="peroxide operon regulator"
                     /protein_id="YP_001696094.1"
                     /db_xref="GI:169825936"
                     /db_xref="GeneID:6020833"
                     /translation="MTMSTTHLQDALDTLKTTGVRITPQRHAILEYLIQSMAHPTADE
                     IYKALEGKFPNMSVATVYNNLRVFREVGLVKELTYGDASSRFDFVTNDHYHMICECCG
                     KIVDFHYPGLDEIEHFASQVTDFDVHSHRLEIYGTCPSCKGVTAKVQ"
     misc_feature    355616..355960
                     /locus_tag="Bsph_0335"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(355661..355663,355805..355807,355823..355825,
                     355829..355831,355862..355864)
                     /locus_tag="Bsph_0335"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    355715..355759
                     /locus_tag="Bsph_0335"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(355826..355828,355883..355885,355934..355936)
                     /locus_tag="Bsph_0335"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(355835..355843,355889..355894,355919..355927,
                     355931..355957)
                     /locus_tag="Bsph_0335"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(355838..355840,355847..355849,355958..355960)
                     /locus_tag="Bsph_0335"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            complement(356018..356371)
                     /locus_tag="Bsph_0336"
                     /db_xref="GeneID:6020834"
     CDS             complement(356018..356371)
                     /locus_tag="Bsph_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696095.1"
                     /db_xref="GI:169825937"
                     /db_xref="GeneID:6020834"
                     /translation="MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMT
                     LGVLCIIGSTVVYAWIGLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLE
                     GKEFDQSYNHKTKKS"
     misc_feature    complement(356033..356368)
                     /locus_tag="Bsph_0336"
                     /note="Protein of unknown function (DUF2614); Region:
                     DUF2614; pfam11023"
                     /db_xref="CDD:220946"
     gene            356497..357405
                     /locus_tag="Bsph_0337"
                     /db_xref="GeneID:6020835"
     CDS             356497..357405
                     /locus_tag="Bsph_0337"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696096.1"
                     /db_xref="GI:169825938"
                     /db_xref="GeneID:6020835"
                     /translation="MNKGGLNMEQVLRPIYQERASQSNTLGVILVEKREEQSNVTDTF
                     DTVLLIIVKEAEQPVFSKHYLYEGNKVALHTVTEKLIRKWLLIGSNKKVVDWIFFGRV
                     LFDRNEFLHKLKIELQEFPYSGRKIKTGIQFSKLIRRYLEGKEYFDKGSYLDAYNHVV
                     DSLHHLGRLSIIDSGLYPEVTVWGQVKKIEPAIYKLYEELVTSNEPIEKRLELLFLAS
                     EFLIHSRTRDGAQHILEVMQTKETWSIQELHDHHELMNYSVDLEVFVEYLVDKGYIHI
                     EPVTAKNEMIFHRHYKVDKEALEIGQ"
     gene            357759..359302
                     /locus_tag="Bsph_rRNA0616S"
                     /db_xref="GeneID:6020836"
     rRNA            357759..359302
                     /locus_tag="Bsph_rRNA0616S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6020836"
     gene            359626..362542
                     /locus_tag="Bsph_rRNA0623S"
                     /db_xref="GeneID:6020837"
     rRNA            359626..362542
                     /locus_tag="Bsph_rRNA0623S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6020837"
     gene            362660..362766
                     /locus_tag="Bsph_rRNA065S"
                     /db_xref="GeneID:6020762"
     rRNA            362660..362766
                     /locus_tag="Bsph_rRNA065S"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:6020762"
     gene            362788..362864
                     /locus_tag="Bsph_tRNA10"
                     /db_xref="GeneID:6020763"
     tRNA            362788..362864
                     /locus_tag="Bsph_tRNA10"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:6020763"
     gene            362870..362961
                     /locus_tag="Bsph_tRNA11"
                     /db_xref="GeneID:6020764"
     tRNA            362870..362961
                     /locus_tag="Bsph_tRNA11"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:6020764"
     gene            362986..363060
                     /locus_tag="Bsph_tRNA12"
                     /db_xref="GeneID:6020765"
     tRNA            362986..363060
                     /locus_tag="Bsph_tRNA12"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:6020765"
     gene            363080..363155
                     /locus_tag="Bsph_tRNA13"
                     /db_xref="GeneID:6020766"
     tRNA            363080..363155
                     /locus_tag="Bsph_tRNA13"
                     /product="tRNA-Val"
                     /db_xref="GeneID:6020766"
     gene            363181..363255
                     /locus_tag="Bsph_tRNA14"
                     /db_xref="GeneID:6021059"
     tRNA            363181..363255
                     /locus_tag="Bsph_tRNA14"
                     /product="tRNA-Met"
                     /db_xref="GeneID:6021059"
     gene            363259..363334
                     /locus_tag="Bsph_tRNA15"
                     /db_xref="GeneID:6021060"
     tRNA            363259..363334
                     /locus_tag="Bsph_tRNA15"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:6021060"
     gene            363351..363426
                     /locus_tag="Bsph_tRNA16"
                     /db_xref="GeneID:6021061"
     tRNA            363351..363426
                     /locus_tag="Bsph_tRNA16"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:6021061"
     gene            363434..363509
                     /locus_tag="Bsph_tRNA17"
                     /db_xref="GeneID:6024151"
     tRNA            363434..363509
                     /locus_tag="Bsph_tRNA17"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:6024151"
     gene            363519..363602
                     /locus_tag="Bsph_tRNA18"
                     /db_xref="GeneID:6024152"
     tRNA            363519..363602
                     /locus_tag="Bsph_tRNA18"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:6024152"
     gene            363626..363699
                     /locus_tag="Bsph_tRNA19"
                     /db_xref="GeneID:6024029"
     tRNA            363626..363699
                     /locus_tag="Bsph_tRNA19"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:6024029"
     gene            363712..363787
                     /locus_tag="Bsph_tRNA20"
                     /db_xref="GeneID:6024030"
     tRNA            363712..363787
                     /locus_tag="Bsph_tRNA20"
                     /product="tRNA-His"
                     /db_xref="GeneID:6024030"
     gene            363832..363907
                     /locus_tag="Bsph_tRNA21"
                     /db_xref="GeneID:6024031"
     tRNA            363832..363907
                     /locus_tag="Bsph_tRNA21"
                     /product="tRNA-His"
                     /db_xref="GeneID:6024031"
     gene            363912..363986
                     /locus_tag="Bsph_tRNA22"
                     /db_xref="GeneID:6024442"
     tRNA            363912..363986
                     /locus_tag="Bsph_tRNA22"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:6024442"
     gene            363993..364067
                     /locus_tag="Bsph_tRNA23"
                     /db_xref="GeneID:6024443"
     tRNA            363993..364067
                     /locus_tag="Bsph_tRNA23"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:6024443"
     gene            364076..364149
                     /locus_tag="Bsph_tRNA24"
                     /db_xref="GeneID:6023236"
     tRNA            364076..364149
                     /locus_tag="Bsph_tRNA24"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:6023236"
     gene            364197..364280
                     /locus_tag="Bsph_tRNA25"
                     /db_xref="GeneID:6023237"
     tRNA            364197..364280
                     /locus_tag="Bsph_tRNA25"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:6023237"
     gene            364580..364735
                     /locus_tag="Bsph_0340"
                     /db_xref="GeneID:6023238"
     CDS             364580..364735
                     /locus_tag="Bsph_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696097.1"
                     /db_xref="GI:169825939"
                     /db_xref="GeneID:6023238"
                     /translation="MERLEVIFMKKVISGQQDEFKGNDTANGIDKMFSGQPVHPTCRN
                     MFEADIV"
     gene            complement(364865..366160)
                     /locus_tag="Bsph_0341"
                     /db_xref="GeneID:6024804"
     CDS             complement(364865..366160)
                     /locus_tag="Bsph_0341"
                     /codon_start=1
                     /transl_table=11
                     /product="sphaericase (sfericase)"
                     /protein_id="YP_001696098.1"
                     /db_xref="GI:169825940"
                     /db_xref="GeneID:6024804"
                     /translation="MKKMKSTLLSLLIAGSVINPVYATAMDSEDSLGNDGGQEKFRVY
                     VEANKKTEKSTLKTQYSARWELTENGFSTDMNEKQFEALQKNKNFTVTKVPIVTLDTI
                     GLEDDSMVENETLDLVTSLRASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNI
                     SHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDA
                     DLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNY
                     AYSKGVLIVAAAGNSGYAQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYIS
                     TAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLS
                     NTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARVQ"
     misc_feature    complement(364955..365719)
                     /locus_tag="Bsph_0341"
                     /note="Peptidase S8 family domain in Subtilisin proteins;
                     Region: Peptidases_S8_Subtilisin_subset; cd07477"
                     /db_xref="CDD:173803"
     misc_feature    complement(order(365048..365050,365291..365293,
                     365378..365380,365450..365452,365585..365587,
                     365696..365698))
                     /locus_tag="Bsph_0341"
                     /note="active site"
                     /db_xref="CDD:173803"
     misc_feature    complement(order(365048..365050,365585..365587,
                     365696..365698))
                     /locus_tag="Bsph_0341"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173803"
     gene            366290..367516
                     /locus_tag="Bsph_0342"
                     /db_xref="GeneID:6024805"
     CDS             366290..367516
                     /locus_tag="Bsph_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator nprA"
                     /protein_id="YP_001696099.1"
                     /db_xref="GI:169825941"
                     /db_xref="GeneID:6024805"
                     /translation="MKMKIGSLIKYYRTKLGMTQNSVAMGICSIPHLSKIENNNKEAN
                     SETIRLLLERLNISIHDVENNEQNIICLLNDLQKHINYLEIDKVKETMSRLKEYEEII
                     GFTESIYLYELYKLRYYVFVKEHKLADNQLKWLNAHRPNFSQHERYLHSYYYALVLIT
                     KGKYEEAAKELTQILQIHPELGSLEGEFYYHFALIKGRLEEPSQAIIYGKKALQFYKD
                     QFNFKRIVYTLMSLALNYSRGKVFHEAIEIYEHLVRNVELLQQQQLLPAIYHNLGDLY
                     QMRWEYENALIYFEKSASLMSKNCDHYLLCLYNLGVTQFRLEQTEKSIKTFTILKEEA
                     KNKKKLSFNLFATFYLYLLGEEKKKAMDFLEGRLIPFIADNEELKEMHQQFSNLLGEY
                     YRQEKQFEKAMQFIEI"
     misc_feature    366305..366475
                     /locus_tag="Bsph_0342"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(366317..366319,366329..366331,366401..366403)
                     /locus_tag="Bsph_0342"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(366326..366328,366398..366400)
                     /locus_tag="Bsph_0342"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(366347..366352,366380..366382,366389..366391,
                     366401..366406)
                     /locus_tag="Bsph_0342"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    366722..366943
                     /locus_tag="Bsph_0342"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:205602"
     misc_feature    367076..367270
                     /locus_tag="Bsph_0342"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:205602"
     gene            367951..368982
                     /locus_tag="Bsph_0343"
                     /db_xref="GeneID:6024806"
     CDS             367951..368982
                     /locus_tag="Bsph_0343"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-transporter transmembrane subunit"
                     /protein_id="YP_001696100.1"
                     /db_xref="GI:169825942"
                     /db_xref="GeneID:6024806"
                     /translation="MNLAWKEMKKNKVRFLILGSIIFLVSFLTFIISGLANGLSQDNA
                     ALIKDLPQGQFYMTEDADGTFNLSRISNNLQQEVMSEEKEAVAFSIQMGFLSDEDDKQ
                     QSVAFVTSTESSLFRNVRQGEVLLDSSLQEKGIKVGDILANNQYSGEFKVKGFVEQKK
                     YSHAPVAYISKEAYQEMYRIQDMQLIFVPHNAAKDFEGLQSYSNKEFLNAIPSYSAEQ
                     MSLNMIIWFLVVISGMLFAIFFYMMNVQKIGLYGILKAIGLKTGRLFNMIWTQMVIIT
                     AISLVLSVSLSQLFNIVAPKGMPFTLNFGTTMQLSLVFLVIGFVGATLSGLQIKKIQP
                     LQAIHQGEA"
     misc_feature    367960..368496
                     /locus_tag="Bsph_0343"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:221725"
     misc_feature    <368518..368967
                     /locus_tag="Bsph_0343"
                     /note="ABC-type antimicrobial peptide transport system,
                     permease component [Defense mechanisms]; Region: SalY;
                     COG0577"
                     /db_xref="CDD:223650"
     misc_feature    368614..368952
                     /locus_tag="Bsph_0343"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:217187"
     gene            368985..369680
                     /locus_tag="Bsph_0344"
                     /db_xref="GeneID:6024807"
     CDS             368985..369680
                     /locus_tag="Bsph_0344"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696101.1"
                     /db_xref="GI:169825943"
                     /db_xref="GeneID:6024807"
                     /translation="MTLFTIDEVRKTFKNGDVEEEILKGINLSLKEGEITALVGASGS
                     GKSTLLTIAAGLQPATDGQILFEGQNLTTMNEEQVRKLRASKFGFVFQFAHLVPFLTV
                     EEQLLLMLDVAGSPLKKHEQKHEVNRLLQLVGLAHRQDAYPSSLSGGEKQRVAIARAI
                     IHQPKVLFADEPTASLDSQRSKEIMMLLRTLTKTLSITTLLVTHDEEMLAYTDRIIKM
                     SDGVVLQNKQGSH"
     misc_feature    369000..369665
                     /locus_tag="Bsph_0344"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    369009..369653
                     /locus_tag="Bsph_0344"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    369102..369125
                     /locus_tag="Bsph_0344"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(369111..369116,369120..369128,369258..369260,
                     369492..369497,369594..369596)
                     /locus_tag="Bsph_0344"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    369249..369260
                     /locus_tag="Bsph_0344"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    369420..369449
                     /locus_tag="Bsph_0344"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    369480..369497
                     /locus_tag="Bsph_0344"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    369504..369515
                     /locus_tag="Bsph_0344"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    369582..369602
                     /locus_tag="Bsph_0344"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            complement(369700..370509)
                     /locus_tag="Bsph_0345"
                     /db_xref="GeneID:6025017"
     CDS             complement(369700..370509)
                     /locus_tag="Bsph_0345"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_001696102.1"
                     /db_xref="GI:169825944"
                     /db_xref="GeneID:6025017"
                     /translation="MKKIAVVTGGVSGIGKAICQELITRHIFVIIADIQEQEGRMLEA
                     QLNKDAVHAKFVPLNVTDYNSVASVIHGVIEEYHRIDYLFNNAGIAMYGELGETTIED
                     WKEIMAINLWGVIYGTQLGYSLMKKQGFGHIINTSSAAGLGPSPFSSAYATTKHAVIG
                     LTTSLHYEAEEFGIKVSALCPTFVDTPIFDNAKAIHMDKSIITKQLQQQKMISPQRIA
                     KIAIEGVHQNKPIICPMPMRKTMDVIFTIFPFLHKALMRMVCKVSRNARLT"
     misc_feature    complement(369739..370509)
                     /locus_tag="Bsph_0345"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     misc_feature    complement(369856..370497)
                     /locus_tag="Bsph_0345"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(369949..369954,369958..369969,
                     370045..370047,370057..370059,370096..370104,
                     370183..370185,370246..370254,370330..370338,
                     370405..370413,370468..370479,370483..370485))
                     /locus_tag="Bsph_0345"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(370045..370047,370057..370059,
                     370096..370098,370180..370182))
                     /locus_tag="Bsph_0345"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(370513..371214)
                     /locus_tag="Bsph_0346"
                     /db_xref="GeneID:6025018"
     CDS             complement(370513..371214)
                     /locus_tag="Bsph_0346"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696103.1"
                     /db_xref="GI:169825945"
                     /db_xref="GeneID:6025018"
                     /translation="MKVGLIGDSLTEGRPGVSFYNLLKLQYPHISFDNLGNPGETIKS
                     LFTRLEKTPLQSSYDLLFLWVGVNDVYSKLLKVQAQPVTKDHIEFEEYCLKVLEKAHT
                     ASKNVVLVSPALVGEDLQNHSNNEVKELTSVMESIALKSGNVYFVNMQNLFKEHLEHL
                     DCSSFINTSVMRVLLDVLFYKNPLRIDKLSQKRGLHVTMDGVHLNSKGADIVAQQYSS
                     IIEHYANEGDKIGRS"
     misc_feature    complement(370747..371199)
                     /locus_tag="Bsph_0346"
                     /note="GDSL-like Lipase/Acylhydrolase family; Region:
                     Lipase_GDSL_2; pfam13472"
                     /db_xref="CDD:222156"
     misc_feature    complement(order(370606..370608,370615..370617,
                     371011..371013,371098..371100,371188..371190))
                     /locus_tag="Bsph_0346"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    complement(order(370606..370608,370615..370617,
                     371188..371190))
                     /locus_tag="Bsph_0346"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    complement(order(371011..371013,371098..371100,
                     371188..371190))
                     /locus_tag="Bsph_0346"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     gene            complement(371215..371811)
                     /gene="qacR"
                     /locus_tag="Bsph_0347"
                     /db_xref="GeneID:6025019"
     CDS             complement(371215..371811)
                     /gene="qacR"
                     /locus_tag="Bsph_0347"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator"
                     /protein_id="YP_001696104.1"
                     /db_xref="GI:169825946"
                     /db_xref="GeneID:6025019"
                     /translation="MNKRRYDSDKAKLEIIKHATQLFSQHGYNQTSVGDISKVSGYSK
                     GHIYYHFENKEKLFVLLAQQSMKNWHDKWLQKESSYTTSTEKLYGMALHVLYEYQTPL
                     LKSGQELASNPKSTPESIQQLFNLAITPMNAYRVILQEGIDQNEFVHGDVDTWTVLLG
                     TWLGGLCQLTNTQHLKSLEPLFQQAITIFLKEIKKGGI"
     misc_feature    complement(<371587..371811)
                     /gene="qacR"
                     /locus_tag="Bsph_0347"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(371638..371769)
                     /gene="qacR"
                     /locus_tag="Bsph_0347"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:201228"
     misc_feature    complement(371227..371619)
                     /gene="qacR"
                     /locus_tag="Bsph_0347"
                     /note="QacR-like protein, C-terminal region; Region:
                     TetR_C_5; pfam08360"
                     /db_xref="CDD:203917"
     gene            372043..372333
                     /locus_tag="Bsph_0348"
                     /db_xref="GeneID:6025020"
     CDS             372043..372333
                     /locus_tag="Bsph_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696105.1"
                     /db_xref="GI:169825947"
                     /db_xref="GeneID:6025020"
                     /translation="MFGWRIAAPNWDYWPVTTGHESKIGINGGISKGPSDYPHGTRIQ
                     IEVDAMDEVIEQATSNGATILRGKMEFEDFYLAYLMDPTGIEIGLIQHKNNE"
     misc_feature    372046..372315
                     /locus_tag="Bsph_0348"
                     /note="N-terminal domain of Streptomyces griseus SgaA
                     (suppression of growth disturbance caused by A-factor at a
                     high concentration under high osmolality during early
                     growth phase), and similar domains; Region: SgaA_N_like;
                     cd07247"
                     /db_xref="CDD:176671"
     gene            372479..373501
                     /locus_tag="Bsph_0349"
                     /db_xref="GeneID:6025021"
     CDS             372479..373501
                     /locus_tag="Bsph_0349"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696106.1"
                     /db_xref="GI:169825948"
                     /db_xref="GeneID:6025021"
                     /translation="MQAASFKDLTDDTLMTEIHYLVEQDIVKGYSNQLFKPNDYVTKA
                     QVAVMLTRALGLNTINIQNPNYQDVTPANKYYKEIAAVQKKGIFDAAHKFNPDAPLTR
                     AEMAIVLNRAFKLKGSDPYYFTDVTEQTYGYKEILTLAHNHLVRGYENGEFKPNAPVT
                     RAHFSAFLARALTLSKPSLLKDPAFVYTYGYYSLSDHKRYTLSYQYKQHDGKNDVWTV
                     KNISTGQTLSDELLYGHDRVYGQAIASDANTHYDLYMELPLRIGVILHEDDPGVTAGE
                     RVTVKSTNGTVQAGEVQYTGVIIVEKRSVYSDVVKTYYFVDDIGLVKELHNDKVVFEL
                     FNRTMK"
     misc_feature    372491..372619
                     /locus_tag="Bsph_0349"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    372671..372796
                     /locus_tag="Bsph_0349"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     misc_feature    372845..372970
                     /locus_tag="Bsph_0349"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:215897"
     gene            complement(373542..374288)
                     /locus_tag="Bsph_0350"
                     /db_xref="GeneID:6021648"
     CDS             complement(373542..374288)
                     /locus_tag="Bsph_0350"
                     /EC_number="2.3.1.118"
                     /codon_start=1
                     /transl_table=11
                     /product="N-hydroxyarylamine O-acetyltransferase"
                     /protein_id="YP_001696107.1"
                     /db_xref="GI:169825949"
                     /db_xref="GeneID:6021648"
                     /translation="MNAQIQQYLQHIQFQGTLEPTVQLLGQLQTKHLLTIPYENLDVA
                     LNLGISFSIPDLFQKIIIERRGGNCFELNILFSWLLRELGFSVTNRYAQFWRNVEEHS
                     PPEDIPMHQLLLVKDAKQSYISDVGVGALAPCKPVPLIAGYQHREGRELYKVEYDEEN
                     GWMLFELTKQQWRLLYCFHDDANDAKFAPRLSKQKNKIAMIRTTRGRHTMMNNEFRIY
                     EGQSLTTYTTNTEKEWLQALQRFFHISLQQ"
     misc_feature    complement(373548..374228)
                     /locus_tag="Bsph_0350"
                     /note="N-acetyltransferase; Region: Acetyltransf_2;
                     cl00949"
                     /db_xref="CDD:242215"
     gene            374475..375188
                     /locus_tag="Bsph_0351"
                     /db_xref="GeneID:6021649"
     CDS             374475..375188
                     /locus_tag="Bsph_0351"
                     /EC_number="3.5.99.6"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="YP_001696108.1"
                     /db_xref="GI:169825950"
                     /db_xref="GeneID:6021649"
                     /translation="MKWIEVNTYDEMSEVAANIFLKQIQKKPNSVLGLATGGSPVGMY
                     KELVARYQAGQLTFKDVQTFNLDEYVGLKRSSPASYWTFMHNNLFNGVNIKQENIHLP
                     NGEAEDLAAECKAYDARIDAAGGIDLQLLGIGVNGHIGFNEPGTPFDSMTNIVELTES
                     TRTENAIYFDDAADVPIHAITMGIQSIMKAKEIVLIAFGEKKMEAIQKLKSGHITEDF
                     PASQLLKHPNVTIIYGGTN"
     misc_feature    374475..375173
                     /locus_tag="Bsph_0351"
                     /note="6-phosphogluconolactonase/Glucosamine-6-phosphate
                     isomerase/deaminase [Carbohydrate transport and
                     metabolism]; Region: NagB; COG0363"
                     /db_xref="CDD:223440"
     misc_feature    374502..375170
                     /locus_tag="Bsph_0351"
                     /note="GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P)
                     deaminase subfamily; GlcN6P deaminase catalyzes the
                     reversible conversion of GlcN6P to D-fructose-6-phosphate
                     (Fru6P) and ammonium. The reaction is an aldo-keto
                     isomerization coupled with an amination or...; Region:
                     GlcN6P_deaminase; cd01399"
                     /db_xref="CDD:238693"
     misc_feature    order(374580..374591,374670..374675,374868..374873,
                     374886..374888,374892..374894,374973..374975,
                     375078..375080)
                     /locus_tag="Bsph_0351"
                     /note="active site"
                     /db_xref="CDD:238693"
     misc_feature    order(374907..374909,374913..374918,374940..374942,
                     375102..375122,375144..375152)
                     /locus_tag="Bsph_0351"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238693"
     misc_feature    order(374910..374915,374931..374942)
                     /locus_tag="Bsph_0351"
                     /note="allosteric site; other site"
                     /db_xref="CDD:238693"
     misc_feature    order(374946..374948,374955..374987,374994..375002)
                     /locus_tag="Bsph_0351"
                     /note="active site lid [active]"
                     /db_xref="CDD:238693"
     gene            375479..376387
                     /gene="ykfA"
                     /locus_tag="Bsph_0352"
                     /db_xref="GeneID:6021650"
     CDS             375479..376387
                     /gene="ykfA"
                     /locus_tag="Bsph_0352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696109.1"
                     /db_xref="GI:169825951"
                     /db_xref="GeneID:6021650"
                     /translation="MNVKNTVPRLQKGDLVGVVALSSVVNHEKLGDALSFLDELGLHY
                     IVGDTIHATHDYLAGSDEVRLADFHEMVKNPEVKAIFCVKGGYGSARIAEKIDYTLLE
                     ENPKIFWGFSDITYLHCAINEYANLVTFHGPMLMAANKMDELSKKMFVQLFSPIEIQY
                     TESISPLTTIAGGVARGELIGGNLYRLVSTLGTKFEIQTEGKILLIEELAESIPNIDS
                     MLQQLKQARKIEQLAGVVIGSFTQTEANETALHNLMKEYFGDLGIPVVAGFKIGHEST
                     NVGIPLGVDAYLDAEEKVLKILPGVY"
     misc_feature    375524..376336
                     /gene="ykfA"
                     /locus_tag="Bsph_0352"
                     /note="LD-Carboxypeptidase, a serine protease, includes
                     microcin C7 self immunity protein; Region: Peptidase_S66;
                     cd07025"
                     /db_xref="CDD:132882"
     misc_feature    order(375746..375751,376040..376045,376049..376054,
                     376118..376123,376127..376132,376139..376144,
                     376244..376249)
                     /gene="ykfA"
                     /locus_tag="Bsph_0352"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132882"
     misc_feature    order(375812..375814,376097..376099,376295..376297)
                     /gene="ykfA"
                     /locus_tag="Bsph_0352"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:132882"
     gene            376398..376811
                     /locus_tag="Bsph_0353"
                     /db_xref="GeneID:6021651"
     CDS             376398..376811
                     /locus_tag="Bsph_0353"
                     /note="Reclaims exogenous and endogenous cytidine and
                     2'-deoxycytidine molecules for UMP synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="YP_001696110.1"
                     /db_xref="GI:169825952"
                     /db_xref="GeneID:6021651"
                     /translation="MLNDMDIEKKLYEAAVQLVEKRYPSGWGGAAALYSEDGHILTSV
                     APEVINAATELCMETGAILEAHKLNTKVTHSICVARENEKSKFVVLTPCGVCQERLFY
                     WGENVKAAVTNTDDTLLFKTLKEIQPYHWYKAYEQ"
     misc_feature    376434..376769
                     /locus_tag="Bsph_0353"
                     /note="Cytidine deaminase zinc-binding domain. These
                     enzymes are Zn dependent. The zinc ion in the active site
                     plays a central role in the proposed catalytic mechanism,
                     activating a water molecule to form a hydroxide ion that
                     performs a nucleophilic attack on...; Region:
                     cytidine_deaminase; cd01283"
                     /db_xref="CDD:238610"
     misc_feature    order(376476..376478,376482..376484,376530..376532,
                     376536..376538,376563..376571,376674..376676,
                     376683..376685)
                     /locus_tag="Bsph_0353"
                     /note="active site"
                     /db_xref="CDD:238610"
     misc_feature    order(376563..376571,376671..376676,376683..376685)
                     /locus_tag="Bsph_0353"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238610"
     misc_feature    order(376563..376565,376569..376571,376674..376676,
                     376683..376685)
                     /locus_tag="Bsph_0353"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238610"
     gene            complement(376859..378445)
                     /locus_tag="Bsph_0354"
                     /db_xref="GeneID:6021652"
     CDS             complement(376859..378445)
                     /locus_tag="Bsph_0354"
                     /EC_number="1.11.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase X"
                     /protein_id="YP_001696111.1"
                     /db_xref="GI:169825953"
                     /db_xref="GeneID:6021652"
                     /translation="MTQKNDSTHDQDTTLTNRQGHPITNNQNLRTVSNRGPATLENYD
                     FLEKISHFDRERVPERVVHARGAGAHGYFETYGVVGNEPISKYTRAKVFQDKGKKTPV
                     FVRFSTVIHGGHSPETLRDPRGFAVKFYTEDGNWDLVGNNLKIFFIRDAMKFPDMIHA
                     FKPDPITNIQNVERFFDFCASSPESFHMVTFVYSPWGIPANYRMMQGSGVNTYKWVNQ
                     EGKGVLVKYHWEPLQGIKNLTQKEAEEIQQKNFNHATQDLYDAIEREEFPEWELHVQI
                     MEDGPHPELDFDPLDDTKLWPNDQFPWYPVGKMVLNKNPEDYFAEVEQATFGTGVLVD
                     GLDFSDDKMLQGRTFSYSDTQRHRVGANYLQLPINAPKKRVATNQSGGQMMYKRDLAP
                     GQNPHINYEPSMLNGLKEATQDGKEYTPYVEGNLVRESIDRQSNTKQAGETYRNFEQW
                     ERDELLANLIRDLSVCHMEIQNAMIALAEEADEEYGRLLKEGLHKARKESSTSKPLGN
                     IDGDQAPQNAIDKGHNAEPY"
     misc_feature    complement(376958..378439)
                     /locus_tag="Bsph_0354"
                     /note="Catalase [Inorganic ion transport and metabolism];
                     Region: KatE; COG0753"
                     /db_xref="CDD:223824"
     misc_feature    complement(376967..378406)
                     /locus_tag="Bsph_0354"
                     /note="Clade 1 of the heme-binding enzyme catalase;
                     Region: catalase_clade_1; cd08154"
                     /db_xref="CDD:163710"
     misc_feature    complement(order(377027..377029,377039..377041,
                     377045..377047,377051..377056,377234..377251,
                     377291..377299,377303..377305,377312..377314,
                     377318..377323,377333..377335,377345..377356,
                     377360..377365,377369..377377,377384..377389,
                     377396..377404,377411..377413,377420..377422,
                     377426..377428,377450..377455,377474..377476,
                     377483..377485,377489..377494,377498..377500,
                     377576..377578,377582..377584,377597..377602,
                     377669..377671,377678..377683,377690..377692,
                     377702..377707,377714..377716,377723..377725,
                     377915..377917,377924..377926,377936..377953,
                     377969..377971,377978..377980,377984..377998,
                     378041..378046,378101..378106,378263..378265,
                     378278..378280))
                     /locus_tag="Bsph_0354"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163710"
     misc_feature    complement(order(377393..377395,377405..377407,
                     377984..377986,378008..378010,378023..378025,
                     378125..378127,378257..378259))
                     /locus_tag="Bsph_0354"
                     /note="heme binding pocket [chemical binding]; other site"
                     /db_xref="CDD:163710"
     gene            complement(378744..379253)
                     /locus_tag="Bsph_0355"
                     /db_xref="GeneID:6021102"
     CDS             complement(378744..379253)
                     /locus_tag="Bsph_0355"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696112.1"
                     /db_xref="GI:169825954"
                     /db_xref="GeneID:6021102"
                     /translation="MINLAEAVKLKSILGKKTQELISELHRSAFVTVEKGQTPKTSNR
                     ALPLIETELAQVRLDTLTLDRLVYEANIQNTVEFKDQKLALVEAIELATQLRAEAELC
                     KEFSMREKESVRFGYGDGAMLYEIALYEPDDYRERAMKLEKEAHKLSNLINSKNYSIQ
                     INFDDSRYF"
     gene            complement(379269..379958)
                     /locus_tag="Bsph_0356"
                     /db_xref="GeneID:6021103"
     CDS             complement(379269..379958)
                     /locus_tag="Bsph_0356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696113.1"
                     /db_xref="GI:169825955"
                     /db_xref="GeneID:6021103"
                     /translation="MEISINESLLTQHPELKIGIIHYTKIVVAESPQMIKGRMQLYQE
                     NLFLDMQDFPVNQREGIAEWRVFWKKLGSDPNRYRHSAESLMRRISKQNYVTPFHSAV
                     DLNNFFSLQYEIPVGLYDIAFMKGYVEIALGHEDIGYEGLNGRFNTFNKILYSRDEKG
                     AFGSPFVDSKRTAVTEDTTEALQIFYLRPSLTHEAANDLLASAGKMFNQIHGGDYQIA
                     LLSNNAPSTSL"
     misc_feature    complement(379299..379919)
                     /locus_tag="Bsph_0356"
                     /note="Solo B3/4 domain (OB-fold DNA/RNA-binding) of
                     Phe-aaRS-beta [General function prediction only]; Region:
                     COG3382"
                     /db_xref="CDD:225917"
     misc_feature    complement(<379413..379727)
                     /locus_tag="Bsph_0356"
                     /note="B3/4 domain; Region: B3_4; pfam03483"
                     /db_xref="CDD:202662"
     gene            380018..381151
                     /locus_tag="Bsph_0357"
                     /db_xref="GeneID:6021104"
     CDS             380018..381151
                     /locus_tag="Bsph_0357"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696114.1"
                     /db_xref="GI:169825956"
                     /db_xref="GeneID:6021104"
                     /translation="MNIHDLQRDFVAYARAIGVDKIGFTTAAPFTELKNRLRRQQELG
                     YQSGFEESDIEKRTEPLQLLNEAESIVSIAVAYPSRMQNAPIGKKGARRGIFCRASWG
                     VDYHTAIRERLKLLSAWLEERVEGVRIESMVDTGALVDRAVAERAGIGWSGKNCSIIT
                     PEFGSYVYLGELITNVPFSPDKPMEDECGECRLCLDVCPTGALIQGGQLDAQRCIAFL
                     TQTKGTLPDEFRNHIGNRLYGCDTCQTVCPKNKGKINWIHDEFIPDPELAKPLLTPLL
                     TISNREFKAKFGHVSGSWRGKKPIQRNAILALAHFKEEAAIPDLINLLKNDDRPVIRG
                     TSAWALGKIGGEQAKSALYDAEANEQDEEVLNEIHKGLQFFHE"
     misc_feature    380048..381046
                     /locus_tag="Bsph_0357"
                     /note="epoxyqueuosine reductase; Region: TIGR00276"
                     /db_xref="CDD:213520"
     misc_feature    380186..380422
                     /locus_tag="Bsph_0357"
                     /note="Domain of unknown function (DUF1730); Region:
                     DUF1730; pfam08331"
                     /db_xref="CDD:149403"
     misc_feature    380384..380575
                     /locus_tag="Bsph_0357"
                     /note="Cellular and retroviral pepsin-like aspartate
                     proteases; Region: pepsin_retropepsin_like; cl11403"
                     /db_xref="CDD:245603"
     gene            381219..381692
                     /locus_tag="Bsph_0358"
                     /db_xref="GeneID:6021105"
     CDS             381219..381692
                     /locus_tag="Bsph_0358"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/rRNA methyltransferase in gldA 3'region"
                     /protein_id="YP_001696115.1"
                     /db_xref="GI:169825957"
                     /db_xref="GeneID:6021105"
                     /translation="MPLHIVLYQPEIPANTGNIARTCAGTNTSLHLIRPLGFSTDDKM
                     LKRAGLDYWHSVNIVYHNSLDDFIEYSRDGDVYLIETYSDEPFTTHDFSNKERDIYFM
                     FGKETTGLPKDFAYERRNMCLRIPQSDHVRSLNLSNTAAIVIYEALRQQGYPGLH"
     misc_feature    381219..381686
                     /locus_tag="Bsph_0358"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            complement(381728..382606)
                     /locus_tag="Bsph_0359"
                     /db_xref="GeneID:6021106"
     CDS             complement(381728..382606)
                     /locus_tag="Bsph_0359"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696116.1"
                     /db_xref="GI:169825958"
                     /db_xref="GeneID:6021106"
                     /translation="MNKNNLTEVFYMHFHEKPNTYVTNVEIKVSDLQRSLTFYQEVIG
                     FNVLHQESHKATLTADGHTALLTIVQPDTVEEKLSMTTGLYHFALLLPTRRDLANIIT
                     HFHEKGVYLGASDHAVSEALYLNDPDHNGIEVYADRPENVWDWHQDQVNMVTEPLNIR
                     SILEEGDGNWDGLPSGTVMGHIHLSVSNLAEAEQFYTKGLGYDIVARYGSQALFISTG
                     RYHHHIGLNTWHSENAPKLGENQVGLKTFSLRLDNEEQASMMKANLRTIGARVIDIDG
                     GFQTEDPAGNVVLLKF"
     misc_feature    complement(381779..382573)
                     /locus_tag="Bsph_0359"
                     /note="Predicted ring-cleavage extradiol dioxygenase
                     [General function prediction only]; Region: COG2514"
                     /db_xref="CDD:225312"
     misc_feature    complement(382178..382549)
                     /locus_tag="Bsph_0359"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_12; cd07255"
                     /db_xref="CDD:211352"
     misc_feature    complement(order(382208..382210,382349..382351))
                     /locus_tag="Bsph_0359"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:211352"
     misc_feature    complement(381737..382066)
                     /locus_tag="Bsph_0359"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    complement(order(381740..381742,381746..381748,
                     381770..381772,381869..381871,381926..381928,
                     381932..381934,381965..381967,382052..382054,
                     382064..382066))
                     /locus_tag="Bsph_0359"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    complement(order(381740..381742,381869..381871,
                     382064..382066))
                     /locus_tag="Bsph_0359"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            382969..383139
                     /locus_tag="Bsph_0360"
                     /db_xref="GeneID:6021911"
     CDS             382969..383139
                     /locus_tag="Bsph_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696117.1"
                     /db_xref="GI:169825959"
                     /db_xref="GeneID:6021911"
                     /translation="MKKKVPNIENGTMARDMKELKDLGKQMEHLRDGLELADDERIAD
                     PIQLESIEEKDE"
     gene            383224..384054
                     /locus_tag="Bsph_0361"
                     /db_xref="GeneID:6021912"
     CDS             383224..384054
                     /locus_tag="Bsph_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="plant-metabolite dehydrogenase"
                     /protein_id="YP_001696118.1"
                     /db_xref="GI:169825960"
                     /db_xref="GeneID:6021912"
                     /translation="MYLQSSKTLSNGVEMPRFGLGVYKMTDHEETLQSIDTALKFGYR
                     AIDTASLYGNEAEVGEAIRYSGIPREHIFVTTKVWNNDQGYDETLRAFEVSLKKLKMD
                     YVDLYLTHWAVPETFEETYRAIERLYDEKLIRATGVSNHHEHHLEKILAKANIAPMVN
                     QVEMHPYLQQQALSAYCHEHQIAVTAWSPLGRGGVLDDSTILEISKEIGKTTAQVVLR
                     WHLQNDTLIIPKSVTPSRIEENAQIFDFELTQTQMEKIASLNRNQRFGQDPDHFKFDF
                     "
     misc_feature    383251..384000
                     /locus_tag="Bsph_0361"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    383272..384006
                     /locus_tag="Bsph_0361"
                     /note="Aldo/keto reductase family; Region: Aldo_ket_red;
                     pfam00248"
                     /db_xref="CDD:215817"
     misc_feature    order(383284..383292,383362..383364,383377..383379,
                     383452..383454,383551..383556,383638..383643,
                     383704..383706,383782..383799,383860..383862,
                     383905..383916,383929..383931,383938..383943)
                     /locus_tag="Bsph_0361"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(383362..383364,383377..383379,383452..383454,
                     383551..383553)
                     /locus_tag="Bsph_0361"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(384079..384942)
                     /locus_tag="Bsph_0362"
                     /db_xref="GeneID:6021913"
     CDS             complement(384079..384942)
                     /locus_tag="Bsph_0362"
                     /EC_number="5.4.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridine synthase yhcT"
                     /protein_id="YP_001696119.1"
                     /db_xref="GI:169825961"
                     /db_xref="GeneID:6021913"
                     /translation="MFLYAFNEDNLTIEELLRNHWRLGKKLVHELRMAKAITLENDEL
                     VQWNTPLQVGTIVKFTFPIPASSYKRTPVCAIDIVYEDDHCLIVSKPKGMATHPNDDR
                     DTHTCMNHVMAHIQEQGGIYAEHVHRLDKGTQGLLLVAKHPLAKSIFDRMIEEKSIIR
                     TYAAEVQGNIRSSSGTISESIGKDRHHASRRVVSQTGQHAVTHYEVVSRYKNSCVVHL
                     ILETGRTHQIRVHLAYIGHPIIGDTMYGARETASGDYELHAIQLEFDHPFLNKRITVK
                     DEQSSKNPASQ"
     misc_feature    complement(384115..384924)
                     /locus_tag="Bsph_0362"
                     /note="Pseudouridylate synthases, 23S RNA-specific
                     [Translation, ribosomal structure and biogenesis]; Region:
                     RluA; COG0564"
                     /db_xref="CDD:223638"
     misc_feature    complement(384151..384687)
                     /locus_tag="Bsph_0362"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    complement(order(384256..384258,384553..384564))
                     /locus_tag="Bsph_0362"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            complement(384997..385422)
                     /locus_tag="Bsph_0363"
                     /db_xref="GeneID:6021914"
     CDS             complement(384997..385422)
                     /locus_tag="Bsph_0363"
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide oxidoreductase"
                     /protein_id="YP_001696120.1"
                     /db_xref="GI:169825962"
                     /db_xref="GeneID:6021914"
                     /translation="MSKKEENGLLFIWIVSAVATLGSLYFSEIRHYEPCKLCWIQRIF
                     MYPIVIMATVAFIQKNARIAVTTAVFSVIGGCISLYHYGIQKLSFLADSAPSCGAVSC
                     TGQYINWLGFITIPFLALTAFILIAGASFYLIKATKAVK"
     misc_feature    complement(385012..385422)
                     /locus_tag="Bsph_0363"
                     /note="putative disulfide oxidoreductase; Provisional;
                     Region: PRK03113"
                     /db_xref="CDD:179540"
     gene            385606..386721
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /db_xref="GeneID:6021915"
     CDS             385606..386721
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein"
                     /protein_id="YP_001696121.1"
                     /db_xref="GI:169825963"
                     /db_xref="GeneID:6021915"
                     /translation="MKENEHSNISILKEIAELLNEETEIVTMLKGALIKFLNGTNFET
                     GWIFFIDAKGRSELVVHENLPEALEFKNCHYLNKGGCWCVSRYRNEELKKASNIIECQ
                     RIESAIAANVGDHEGITHHATVPLQSGQERFGVLNVASKDTVRFSEEELALLESVAFQ
                     MGSAIKRILLTKQEQEMALVKERNRLARDLHDSVNQLLFSVTLTARAGIEMTQDSDVK
                     ETFKEIQHLTQDALTEMRALIWQLRPKGLENGLLEAIKVYAEMLGLKLHVTVSGVLQF
                     PSRIEETLFRVAQEALNNVRRHAGVLEAALYITVTSTDILLVIRDEGRGFVIDNNTKL
                     LSMGLQSIKDRAKSVGGTADWVSEMGKGTELLIRLPY"
     misc_feature    385624..386133
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    386101..386715
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG3920"
                     /db_xref="CDD:226434"
     misc_feature    386149..386334
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:219540"
     misc_feature    386455..386712
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(386473..386475,386485..386487,386494..386496,
                     386560..386562,386566..386568,386572..386574,
                     386578..386583,386611..386622,386668..386670,
                     386674..386676,386689..386694,386698..386700)
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    386485..386487
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(386572..386574,386578..386580,386611..386613,
                     386617..386619)
                     /gene="liaS"
                     /locus_tag="Bsph_0364"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            386734..387381
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /db_xref="GeneID:6023139"
     CDS             386734..387381
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator-like protein"
                     /protein_id="YP_001696122.1"
                     /db_xref="GI:169825964"
                     /db_xref="GeneID:6023139"
                     /translation="MIRVLIADDHHVVRRGLLFFLKTQKDIEVVGEAKNGHEAVSLAE
                     SIQPDIILMDLVMPELDGIQATKRIKAKFPKIEILMLTSFSDRDHVVPAMEAGAAGYQ
                     LKDIEPDELVLSIRRIMRGENTLHPEATTTLEMDRQEAQNAPHSLNPLTPREQDVLAE
                     LTKGKSNREIASSLFVTEKTVKTHISNIFTKLQVQDRTQAALYAVKHGLTEGSGS"
     misc_feature    386737..387369
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    386746..387090
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(386755..386760,386893..386895,386917..386919,
                     386977..386979,387034..387036,387043..387048)
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    386893..386895
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(386902..386907,386911..386919)
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    387043..387051
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    387181..387351
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(387184..387192,387229..387237,387259..387264,
                     387268..387273,387277..387291,387322..387324)
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(387217..387219,387223..387225,387229..387231,
                     387322..387330,387337..387339,387346..387351)
                     /gene="yhcZ"
                     /locus_tag="Bsph_0365"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(387435..388556)
                     /locus_tag="Bsph_0366"
                     /db_xref="GeneID:6023140"
     CDS             complement(387435..388556)
                     /locus_tag="Bsph_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696123.1"
                     /db_xref="GI:169825965"
                     /db_xref="GeneID:6023140"
                     /translation="MIRAVLIDNEPLALHYFQNKLQVFQQIQVIQTFTSVEVFLNELP
                     SIEFEVLFLEVKLKELSGLEVADMIKTERPHVSVVFITSYHEFALQAYEIGGLDYLLK
                     PISHARLEKTVTRIEHEFSIQQMLQQATQTLLNVQCFDQFAVYSNKSLVAFKTEKTKE
                     LFAYFILHPNIPIHRDYLIEILWPDLDYVRAKSNLHTALSYLRKTLNTIGYENCIVFS
                     NKYYIFEKPSLVCDLYDFQKLHEDFSRLEFPSISLIHQCLAIYKNGLFVFDDYEWAKA
                     YKDRLTKSYIELLEKGFQTTVFSDTDKAIEFLHALLEYDPYNEQKLEHYLYTLIQAGL
                     HEQAHKIFLTYKQKLKEDLALPPSSTLLEISKKLFVESK"
     misc_feature    complement(388209..>388376)
                     /locus_tag="Bsph_0366"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(388248..388253,388260..388262,
                     388311..388313,388371..388373))
                     /locus_tag="Bsph_0366"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(388245..388253)
                     /locus_tag="Bsph_0366"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(387909..388094)
                     /locus_tag="Bsph_0366"
                     /note="Transcriptional regulatory protein, C terminal;
                     Region: Trans_reg_C; smart00862"
                     /db_xref="CDD:214866"
     misc_feature    complement(387474..387866)
                     /locus_tag="Bsph_0366"
                     /note="Bacterial transcriptional activator domain; Region:
                     BTAD; pfam03704"
                     /db_xref="CDD:202730"
     gene            389128..390054
                     /gene="yobV"
                     /locus_tag="Bsph_0367"
                     /db_xref="GeneID:6023141"
     CDS             389128..390054
                     /gene="yobV"
                     /locus_tag="Bsph_0367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696124.1"
                     /db_xref="GI:169825966"
                     /db_xref="GeneID:6023141"
                     /translation="MKLERLLTMIMILINRKKVTAQELAELFNVSVRTIYRDIETLSC
                     AGIPVISQQGVHGGISLIDGYRVDKQVLTKEELASLTIAIKSALTTYEDSHALAVLEK
                     LTSIADDHVTQTIDHLFVDLSPWGPNILFKEHITSLKSAIENRHCVSFTYTTAHGELT
                     KRVVEPHTIVQKGKTWYLYGYCTLRMDFRLFKLARIKNLMQEDLHFERKEINLSELPW
                     GKEWYQPQNVVDLVISFDTAITTLVEESFGVAYVDHGQDKIYISIPEDEWLYGFLLSF
                     GNRIKVLEPPHIRDILQKRAHEIAQLYNPDNS"
     misc_feature    389128..390039
                     /gene="yobV"
                     /locus_tag="Bsph_0367"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    389140..389325
                     /gene="yobV"
                     /locus_tag="Bsph_0367"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:116863"
     misc_feature    389524..390027
                     /gene="yobV"
                     /locus_tag="Bsph_0367"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:222022"
     gene            390106..390861
                     /locus_tag="Bsph_0368"
                     /db_xref="GeneID:6023142"
     CDS             390106..390861
                     /locus_tag="Bsph_0368"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696125.1"
                     /db_xref="GI:169825967"
                     /db_xref="GeneID:6023142"
                     /translation="MESTMMQSYCQSCGMPLTDEALLGTEKEGHKNQDYCTYCYEEGS
                     FKQPNLTVEEMIDICVPHLKGDGMPANEARTMLTSFLPSLKRWRKQEWSEPKIIKREA
                     FQIIGISTKTSNANELTAQAKIPQLWQDFYEKNIVDQLSKLDNQNVYGLYSDYETDVN
                     GNYAITIGVEASKMNDASPEWVIKTIPAAKYLVFTSHKGKMPEIVIQTWQEIWAWFAN
                     SKVERTYTGDFELYDERCANPQEAQVEVYIAIK"
     misc_feature    390130..390369
                     /locus_tag="Bsph_0368"
                     /note="Putative zinc ribbon domain; Region: Zn_ribbon_2;
                     pfam12674"
                     /db_xref="CDD:221703"
     misc_feature    390385..390858
                     /locus_tag="Bsph_0368"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3708"
                     /db_xref="CDD:226231"
     gene            complement(390880..391788)
                     /locus_tag="Bsph_0369"
                     /db_xref="GeneID:6023143"
     CDS             complement(390880..391788)
                     /locus_tag="Bsph_0369"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696126.1"
                     /db_xref="GI:169825968"
                     /db_xref="GeneID:6023143"
                     /translation="MELYTNLRQGEKGAWLSIGTYLILSSIKLTIGYIGTSEALKADG
                     LNNTTDIIASIAVLIGLRIAQRPPDSNHQYGHLRAETIASLVASFIMLVVGLQVLINS
                     LKSLWAPSGTTPSLLTAFVAIGSGAVMYIVYRYNLALSKKIKSSAVKAAAFDNRSDAF
                     VSIGTAIGIFGAIFGFPIIDSLTALIVAVLIIKTAVEIFGEAVQSLTDAFDIDEVETL
                     SVLIRNVDGVIELLDFKGRAHGNMYFIDITVTVDPYLNVFDSHRITEEIERTILRENR
                     FCQVLVHIEPHIEIIPPQNDEKSPTS"
     misc_feature    complement(391006..391788)
                     /locus_tag="Bsph_0369"
                     /note="Predicted Co/Zn/Cd cation transporters [Inorganic
                     ion transport and metabolism]; Region: MMT1; COG0053"
                     /db_xref="CDD:223131"
     misc_feature    complement(391006..391722)
                     /locus_tag="Bsph_0369"
                     /note="Cation efflux family; Region: Cation_efflux;
                     cl00316"
                     /db_xref="CDD:241777"
     gene            complement(391982..393274)
                     /gene="yhdP"
                     /locus_tag="Bsph_0370"
                     /db_xref="GeneID:6020981"
     CDS             complement(391982..393274)
                     /gene="yhdP"
                     /locus_tag="Bsph_0370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696127.1"
                     /db_xref="GI:169825969"
                     /db_xref="GeneID:6020981"
                     /translation="MTGFFVATEFAIVKVRTTRIDQLLAEGHKKAKNAKRVVSDLDEY
                     LSACQLGITITALGLGWLGEPTFEIILHPVFEFLNLNGSITSILSFILAFSIVTFMHV
                     VIGELAPKTLAIQKAEFVTLNFSGALILFHNITYPVIKLLNGSARGLTGLFGLKMMSE
                     SEVAHTEEELRMILSDSLKGGEINNAEYEYVNSIFEFSDRLAKEIMVPRTEIVGIEKE
                     LTIKEVFDLMGVEQYTRYPIIDGDKDHIIGLVNMKHLLTAYIKDSKNGDKPVIDYMQP
                     IIRVMETTQINDLLLKIQRERIHMAILMDEYGGTSGLVTIEDIIEEIVGDIQDEFDED
                     EIPEVQEIADNHFILDAKMLLENVNDMLGTDIEDDDIDTIGGWFMTKRFDAVEGDSIQ
                     EQGYEFIAKELDGHHILYLEVLKLPETDLSNEFDAVTE"
     misc_feature    complement(392015..393274)
                     /gene="yhdP"
                     /locus_tag="Bsph_0370"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    complement(392714..393268)
                     /gene="yhdP"
                     /locus_tag="Bsph_0370"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:216595"
     misc_feature    complement(392330..392647)
                     /gene="yhdP"
                     /locus_tag="Bsph_0370"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(392027..392257)
                     /gene="yhdP"
                     /locus_tag="Bsph_0370"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            complement(393394..393531)
                     /locus_tag="Bsph_0371"
                     /db_xref="GeneID:6020982"
     CDS             complement(393394..393531)
                     /locus_tag="Bsph_0371"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696128.1"
                     /db_xref="GI:169825970"
                     /db_xref="GeneID:6020982"
                     /translation="MALTITLLLILPIFLNGIENQLKKVVVNICVFLLNNLLLKHPTI
                     F"
     gene            complement(393766..394209)
                     /locus_tag="Bsph_0372"
                     /db_xref="GeneID:6020983"
     CDS             complement(393766..394209)
                     /locus_tag="Bsph_0372"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696129.1"
                     /db_xref="GI:169825971"
                     /db_xref="GeneID:6020983"
                     /translation="MFFMQEAISMSKVTLSDDLNSYHSKALIRVKVKEFFSEFSAKIF
                     ELADEAGNLDIKKFEAISGINGDFYNEYCSQLKGFFDSSASTFGKKSIKTMYFTYNGK
                     NYMLTQQGITEKAPVSIAPFTGDLPLKESFHDVEKACLKLRFQQE"
     gene            complement(394354..394560)
                     /locus_tag="Bsph_0373"
                     /db_xref="GeneID:6020984"
     CDS             complement(394354..394560)
                     /locus_tag="Bsph_0373"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696130.1"
                     /db_xref="GI:169825972"
                     /db_xref="GeneID:6020984"
                     /translation="MMIQHFSFKPLFENTQLPGWTIAFFYQRERYSAEYLKDGTIQWT
                     GPTPPNEEDVKKMIHELMLFHVYD"
     gene            394746..395888
                     /locus_tag="Bsph_0374"
                     /db_xref="GeneID:6020985"
     CDS             394746..395888
                     /locus_tag="Bsph_0374"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696131.1"
                     /db_xref="GI:169825973"
                     /db_xref="GeneID:6020985"
                     /translation="MDNFIVTLLFMAIIGAAIGGVTNHLAIKMLFRPHNAIYIKNWRV
                     PFTPGLIPKRRDELAKQLGLTVVNYLLTPETFRKKFFSKDIQEKVEQFVQTKVEETIF
                     TNDKTIQDWLNIAGFSHMPATIEQKVEAIVEGQFASVKNTLSTKSIRTLLSSDMQDTL
                     DAKIPVAVSHILEKGEDYFLSPEGEMTIKAMIDDFLSSKGSFGGMINMFLGDSSSLVG
                     KVQRELVKFLQAPGTSTLLTKIFTQEWEKLKDRPAMDFLQDMQFDPILSKLQMYVKEQ
                     LAVAERLNQPISYYWPEGNEWMKNSVIPQAIDKAFVKAEEKLEDVLKRLNLQEVVREQ
                     VDSFPVEKLEELVLGISKREFKMITVLGAVLGGLIGIVQGLIVNFI"
     misc_feature    394764..395816
                     /locus_tag="Bsph_0374"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4399"
                     /db_xref="CDD:226834"
     gene            395905..396252
                     /gene="yheA"
                     /locus_tag="Bsph_0375"
                     /db_xref="GeneID:6021453"
     CDS             395905..396252
                     /gene="yheA"
                     /locus_tag="Bsph_0375"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696132.1"
                     /db_xref="GI:169825974"
                     /db_xref="GeneID:6021453"
                     /translation="MVNIYNDINALEATFRKTPEFEALQAAVEVVKSDEEALNVFKNF
                     RKIQIELQKKQLAGEELLEDELVYAQKASQLVQQNEKISAMLEAEMKLSKVIEEVNRI
                     LIKPIQGLYEDIQ"
     misc_feature    395905..396243
                     /gene="yheA"
                     /locus_tag="Bsph_0375"
                     /note="hypothetical protein; Provisional; Region:
                     PRK13676"
                     /db_xref="CDD:237467"
     gene            396383..397045
                     /locus_tag="Bsph_0376"
                     /db_xref="GeneID:6021454"
     CDS             396383..397045
                     /locus_tag="Bsph_0376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696133.1"
                     /db_xref="GI:169825975"
                     /db_xref="GeneID:6021454"
                     /translation="MYVFIEWTYKTPKGATTVLRSEEMPAAQALLLAEDMEKTGRVKS
                     IHCLDRQDTSWTIKELKTYLKEIDTEPHNIIVYFDGGFDRGTRQAGLGCAIYYEQNGK
                     PYRLRRNAFSSELTSNNEAEYAALYLGVVELELLNVHHLPVQIKGDSQVVINQLRGEW
                     AALEKDLVGWADKIDAKLAQLTIQPDYQLITRKDNSEADSLATQALNGIDITGLSELV
                     KE"
     misc_feature    396383..397039
                     /locus_tag="Bsph_0376"
                     /note="hypothetical protein; Validated; Region: PRK07708"
                     /db_xref="CDD:181088"
     misc_feature    396602..397000
                     /locus_tag="Bsph_0376"
                     /note="RNAse HI family that includes Archaeal RNase HI;
                     Region: RNase_HI_archaeal_like; cd09279"
                     /db_xref="CDD:187703"
     misc_feature    order(396617..396628,396731..396739,396746..396748,
                     396824..396826,396947..396949,396989..396991)
                     /locus_tag="Bsph_0376"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:187703"
     misc_feature    order(396617..396619,396746..396748,396824..396826,
                     396977..396979)
                     /locus_tag="Bsph_0376"
                     /note="active site"
                     /db_xref="CDD:187703"
     gene            397164..398072
                     /locus_tag="Bsph_0377"
                     /db_xref="GeneID:6021455"
     CDS             397164..398072
                     /locus_tag="Bsph_0377"
                     /codon_start=1
                     /transl_table=11
                     /product="copper amine oxidase-like protein"
                     /protein_id="YP_001696134.1"
                     /db_xref="GI:169825976"
                     /db_xref="GeneID:6021455"
                     /translation="MYMKKLAPVALSALLMGSVMIPVASANEQKDEVEIPQIQIDPVH
                     IFNQTHGTVEDVRVGKDITYYTVKDGEQTNILEITKDTLVYDNTGKKVELKEGDQVVA
                     YTFANKPQKYIYPPQFNPEIIIVDSKEVGFVEVDYFFDDLTNTYDILKLNIGKETELV
                     NAKGKKVTSKDLVEKHLAVFYTASTKSIPAQTTPSKVIVLDDNSEISLSPIDEEINTI
                     IATDYYMVAETTMVPLRSIAEKLGFQVESKGKAVILTKGNESYTITRGEKAFGYNKSL
                     RTLSVAPSLKDTKTYVPVEFIEEYLK"
     misc_feature    397839..398066
                     /locus_tag="Bsph_0377"
                     /note="Copper amine oxidase N-terminal domain; Region:
                     Cu_amine_oxidN1; pfam07833"
                     /db_xref="CDD:219600"
     gene            complement(398119..398499)
                     /locus_tag="Bsph_0378"
                     /db_xref="GeneID:6021456"
     CDS             complement(398119..398499)
                     /locus_tag="Bsph_0378"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696135.1"
                     /db_xref="GI:169825977"
                     /db_xref="GeneID:6021456"
                     /translation="MFLLKNNKRPFISSFIHQVEVAFHHFDLARCDEKTLYVTVLFKY
                     GTHNVICDFIYIIDQQDMYGAISINKHYEKARAFVKQHFQQLLLYSDEMILANNFMNT
                     VSFKYCLQQFVKRYPTFNSSKIVS"
     gene            398674..400179
                     /locus_tag="Bsph_0379"
                     /db_xref="GeneID:6021457"
     CDS             398674..400179
                     /locus_tag="Bsph_0379"
                     /EC_number="1.3.99.22"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_001696136.1"
                     /db_xref="GI:169825978"
                     /db_xref="GeneID:6021457"
                     /translation="MKMIHIDQKYPEDWIRVLNHIANLFFEDSKLRVEPEEADMSVSF
                     TYDVEENFTISTKAILTVDGQQYTNNYSIQYESAATGRELNIRMKRALSHVFLDVLEQ
                     HTGVHQQWGILTGVRPTKLYHKFRKEGKGEQEIAELLIRDFRLSEEKVALLKDIVERQ
                     LVTIPDIDQIGQEISVYIGIPFCPTKCAYCTFPAYAIGSNRKQGRVNTFLDGLHIELR
                     EMGKWLKNNNMKITSIYWGGGTPTSIEADEMDALYQTMYESFPNPETIREITVEAGRP
                     DTITPEKLEVLKKWGIDRISVNPQSYTDETLKAIGRHHTVQETIDKFWLARESGMNNI
                     NMDLIIGLPNEGIEEFQHSLVESAKMQPESLTVHTLSFKRASEMTRNKDKYKVADRDT
                     VAEMMQMAQDWTKENDYVPYYLYRQKNILGNLENVGYSKAGEESIYNIVIMEEVQTIL
                     GVGCGASSKFVHPETGKITQFHNPKDPAAYIMTFEEAIGKKIEFLDELYKI"
     misc_feature    398704..400173
                     /locus_tag="Bsph_0379"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK08207"
                     /db_xref="CDD:236187"
     misc_feature    399220..399867
                     /locus_tag="Bsph_0379"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(399220..399222,399226..399228,399232..399234,
                     399238..399246,399382..399384,399388..399393,
                     399487..399495,399565..399567,399688..399690,
                     399793..399798)
                     /locus_tag="Bsph_0379"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(400217..401296)
                     /locus_tag="Bsph_0380"
                     /db_xref="GeneID:6023701"
     CDS             complement(400217..401296)
                     /locus_tag="Bsph_0380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696137.1"
                     /db_xref="GI:169825979"
                     /db_xref="GeneID:6023701"
                     /translation="MLTKKLADEIVHQTMLRLRHNINVISPTGVILASGDKMRVEDIH
                     EGAVYVAQTKKTLIINEDNIELYPNTKPGINMPILYQDEVVGVIGITGDSEEMLEIAN
                     LVQLTTEIMTHQALVESKSEWQRKNNDYIFEALVHGSKLDATLNKRIQKLPFSLIAPF
                     QVILVSLHETSYLENRMPFFFEDLFYRQPILAGHSQLQEYYILLTYRQEQNYQSIIKA
                     LRKKKQKLPSLQIGIGPVVQQLSQLPYSYQGARTALEFATIHNEITFFEDVELFSLFK
                     HRESEEVQAFHHRILKNINAKQLETLQSFFDCNLQLKLCAQQLNIHRHTLTYRLNKIR
                     ELTGYDPQYFEDAVILQMACTLRTL"
     misc_feature    complement(400226..401296)
                     /locus_tag="Bsph_0380"
                     /note="Sugar diacid utilization regulator [Transcription /
                     Signal transduction mechanisms]; Region: CdaR; COG3835"
                     /db_xref="CDD:226355"
     misc_feature    complement(400889..401293)
                     /locus_tag="Bsph_0380"
                     /note="Putative sugar diacid recognition; Region:
                     Diacid_rec; pfam05651"
                     /db_xref="CDD:147680"
     misc_feature    complement(400229..400396)
                     /locus_tag="Bsph_0380"
                     /note="PucR C-terminal helix-turn-helix domain; Region:
                     HTH_30; pfam13556"
                     /db_xref="CDD:205734"
     gene            401462..402601
                     /locus_tag="Bsph_0381"
                     /db_xref="GeneID:6023702"
     CDS             401462..402601
                     /locus_tag="Bsph_0381"
                     /EC_number="2.7.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="YP_001696138.1"
                     /db_xref="GI:169825980"
                     /db_xref="GeneID:6023702"
                     /translation="MKIIISPDSFKGTLSAVEVAKSMQQGILDVNPSIETIILPVADG
                     GEGTLDSLIASTGGQYFSTEVLDPIGRDIQAQYGVLGDKETCVIEMAQASGIMLLQDH
                     EKNPEFATTYGTGQLIKAALDRGFRKFIIGIGGSATNDAGIGMLKALGVRFIKEDGSD
                     LEDGISSLMELTAIDISGLDERLIGAIFTIACDVDNPFIGERGATAIFGPQKGVQDYQ
                     ITHFDNCLKHFADIIEQQFAIRLHDYQGAGAAGGLGGALIAFLNGTFHAGIDIVIDAV
                     QLQDHLAAAQLVITGEGKSDLQTLHGKAPLGVAKAAALAHVEAVLLSGDIDSMAKPAL
                     QNYFSVVETLVDEEITTEQAMREPAYFIRLKTKQIFELYIQKGDD"
     misc_feature    401465..402370
                     /locus_tag="Bsph_0381"
                     /note="glycerate kinase; Region: TIGR00045"
                     /db_xref="CDD:232797"
     gene            402602..403948
                     /locus_tag="Bsph_0382"
                     /db_xref="GeneID:6023703"
     CDS             402602..403948
                     /locus_tag="Bsph_0382"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate permease"
                     /protein_id="YP_001696139.1"
                     /db_xref="GI:169825981"
                     /db_xref="GeneID:6023703"
                     /translation="MLFIIILLGVLFVVWGTAKLKLHPFLALLISAFFVGIASGMPLL
                     TVVESINTGFGGLMTSIGLVIIAGTIIGLILEKSGAAYRMAEVVLRIVGPKRPQLAMS
                     LIGYIVSIPVFCDSGFIILSSLQKSLAKRANVTIASMAVALATGLFATHVLVPPTPGP
                     IAAAGNIGAANYLGTVIVIGLLVAIPATFVGYMWSVKVATKIRVPQDEVEALDYEEVI
                     KSFGKMPSTFKAFLPIVLPIVLIGLGSIASLAGDPESTFNTIFKFLGSPTVALFLGVA
                     AAFLLLPEISETTLTGWIGESLKEAAPILLITGAGGSFGTVIKNAGVGEILQEMDLGM
                     FASGTLFLLVPFIVAAALKTAQGSSTTALVITSTLVAPMLVTLGIEGAVPLALVVMAI
                     GAGAMTVSHVNDSFFWVITQYSGMEVTQAYKAQTVATLLQGIVTIMITMVLWWIFV"
     misc_feature    402650..403942
                     /locus_tag="Bsph_0382"
                     /note="H+/gluconate symporter and related permeases
                     [Carbohydrate transport and metabolism / Amino acid
                     transport and metabolism]; Region: GntT; COG2610"
                     /db_xref="CDD:225330"
     misc_feature    402656..403939
                     /locus_tag="Bsph_0382"
                     /note="fructuronate transporter; Provisional; Region:
                     PRK10034; cl15264"
                     /db_xref="CDD:246912"
     gene            404021..405199
                     /locus_tag="Bsph_0383"
                     /db_xref="GeneID:6023704"
     CDS             404021..405199
                     /locus_tag="Bsph_0383"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase-like protein"
                     /protein_id="YP_001696140.1"
                     /db_xref="GI:169825982"
                     /db_xref="GeneID:6023704"
                     /translation="MRKLIVVLLCIFLLAGCTEAIKTERVPVTAGDEMRVHFMDVGQG
                     DSILIESPNGKTMLIDAGVKGAGQQVVSYLKELGVNKLDKVVATHPDADHIGGLIPVL
                     HAIPIEQFYDSGKVHTSQTFEEMLMAIDEKNIPYYVPKTGDFIEFDKDVTVKVLNANE
                     HATDNNDASIVLKVVYGNVSFLLTGDAGIALEKEMMSNDVTATVLKAGHHGSNTSSSE
                     DFIRAVKPEVTILSYGEDNKYGHPHAEVVNRLQAIGSNIYATADLGTITVATNGVNYT
                     VNGKRAVTQKKPSTVEPTTAVEIVSKDLVTEIVGIKNNGQQAVSLNDWQLISLEGNQV
                     FNFPNLSLQPGKIIYVTSGANAREGDNYLKWTTKQIWLNDGDAAQLRNEKGELVSELD
                     "
     misc_feature    404021..404887
                     /locus_tag="Bsph_0383"
                     /note="Predicted hydrolase (metallo-beta-lactamase
                     superfamily) [General function prediction only]; Region:
                     ComEC; COG2333"
                     /db_xref="CDD:225212"
     misc_feature    404021..404074
                     /locus_tag="Bsph_0383"
                     /note="Prokaryotic membrane lipoprotein lipid attachment
                     site; Region: LPAM_1; pfam08139"
                     /db_xref="CDD:149279"
     misc_feature    404156..404713
                     /locus_tag="Bsph_0383"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     misc_feature    404909..405196
                     /locus_tag="Bsph_0383"
                     /note="Lamin Tail Domain; Region: LTD; pfam00932"
                     /db_xref="CDD:216203"
     gene            405186..405434
                     /locus_tag="Bsph_0384"
                     /db_xref="GeneID:6023705"
     CDS             405186..405434
                     /locus_tag="Bsph_0384"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696141.1"
                     /db_xref="GI:169825983"
                     /db_xref="GeneID:6023705"
                     /translation="MSSTKYTLDRIEDGYAVFLKYPEEEEQIIILQSALNKPVLVGDR
                     VQIEEIDGMYHIEILREETEQKRADIQNLMDRLRHKNK"
     misc_feature    405198..405419
                     /locus_tag="Bsph_0384"
                     /note="Protein of unknown function (DUF3006); Region:
                     DUF3006; pfam11213"
                     /db_xref="CDD:221030"
     gene            405627..406415
                     /locus_tag="Bsph_0385"
                     /db_xref="GeneID:6022543"
     CDS             405627..406415
                     /locus_tag="Bsph_0385"
                     /EC_number="3.1.3.29"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acylneuraminate-9-phosphatase"
                     /protein_id="YP_001696142.1"
                     /db_xref="GI:169825984"
                     /db_xref="GeneID:6022543"
                     /translation="MSINTIIFDLDDTLLWDKKSVKTAFEKTCDYAATIHNVNSAELE
                     EAVRQEARALYEGYETYDYTVLIGINPFEGLWGTFDDPTESFQAMKRLVPGYRAAAWT
                     KGLSALGIEDAKFGAELGERFVAERKASPFLYEDTFTVLDELKGKYQLVLLTNGAPSL
                     QNLKLEITPEIAPYFDHIIISGDFGKGKPDASIFEHVMERTGITADDAIMVGDNLNTD
                     ILGSSRVGMRNVWINRDNNMANGAVTPTYEISSLTDLVKLVKQL"
     misc_feature    405627..406412
                     /locus_tag="Bsph_0385"
                     /note="Predicted hydrolase (HAD superfamily) [General
                     function prediction only]; Region: COG1011"
                     /db_xref="CDD:223943"
     misc_feature    406023..406322
                     /locus_tag="Bsph_0385"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    406086..406088
                     /locus_tag="Bsph_0385"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(406572..408179)
                     /locus_tag="Bsph_0386"
                     /db_xref="GeneID:6022544"
     CDS             complement(406572..408179)
                     /locus_tag="Bsph_0386"
                     /EC_number="1.1.1.95"
                     /note="catalyzes the formation of 3-phosphonooxypyruvate
                     from 3-phospho-D-glycerate in serine biosynthesis; can
                     also reduce alpha ketoglutarate to form
                     2-hydroxyglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="YP_001696143.1"
                     /db_xref="GI:169825985"
                     /db_xref="GeneID:6022544"
                     /translation="MITATKTINVFIADPLSEDGIFPLRQEQDLDLNIIVDTGLAPEE
                     LMTKIADVDVLLVRSQTTVTREVIEAAKSLKLIGRAGVGVDNIDLTAATEHGIIVVNA
                     PDGNTNSAAEHTIAMMTSLARHIPQAFNTLKNGKWDRKSYVGVELKNKTLGVVGFGRI
                     GVEVAYRAKGQRMNVMAYDPFLTDERAKELGVTKASVEEICEAADFITVHTPLLPETR
                     NLINKEKFAMMKDGVRIINCARGGIINEDDLYDAIVAGKVAGAALDVFVSEPATDHKL
                     LTLPQVIATPHLGASTIEAQESVAVDVSNDIIKFYKTGTVTNPVNMPSIPKELLAQVE
                     PFFELAEKLGSFLSQVTTEPVKEINLSYAGEVANYDVRPLTSNALKGLLAKNHGNHVN
                     DVNARYLSERIGMKIIEHKTTTAKGFTSLITIEIITANETHTVAGTLLNGLGARIVKV
                     EDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKDINIATMQVGRAQVGGTAVMMLT
                     IDNVVTNEDLAFVAQLENIDEVKAINL"
     misc_feature    complement(406575..408152)
                     /locus_tag="Bsph_0386"
                     /note="D-3-phosphoglycerate dehydrogenase; Provisional;
                     Region: PRK13581"
                     /db_xref="CDD:237436"
     misc_feature    complement(407238..408152)
                     /locus_tag="Bsph_0386"
                     /note="Phosphoglycerate dehydrogenases, NAD-binding and
                     catalytic domains; Region: PGDH_4; cd12173"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(407292..407294,407310..407312,
                     407319..407321,407460..407462,407862..407864,
                     407934..407939,407943..407945,408003..408008))
                     /locus_tag="Bsph_0386"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(407310..407315,407319..407321,
                     407385..407390,407460..407468,407529..407531,
                     407544..407552,407637..407648,407700..407708,
                     407712..407714,407850..407852,407862..407864,
                     407934..407936))
                     /locus_tag="Bsph_0386"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(407286..407288,407298..407309,
                     407313..407336,407340..407354,407367..407375,
                     407382..407384,407667..407672,407679..407681,
                     407730..407732,407736..407756,407763..407765,
                     407769..407777,407781..407786,407793..407798,
                     407802..407807,407811..407813,407820..407825,
                     407832..407837,407841..407846,407853..407858))
                     /locus_tag="Bsph_0386"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240650"
     misc_feature    complement(order(407319..407321,407373..407375,
                     407460..407462))
                     /locus_tag="Bsph_0386"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240650"
     misc_feature    complement(406575..406793)
                     /locus_tag="Bsph_0386"
                     /note="C-terminal ACT (regulatory) domain of
                     D-3-phosphoglycerate dehydrogenase (3PGDH); Region:
                     ACT_3PGDH-xct; cd04902"
                     /db_xref="CDD:153174"
     misc_feature    complement(order(406716..406718,406770..406772,
                     406776..406778))
                     /locus_tag="Bsph_0386"
                     /note="putative L-serine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153174"
     gene            408982..410631
                     /locus_tag="Bsph_0387"
                     /db_xref="GeneID:6022545"
     CDS             408982..410631
                     /locus_tag="Bsph_0387"
                     /note="proposed role in polysaccahride synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="YP_001696144.1"
                     /db_xref="GI:169825986"
                     /db_xref="GeneID:6022545"
                     /translation="MKYDVAIVGAGLAGLVAACELVDAKKKILLVDQEPENSMGGQAF
                     WSFGGIFLVNSPEQRRLGIKDSKELAWQDWLGTAGFDRLEDEDSWAYKWARAYVDFAA
                     GEKYHWLKSKGIKFFPVVGWAERGGSHAGGHGNSVPRFHIVWGTGPGIVKPFVDKVKK
                     AIKDGYIEFKPRHRVDEFIQQDEKIMGISGTVLAETFISRGEKSSRLGVGEFSYEAAA
                     VIVASGGIGANFDLVRKNWPERLGTPPKNMVCGVPAYVDGRMLEITEHAGGRIVNRDR
                     MWHYTEGLKNWDPIWPNHGIRILPGPSSLWFDAEGNRFHAPNFPGFDTLSTLETIQKT
                     GYDYSWFILTEKIIEKEFALSGSEQNPDLTNKSIGDVLKRIMPGPPAPIQAFKNHGED
                     FVIANDLRELVNGMNKLAGNDLLDFMKIKEQILARDREMDNKFTKDIQVNAIHGARNY
                     IGDKLIRVAKPHKILDTKNWPLIAVRLNILTRKTLGGLQTNLNGAVLGMDGQPIPGLF
                     AAGEVSGFGGGGVHGYRALEGTFVGGCLFSGRQVGRFLAEV"
     misc_feature    408982..410625
                     /locus_tag="Bsph_0387"
                     /note="putative FAD-binding dehydrogenase; Reviewed;
                     Region: PRK12834"
                     /db_xref="CDD:183782"
     misc_feature    409039..>410073
                     /locus_tag="Bsph_0387"
                     /note="FAD binding domain; Region: FAD_binding_2;
                     pfam00890"
                     /db_xref="CDD:216176"
     gene            complement(410698..411669)
                     /gene="ybfQ"
                     /locus_tag="Bsph_0388"
                     /db_xref="GeneID:6022546"
     CDS             complement(410698..411669)
                     /gene="ybfQ"
                     /locus_tag="Bsph_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696145.1"
                     /db_xref="GI:169825987"
                     /db_xref="GeneID:6022546"
                     /translation="MTQKDYRILLYYKYVTIEDPIAFAEEHLAVCQELGLLGRILVGH
                     EGINGTVSGTIEQTDAYMNHMKADPRFSDIMWKIDEAEGHAFKKMHVRPRREIVHLGL
                     ENDINPLEITGDYLSPKEFMEQMQEENTIIIDARNDYEYDLGHFRGAVRPDIENFRDL
                     PAWMETHKEEFTDKKILTYCTGGIRCEKFSGWLKREGYGKSVGQLHGGIATYAKDSEV
                     KGQLWDGQMFVFDRRRSVPINQVEHIVIGKDYFTGEPSERYTNCANPECHKLMLCEEK
                     HEAFYMRSCSDECRRAKRNFFVEEHGWTVHQIEEQIARIAVVQNAKS"
     misc_feature    complement(410725..411663)
                     /gene="ybfQ"
                     /locus_tag="Bsph_0388"
                     /note="putative rhodanese-related sulfurtransferase;
                     Provisional; Region: PRK00142"
                     /db_xref="CDD:234663"
     misc_feature    complement(411028..411333)
                     /gene="ybfQ"
                     /locus_tag="Bsph_0388"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily. This CD includes Escherichia coli YceA,
                     Bacillus subtilis YbfQ, and similar uncharacterized
                     proteins; Region: RHOD_YceA; cd01518"
                     /db_xref="CDD:238776"
     misc_feature    complement(411130..411132)
                     /gene="ybfQ"
                     /locus_tag="Bsph_0388"
                     /note="active site residue [active]"
                     /db_xref="CDD:238776"
     gene            411803..412591
                     /locus_tag="Bsph_0389"
                     /db_xref="GeneID:6022547"
     CDS             411803..412591
                     /locus_tag="Bsph_0389"
                     /EC_number="4.2.1.17"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_001696146.1"
                     /db_xref="GI:169825988"
                     /db_xref="GeneID:6022547"
                     /translation="MEMEFSTITVEKLDRRATLTLNRPQAMNAMDDVMMRELAECFEA
                     LQQEKDIQVLVIRGEGKVFSAGGDIKTMLDSTKPLNIDEAMGYLTRIVKAYYQLPMIV
                     IAAVHGASAGLGFSLTLGADIVVACENSKLAMNFIGIGLIPDGGGHFFMKERVGTVKA
                     KQMIWEGKVLTANEALDAGLIDYMAPDGTVFAMADQLVGKMLASPISSMITTKNILHA
                     QNLPQLENILALEAEGQSTMRKTTDHIEGIHAFVEKRTPVFVGK"
     misc_feature    411803..412588
                     /locus_tag="Bsph_0389"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK07659"
                     /db_xref="CDD:236073"
     misc_feature    411824..412405
                     /locus_tag="Bsph_0389"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(411881..411883,411887..411889,411983..411985,
                     411995..412009,412127..412129,412133..412141,
                     412205..412210,412217..412219)
                     /locus_tag="Bsph_0389"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(412001..412003,412139..412141)
                     /locus_tag="Bsph_0389"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(412079..412081,412103..412105,412166..412177,
                     412211..412222,412238..412240,412244..412252,
                     412256..412261,412274..412279,412283..412288,
                     412292..412297,412304..412306,412337..412339,
                     412346..412348,412391..412393,412400..412405)
                     /locus_tag="Bsph_0389"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(412638..412823)
                     /locus_tag="Bsph_0390"
                     /db_xref="GeneID:6022787"
     CDS             complement(412638..412823)
                     /locus_tag="Bsph_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696147.1"
                     /db_xref="GI:169825989"
                     /db_xref="GeneID:6022787"
                     /translation="MENYRFTAFEKTGETLFDETWTFENDEAAKLNGQQQIEEKGVAN
                     KTHRLVNASGKLILFHV"
     misc_feature    complement(412641..412823)
                     /locus_tag="Bsph_0390"
                     /note="YhzD-like protein; Region: YhzD; pfam14120"
                     /db_xref="CDD:206289"
     gene            413092..414306
                     /locus_tag="Bsph_0391"
                     /db_xref="GeneID:6022788"
     CDS             413092..414306
                     /locus_tag="Bsph_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696148.1"
                     /db_xref="GI:169825990"
                     /db_xref="GeneID:6022788"
                     /translation="MSEIRFFHMADLHLDSPFKGLFGLPEHILKEIRSSTFDAFDKII
                     QKAIQEQPDFLLIVGDIYDGENRSLQAQRKFQDAMEKLFQHNIPVIISYGNHDHLKGT
                     WTRFSLPSNVYELPAETSVVQLKIRGQQVCIYGFSYSERHLKESVIDTFPIAQDSHAI
                     HIGMLHGSEASDTSHALYAPFTKQQLLEKNYHYWALGHIHKRQLLHENPPIVYPGNIQ
                     SRHRKEQGIKGCYDVTLSQTACELDFIPTSAIVYTTIEVDCTNIVHANELLKRCEEAI
                     AVNRTSWGAAVVELYLKNIDEQTEALFEHATVDTWLDTIREAEEGIEPMCWVQKMVLQ
                     KPSIHGEYSAATQSVVSLMEQWDSNDWKDILKDLYQYAGGARLIEPLSEKDIKNLTHN
                     AQSLLAEEIQRA"
     misc_feature    413104..413754
                     /locus_tag="Bsph_0391"
                     /note="Mre11 nuclease, N-terminal metallophosphatase
                     domain; Region: MPP_Mre11_N; cd00840"
                     /db_xref="CDD:163616"
     misc_feature    413104..413694
                     /locus_tag="Bsph_0391"
                     /note="Calcineurin-like phosphoesterase; Region:
                     Metallophos; pfam00149"
                     /db_xref="CDD:215750"
     misc_feature    order(413122..413124,413128..413130,413269..413271,
                     413374..413379,413587..413589,413683..413691)
                     /locus_tag="Bsph_0391"
                     /note="active site"
                     /db_xref="CDD:163616"
     misc_feature    order(413122..413124,413128..413130,413269..413271,
                     413374..413376,413587..413589,413683..413685,
                     413689..413691)
                     /locus_tag="Bsph_0391"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163616"
     misc_feature    order(413134..413154,413278..413280,413383..413385,
                     413389..413394,413506..413511)
                     /locus_tag="Bsph_0391"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:163616"
     gene            414306..417200
                     /locus_tag="Bsph_0392"
                     /db_xref="GeneID:6022789"
     CDS             414306..417200
                     /locus_tag="Bsph_0392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696149.1"
                     /db_xref="GI:169825991"
                     /db_xref="GeneID:6022789"
                     /translation="MHMLTIKKLQIYGFGKHENVTIPLNEGVTIFYGLNEAGKTTIQQ
                     FVLQMLFGFPTRQQTQRKYEPKASTKFGGQLTLLHPIYGSCIIERVKGKAAGDVTVYL
                     EDGTTGQEELLAKLLYGYSRASFESIFSFSLHELQGIEKMSEEELTHLLLSSGTTGIQ
                     HLSALEKKMDKEANELFKKTGKVPVINQKIEQLKQLERMIRHEQGKIQTFENKLQQLQ
                     LLEQNLEKLYATQKKQQQQWQYLTVQKQALPLIKQQQMLQQALGNDPHVQFPAEGVRR
                     YEQVKDRLLHESQQLLQLKEQYQLLQDKVLATVNEQTVNEMGRLMQKEATWHQLIVKE
                     KNLRDDLFMLEQEIDAQFRLLGVQEKEAQNILLGETVSLQQEQQFQQQLKRLEEAEDE
                     LKFHLHSLEQVHQALDAITQQKQRLKQESLTKEEEHILAQWPQQKRRLEQLRAAKSQR
                     TKQRQPNYFSLMILLIGLLSFVYGIFQKNVAVAIIGAILTIITIWLIKFVRPATETSD
                     KENSHLLRQLEQDEMTVQTILLKKQRLEDRWLHVHEQQSEKEQQYAQLEYKIQQAELE
                     SEETTQSLQQFLKRYRLQGTIARTLMPELFMRIRSVQELAVKREGSISLLQEVQDEKN
                     SLYEQLQLVLNENYNEHEIYMYLRTAYLDAQQQQQQVQQAQAQLADIKIKLQSGQTRI
                     DRYTADMMQLLNEAEVQNEQAFYERYEQFEHQRKIMTELQTVQAQIASLDLSENVGLK
                     EDSVIEDMRVLEQEQASLQMDIDRCLEHRAALQIEKEQLLNDEKYGQLLQEFEQEKSE
                     LQQMIEHWATKKAVATAIHETLFRLREEKLPHVLSKVNAIFQLLTGGRYVQLTIHDEG
                     YFMAQDVAGIRYQMVELSQATKEQAYIALRLALAQTLITSAPFPIIMDDPFVHFDRNR
                     TDKMVQLMKEVGYERQILYFTCHDEMLKHWPKEQIIDVGALANERGVAST"
     misc_feature    414321..>414536
                     /locus_tag="Bsph_0392"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:247755"
     misc_feature    414402..414425
                     /locus_tag="Bsph_0392"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(414411..414416,414420..414428)
                     /locus_tag="Bsph_0392"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    <415470..417170
                     /locus_tag="Bsph_0392"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4717"
                     /db_xref="CDD:227061"
     misc_feature    <416796..417131
                     /locus_tag="Bsph_0392"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:247755"
     misc_feature    416877..416888
                     /locus_tag="Bsph_0392"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    416922..416951
                     /locus_tag="Bsph_0392"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(417000..417002,417006..417020)
                     /locus_tag="Bsph_0392"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    417027..417038
                     /locus_tag="Bsph_0392"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(417099..417110,417114..417122)
                     /locus_tag="Bsph_0392"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            417197..418135
                     /locus_tag="Bsph_0393"
                     /db_xref="GeneID:6022790"
     CDS             417197..418135
                     /locus_tag="Bsph_0393"
                     /EC_number="3.1.-.-"
                     /note="catalyzes the exonucleic cleavage of mRNA yielding
                     nucleioside 5'-phosphates"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exoribonuclease"
                     /protein_id="YP_001696150.1"
                     /db_xref="GI:169825992"
                     /db_xref="GeneID:6022790"
                     /translation="MKGITTLQVGESVDQYLLIKQATKGVTTVGKPFMSLILQDKSGD
                     IEAKLWDTNEDHEKMYHAEAIVRVGGEIHDYRGKNQLRIKAIRVAKPEEGVAIHDLVP
                     SSATPKEQLFEELNQFFFDIKNPNISRITRAAIKKHQDAILVFPAATKNHHDYASGLL
                     DHMVSMLKLGKAIADLYPTLNRDLLYAGIILHDIGKVVELSGPVATTYTVEGNLLGHI
                     TIMVNEIAKIANELEIEGEEVMLLQHMVLSHHGKEEWGSPKKPMVQEAEILHYIDNID
                     AKMNMLTRALGKTAPGEFTERLFPLDNRSFYKPTID"
     misc_feature    417197..418132
                     /locus_tag="Bsph_0393"
                     /note="3'-5' exoribonuclease YhaM; Provisional; Region:
                     PRK13480"
                     /db_xref="CDD:237394"
     misc_feature    417236..417481
                     /locus_tag="Bsph_0393"
                     /note="YhaM_OBF_like: A subfamily of OB folds similar to
                     that found in Bacillus subtilis YhaM and Staphylococcus
                     aureus cmp-binding factor-1 (SaCBF1). Both these proteins
                     are 3'-to-5'exoribonucleases. YhaM requires Mn2+ or Co2+
                     for activity and is...; Region: YhaM_OBF_like; cd04492"
                     /db_xref="CDD:239938"
     misc_feature    order(417236..417238,417389..417391,417395..417397,
                     417401..417403,417455..417457)
                     /locus_tag="Bsph_0393"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239938"
     misc_feature    order(417251..417259,417299..417310,417314..417316,
                     417332..417340,417344..417346,417386..417388,
                     417407..417415,417434..417442)
                     /locus_tag="Bsph_0393"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239938"
     misc_feature    417668..418042
                     /locus_tag="Bsph_0393"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(417680..417682,417770..417775,418013..418015)
                     /locus_tag="Bsph_0393"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    417773..417775
                     /locus_tag="Bsph_0393"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            418670..418825
                     /locus_tag="Bsph_0394"
                     /db_xref="GeneID:6022791"
     CDS             418670..418825
                     /locus_tag="Bsph_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696151.1"
                     /db_xref="GI:169825993"
                     /db_xref="GeneID:6022791"
                     /translation="MFSTVLVLGVIFTWLASAEGIIAPENKKVVVAKILANNFPFFIN
                     ETTPYNI"
     gene            complement(419502..420461)
                     /gene="prsA"
                     /locus_tag="Bsph_0395"
                     /db_xref="GeneID:6023219"
     CDS             complement(419502..420461)
                     /gene="prsA"
                     /locus_tag="Bsph_0395"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="foldase prsA 1"
                     /protein_id="YP_001696152.1"
                     /db_xref="GI:169825994"
                     /db_xref="GeneID:6023219"
                     /translation="MKKTVLSLTLAASVLALGACSGGDSKAIVTSKVGDISVADFNEK
                     AKSLTGPYVLQQMVTEKVLSDKYEVTDKEFKEAYDVTASQFGDSFSQALAESGLTEEG
                     FKDSLRVQLLQEKALKDQAIKEEDVKKYYEQMKTELNGRHILVADEKTAKEVIAKIKG
                     GAKFADVAKEYSTDTGSAEKGGELGWFSVGSMVDEFNDAAYALELNTLSEPVQTSFGY
                     HVIEITDKRDVKDVGSFKDEEENIRTAMLGKLKQTGEDQVILKDIIAKMAKDANVRTP
                     DKNLKQSLEFFTTTSEEQAKATEEAAKKAESEDKAEDTDKESN"
     misc_feature    complement(419604..420395)
                     /gene="prsA"
                     /locus_tag="Bsph_0395"
                     /note="peptidylprolyl isomerase; Reviewed; Region: prsA;
                     PRK02998"
                     /db_xref="CDD:179522"
     misc_feature    complement(419787..420038)
                     /gene="prsA"
                     /locus_tag="Bsph_0395"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:216038"
     gene            complement(420888..421016)
                     /locus_tag="Bsph_0396"
                     /db_xref="GeneID:6023220"
     CDS             complement(420888..421016)
                     /locus_tag="Bsph_0396"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696153.1"
                     /db_xref="GI:169825995"
                     /db_xref="GeneID:6023220"
                     /translation="MTYALCMRREIPEENQPKIFRTINILITILLVSFYIEILYAV"
     gene            complement(421144..421689)
                     /locus_tag="Bsph_0397"
                     /db_xref="GeneID:6023221"
     CDS             complement(421144..421689)
                     /locus_tag="Bsph_0397"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696154.1"
                     /db_xref="GI:169825996"
                     /db_xref="GeneID:6023221"
                     /translation="MHCWKILNLEHHYGTTRIIIMGVITFLSVFSVSYVTFNLFNEEH
                     YTDHLFWLFVIAVLTLYPVHKFLHFLALYDLRQHLKLRVRTQFYLIPVVHMRIHEPLS
                     KNRYILALLTPFIVLNTSIIIGTWLLPAYTHYGTLLLAYHCSLCLIDILYVKYLLNSP
                     KNSQIEETPKGYEILVPPTVH"
     misc_feature    complement(421192..421527)
                     /locus_tag="Bsph_0397"
                     /note="Protein of unknown function (DUF3267); Region:
                     DUF3267; pfam11667"
                     /db_xref="CDD:221162"
     gene            complement(421865..422425)
                     /locus_tag="Bsph_0398"
                     /db_xref="GeneID:6023222"
     CDS             complement(421865..422425)
                     /locus_tag="Bsph_0398"
                     /note="hpr; ScoC; MarR family; protease production
                     regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator Hpr"
                     /protein_id="YP_001696155.1"
                     /db_xref="GI:169825997"
                     /db_xref="GeneID:6023222"
                     /translation="MVLSEELYTQKEAMLYSQRIAQLSKALWKAVEKDWQQWIKPYDL
                     NINEHHILWISYHLKGASISDVAKFGVMHVSTAFNFSKKLEERGFLKFSKRDDDKRNT
                     YVELTEAGTELIVEMNKNYHNTYHSVLEGSLALKDLYGRFPDFLDVMAVIRNIYGEDF
                     IDIFERSFQHFRDSFDTLEERPTVKG"
     misc_feature    complement(421868..422416)
                     /locus_tag="Bsph_0398"
                     /note="transcriptional regulator Hpr; Provisional; Region:
                     PRK13777"
                     /db_xref="CDD:237501"
     misc_feature    complement(422120..422296)
                     /locus_tag="Bsph_0398"
                     /note="MarR family; Region: MarR; pfam01047"
                     /db_xref="CDD:201571"
     gene            complement(422583..422915)
                     /locus_tag="Bsph_0399"
                     /db_xref="GeneID:6023223"
     CDS             complement(422583..422915)
                     /locus_tag="Bsph_0399"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696156.1"
                     /db_xref="GI:169825998"
                     /db_xref="GeneID:6023223"
                     /translation="MFSTPQSGQQLRTTLKQNVDQTKGMLLDVKQQVGTVKHSVNTLT
                     NEVKNNIPQIINDLKQTITTFSEEIEPNKNNLQQELDALQNSISEIEKNIAQFTENKE
                     KPQKKISD"
     misc_feature    complement(422631..422915)
                     /locus_tag="Bsph_0399"
                     /note="YtxH-like protein; Region: YtxH; cl02079"
                     /db_xref="CDD:242868"
     gene            complement(422870..423001)
                     /locus_tag="Bsph_0400"
                     /db_xref="GeneID:6023348"
     CDS             complement(422870..423001)
                     /locus_tag="Bsph_0400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696157.1"
                     /db_xref="GI:169825999"
                     /db_xref="GeneID:6023348"
                     /translation="MTRNEVYIMKAKPFLIGLATGIIGGTAAVCSQLHNQASSYVQL"
     gene            complement(423109..423324)
                     /locus_tag="Bsph_0401"
                     /db_xref="GeneID:6023349"
     CDS             complement(423109..423324)
                     /locus_tag="Bsph_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696158.1"
                     /db_xref="GI:169826000"
                     /db_xref="GeneID:6023349"
                     /translation="MGEGTILSGTVFLAAALCVFNANVGATFTMLFIGVVLPAVAFNV
                     VAFAIIYPIVAKLVKRSKFVTAISQIS"
     gene            complement(423326..423622)
                     /locus_tag="Bsph_0402"
                     /db_xref="GeneID:6023350"
     CDS             complement(423326..423622)
                     /locus_tag="Bsph_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan transport protein"
                     /protein_id="YP_001696159.1"
                     /db_xref="GI:169826001"
                     /db_xref="GeneID:6023350"
                     /translation="MALLVGIGAALYVVTPGMINGMKPDFMLTMMFIGILLFPTVKET
                     FLLSLATGVLSGLFTTFPAGLVPNIIDKAVTGFVFLAAVVILKRIAKMSGVSAI"
     gene            complement(423795..424208)
                     /locus_tag="Bsph_0403"
                     /db_xref="GeneID:6023351"
     CDS             complement(423795..424208)
                     /locus_tag="Bsph_0403"
                     /codon_start=1
                     /transl_table=11
                     /product="protein hit"
                     /protein_id="YP_001696160.1"
                     /db_xref="GI:169826002"
                     /db_xref="GeneID:6023351"
                     /translation="MSDCLFCKIIDGSIPSTKVYEDEHVYAFTDISPVAKGHTLLIPK
                     HHCQDLYEMPEDVARNLYAVAPKIANAIKAAFEPIGLNTINNNGAAAGQTVFHYHLHF
                     IPRYDEKEGLGLVWQTQKYSPEQLADVAENIKAHL"
     misc_feature    complement(423894..424202)
                     /locus_tag="Bsph_0403"
                     /note="HINT (histidine triad nucleotide-binding protein)
                     subgroup: Members of this CD belong to the superfamily of
                     histidine triad hydrolases that act on alpha-phosphate of
                     ribonucleotides. This subgroup includes members from all
                     three forms of cellular life; Region: HINT_subgroup;
                     cd01277"
                     /db_xref="CDD:238608"
     misc_feature    complement(order(423900..423908,423912..423914,
                     423918..423920))
                     /locus_tag="Bsph_0403"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238608"
     misc_feature    complement(423912..423914)
                     /locus_tag="Bsph_0403"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238608"
     gene            424344..425063
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /db_xref="GeneID:6023352"
     CDS             424344..425063
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter ATP-binding protein"
                     /protein_id="YP_001696161.1"
                     /db_xref="GI:169826003"
                     /db_xref="GeneID:6023352"
                     /translation="MDIQENLVIKDLSFTIEKGELVGLIGLNGAGKSTTIKHIIGTML
                     PKEGDIYLNGVTLKEDTDKYRTAFSYIPETPVLYDELTLREHLELTAMAYGIDKATLD
                     ARSEVLLKEFRMEKRLNWFPSHFSKGMRQKVMIMCAFLINPSLYIIDEPFVGLDPLGI
                     QSLLDQMDEKKKEGASILMSTHILSTAEKHCDRIILLHEGRVRAQGTMADLRQTFAMP
                     HATLDDLYIAMTKERDHEELA"
     misc_feature    424356..424949
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    424365..425033
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="ABC transporter, ATP-binding subunit, PQQ-dependent
                     alcohol dehydrogenase system; Region: PQQ_ABC_ATP;
                     TIGR03864"
                     /db_xref="CDD:188394"
     misc_feature    424419..424442
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(424428..424433,424437..424445,424560..424562,
                     424788..424793,424887..424889)
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    424551..424562
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(424608..424610,424719..424745)
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    424776..424793
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    424800..424811
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    424875..424895
                     /gene="ecsA"
                     /locus_tag="Bsph_0404"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            425083..426228
                     /locus_tag="Bsph_0405"
                     /db_xref="GeneID:6023835"
     CDS             425083..426228
                     /locus_tag="Bsph_0405"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ecsB"
                     /protein_id="YP_001696162.1"
                     /db_xref="GI:169826004"
                     /db_xref="GeneID:6023835"
                     /translation="MHYIGEVQKYMQFIFTGHIAIVLVFLIGAGGYQYSEWLKVVQTD
                     FPAEILIAVFIGILLAFSRPTTLLREPDQVYLLPLESKMSHYFSKALAWTFWSQVWIV
                     AIVYIVSIPLLKAVTDLTTIEIWSIFILVIVLKYISVRGEFSYRYSERGQMVWVDRLI
                     RAIIFAAAVYMGLQAQLLLTIVATVISIIYMIVFRKKSVGEPVPYEHFVKLEQNRMMS
                     FYRFANYFTEVPHLHGSIRRRGWMDWLYKFVPYGKKNSQKYLVFRTFVRTDDHFYLWL
                     RLTAIAGVIAAFVDIPIVTWIVAGALSFATTIQLKQALLSSGEFRMDMLFPLPDNARQ
                     LAVKQIVRLAMVTQAIIVGLCAITQPMFYIVVVIVLVISELTAKVSK"
     misc_feature    425086..426153
                     /locus_tag="Bsph_0405"
                     /note="Bacterial ABC transporter protein EcsB; Region:
                     EcsB; pfam05975"
                     /db_xref="CDD:218835"
     gene            complement(426287..426802)
                     /locus_tag="Bsph_0406"
                     /db_xref="GeneID:6023836"
     CDS             complement(426287..426802)
                     /locus_tag="Bsph_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696163.1"
                     /db_xref="GI:169826005"
                     /db_xref="GeneID:6023836"
                     /translation="MNIYLTSGTGDFLEQLKNKYPNEHMILIHGEGNSVLIHETEGKS
                     VFATPRKFEVLDSVNELEEHGFFVLNNIPVTDEGRPVFEHRFLQRSHAIEDEPGFESY
                     RLLRPIKSDTYIVMTQWHGPHSFEAWKSSKAFEKAHAKRDDSTGVNQQNIFSAASYVT
                     TYSAMPKEQSE"
     misc_feature    complement(<426371..426610)
                     /locus_tag="Bsph_0406"
                     /note="Uncharacterized enzyme involved in biosynthesis of
                     extracellular polysaccharides [General function prediction
                     only]; Region: COG2329"
                     /db_xref="CDD:225209"
     gene            complement(426954..427085)
                     /locus_tag="Bsph_0407"
                     /db_xref="GeneID:6023837"
     CDS             complement(426954..427085)
                     /locus_tag="Bsph_0407"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696164.1"
                     /db_xref="GI:169826006"
                     /db_xref="GeneID:6023837"
                     /translation="MGLPLSIAERVFCILSIVLVQKTFAESRKKCIIYSIIIDIRFQ"
     gene            427182..428270
                     /gene="hemE"
                     /locus_tag="Bsph_0408"
                     /db_xref="GeneID:6023838"
     CDS             427182..428270
                     /gene="hemE"
                     /locus_tag="Bsph_0408"
                     /EC_number="4.1.1.37"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_001696165.1"
                     /db_xref="GI:169826007"
                     /db_xref="GeneID:6023838"
                     /translation="MDSNEFIEGKELFMTTFNDTLLRAARGEKTTHTPVWYMRQAGRS
                     QAEYRAIKEKYSLEEITHQPELCAYVTRLPVENYNVDAAILYKDIVTPLPGIGIDVKI
                     KAGVGPVISNPIRSVADVDNLGEFNAKEHTPFVLETIKILTEEQLNVPLIGFAGAPFT
                     LASYMIEGGPSRNYNKTKSFMVSEPQAWFALMDKLADMIIADVTAQIKAGAKAIQVFD
                     SWVGALNVEDYRVFIKPIMTRIFAELQKENVPLIQFGVGASHLAKEWNDLPIDVVGLD
                     WRLPIKEARTNGITKPVQGNLDPSLLLADWSVIEKRTKDIIDQGLEMPGHIFNLGHGV
                     FPEVDPAVLKRLTTLIHEYSAQQIQARS"
     misc_feature    427245..428237
                     /gene="hemE"
                     /locus_tag="Bsph_0408"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    order(427293..427310,427323..427325,427335..427337,
                     427350..427352,427431..427451,427485..427487,
                     427500..427502,427641..427643,427671..427673,
                     427689..427691,427830..427832,427836..427841,
                     427941..427943,428175..428177)
                     /gene="hemE"
                     /locus_tag="Bsph_0408"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(427296..427298,427308..427310,427443..427445,
                     427671..427673,427836..427838,428175..428177)
                     /gene="hemE"
                     /locus_tag="Bsph_0408"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            428418..429338
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /db_xref="GeneID:6023839"
     CDS             428418..429338
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /EC_number="4.99.1.1"
                     /note="protoheme ferro-lyase; catalyzes the insertion of a
                     ferrous ion into protoporphyrin IX to form protoheme;
                     involved in protoheme biosynthesis; in some organisms this
                     protein is membrane-associated while in others it is
                     cytosolic"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_001696166.1"
                     /db_xref="GI:169826008"
                     /db_xref="GeneID:6023839"
                     /translation="MKEVKGLLVMAYGTPYKEEDIEPYYTHIRHGRKPSEEHLEDLRS
                     RYEAIGGLSPLAAATQAQAEALCSRLNEVQDTVEYKLFIGLKHIHPFIEDAIEQMVAE
                     GIKEAVSIVLAPHFSTFSIKSYNGRAVEAAGDRLTITSVESWYDEPKFIEYWKQQVND
                     TFKSMSEEERETACLIVSAHSLPEKIKDLGDPYEDQLIETARLIQEATDLKNVEVGWQ
                     SAGQTPEPWIGPDVQDLTRELYEEKGFRSFVYTPVGFVTEHLEVLYDNDFECKVVCDE
                     LGAKYYRPSMPNTHPLFIDAMVDAIYKKLS"
     misc_feature    428418..429335
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="ferrochelatase; Provisional; Region: PRK12435"
                     /db_xref="CDD:183526"
     misc_feature    428430..428858
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    order(428448..428450,428550..428552,428562..428564,
                     428589..428591,428601..428603,428751..428753,
                     428760..428771,428844..428846,428850..428852)
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    order(428451..428453,428487..428489,428499..428507,
                     428772..428777)
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    428901..429281
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    order(428955..428957,428970..428972,429096..429098,
                     429198..429200)
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    order(428988..428996,429003..429005,429015..429017,
                     429177..429179,429183..429191,429195..429197,
                     429207..429209,429279..429281)
                     /gene="hemH"
                     /locus_tag="Bsph_0409"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            429353..430774
                     /locus_tag="Bsph_0410"
                     /db_xref="GeneID:6024747"
     CDS             429353..430774
                     /locus_tag="Bsph_0410"
                     /EC_number="1.3.3.4"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_001696167.1"
                     /db_xref="GI:169826009"
                     /db_xref="GeneID:6024747"
                     /translation="MMLVTQKRRKVVVVGGGITGLTAAFYMQKQASTKELPLDIVLVE
                     SSLRLGGKIQTLRKDGFIIERGPESFFDRENYVNALAKDLGIEQKIMTSNAGPNYVAV
                     GSQLYPIPSHLLSGETPHISSFITSGLFSLSGKVRAAGDFFIPRSVQDDDQPLGSFFR
                     RRFGAEVVENLVEPLLAGTFAGDIEQLSMSSTFPQLYHLEQKYRSLLVGMKKAGTNFL
                     SNDVIDENKGIFQTFSNGLETLIESIEESLLPGTVMKGVKVEEIEHGKDGSVHVMLNN
                     FTHIKADAVIIATPFNMADKMFSKYNLLNELGTMKAATIATVTMAFKKEQLGDLDALS
                     FYVSRNSDFSITSCTWMNRKWPGTTPDDYVLLRSYIGRVGDEAIVALSDTEIEKTVLQ
                     DLNKTISIDGEPVTTVVTRWRNAMPQYTVGHEAKVQRIKQELREHFPTVKLAGSSFEG
                     ISIPECVQQGKHVAEEVLAEIFC"
     misc_feature    429404..430762
                     /locus_tag="Bsph_0410"
                     /note="protoporphyrinogen oxidase; Reviewed; Region:
                     PRK11883"
                     /db_xref="CDD:237009"
     misc_feature    429404..429604
                     /locus_tag="Bsph_0410"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:205628"
     gene            complement(430914..434342)
                     /locus_tag="Bsph_0411"
                     /db_xref="GeneID:6024748"
     CDS             complement(430914..434342)
                     /locus_tag="Bsph_0411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696168.1"
                     /db_xref="GI:169826010"
                     /db_xref="GeneID:6024748"
                     /translation="MLLGLLGLSGATGATGVTGVTGVTGVTGVTGVTGVTGVTGVTGV
                     TGVTGVTGVTGVTGVTGVTGVTGVTGVTGSYWRYWRYWRYWRTGVTGATGVTGSTGAT
                     GSTGATGIAGVTGSTGATGVTGITGSTGATGTTGATGAIGVTGATGATGVTGATGATG
                     AIGVTGATGATGVTGSTGIAGVTGSTGATGVTGVTGSTGVTGATGSTGVTGTTGSTGT
                     TGVTGTTGATGSTGVTGATGATGDIGATGSTGSTGATGVTGVTGATGFTGATGVTGAT
                     GATGATGATGATGSTGATGVTGSTGAAGVTGATGATGFTGSTGVTGSTGVTGATGNIG
                     PTGATGAAGIAGVTGATGATGFTGSTGITGSTGATGIAGVTGATGVTGATGVTGSTGA
                     TGIAGVTGATGSTGASGDIGPTGATGVTGVTGATGVTGTTGATGVTGATGNIGPTGAT
                     GAAGIAGVTGATGSTGATGDIGPTGATGVTGVTGATGVTGTTGSTGIAGVTGTTGATG
                     VTGATGNIGPTGATGVAGIAGVTGATGSTGATGDIGPTGATGAIGVTGATGAAGIAGV
                     TGATGSTGATGDVGPTGAIGVTGATGPTGAAGIAGVTGATGFTGSIGVTGSTGATGAA
                     GIAGVTGATGSTGATGDIGPTGATGVTGVTGATGVTGTTGATGATGATGVTGVTGTTG
                     STGSTGTTGVTGVTGATGVTGTTGATGIAGVTGATGVTGSTGVTGATGATGDIGPTGA
                     TGATGIAGVTGASGSTGATGVTGATGVTGATGATGDIGPTGATGIAGVTGTTGATGST
                     GATGDIGPTGATGATGATGFTGATGATGATGATGATGATGAAGIAGVTGATGSTGDIG
                     PTGATGVTGATGATGAIGVTGATGATGIAGVTGPTGATGATGATGSTGATGSTGVTGA
                     TGATGDIGPTGATGATGATGVTGVTGATGATGATGVTGATGATGATGATGATGATGAT
                     GPTGATGFTGPAFTEGFSAFKNTLTVSGSTSITNWSVASPYFTTPAFNPTTGIFTVPT
                     TGRYSFEATINYSTTAAISVTLGAGINPSFAIRQNATTNLISGLFPVLNVNVALVLTL
                     RAVLGNGTITLAGEVNLNAGDTIDLFYEANGLTISLILGGANSGGIVWSCHRIS"
     gene            434499..434732
                     /locus_tag="Bsph_0412"
                     /db_xref="GeneID:6024749"
     CDS             434499..434732
                     /locus_tag="Bsph_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696169.1"
                     /db_xref="GI:169826011"
                     /db_xref="GeneID:6024749"
                     /translation="MAPVEPVTPVTPVTPVAPVAPVAPVAPVAPVAPVLPVAPVMPPV
                     VPVGFTGQTGQLGIGPVLQQQGKELHLLHTCFK"
     gene            complement(434918..435982)
                     /locus_tag="Bsph_0413"
                     /db_xref="GeneID:6024750"
     CDS             complement(434918..435982)
                     /locus_tag="Bsph_0413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696170.1"
                     /db_xref="GI:169826012"
                     /db_xref="GeneID:6024750"
                     /translation="MIVKNEEEVIGRCLESVKGLVDEINIVDTGSTDRTKQIVAQFTD
                     RIFDFEWIHHFAAARNYSFQQATMDYILWLDADDVFLEEDQEKFKALKNSLSATIDAV
                     SMNYNLSFDSEGNVDALIRRNRLVKKDKNFQWIGAVHEYLEVGGTLLDSDIAVSHLPL
                     THDHSRNITIYKTLVESGKTLSPRDTFYFANELLDHGQFEEAIYYYELFLTSKLGWVE
                     DNIRACFKLADCYSNLNDPENNFSSILRSFEYDVPRPEACCRLGYHFMEQYKNYQAIF
                     WYEQALIIKQNPNAPFQNKSFSTWLPHLQLCVLFDRLQEYELANAHNELAGSFIPNDA
                     KVLHNKKYFQQILKSNQTDS"
     misc_feature    complement(435332..435982)
                     /locus_tag="Bsph_0413"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    complement(<435710..435982)
                     /locus_tag="Bsph_0413"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(order(435752..435754,435758..435760))
                     /locus_tag="Bsph_0413"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     misc_feature    complement(435122..435424)
                     /locus_tag="Bsph_0413"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(435179..435184,435191..435196,
                     435203..435208,435284..435289,435296..435301,
                     435305..435310,435407..435412,435419..435424))
                     /locus_tag="Bsph_0413"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(435140..435142,435149..435151,
                     435161..435163,435197..435199,435251..435253,
                     435260..435262,435299..435301,435356..435358,
                     435365..435367,435377..435379,435413..435415))
                     /locus_tag="Bsph_0413"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            436158..437150
                     /locus_tag="Bsph_0414"
                     /db_xref="GeneID:6024751"
     CDS             436158..437150
                     /locus_tag="Bsph_0414"
                     /codon_start=1
                     /transl_table=11
                     /product="surface antigen"
                     /protein_id="YP_001696171.1"
                     /db_xref="GI:169826013"
                     /db_xref="GeneID:6024751"
                     /translation="MKYSKGAEVITLKKWAFFIFSLLQIIWLAGCTEKSYESIERDRN
                     FIASLNIQEPSLDFIDENGHVLAKWLFDKAYSGATLLGDDQVLLYGHQLNTIDVYTLS
                     TGEKLYSQKVEVGTTNVYYDNNIKQFFITNSKTNTVTSFDHEGNMLASQRIGNYPMSM
                     ASYKDKLYVINFKDTKLSVLNMKDLQIEQEWPIQKSSHGIAIIDEIDELWIGGHGEGS
                     KPNSSVKKYDLNSGQLHGEINMPLMPVGLKKTKDAVLVVSHGHNELYVADFDGHIKWQ
                     QEVGANPFVVNQFKDYIVVAGYDDHKLHFIKDGQTEKTVDVGKGAFQLLVREEK"
     misc_feature    436335..437123
                     /locus_tag="Bsph_0414"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:245660"
     misc_feature    order(436356..436358,436362..436364,436455..436457,
                     436464..436472,436479..436481,436575..436577,
                     436581..436583,436590..436592,436599..436604,
                     436611..436613,436692..436694,436698..436700,
                     436707..436715,436716..436718,436833..436835,
                     436839..436841,436848..436856,436953..436955,
                     436959..436961,436965..436973,436980..436982,
                     437070..437072,437076..437078,437079..437087,
                     437094..437096)
                     /locus_tag="Bsph_0414"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199833"
     misc_feature    order(436374..436376,436389..436391,436500..436502,
                     436551..436556,436653..436655,436809..436811)
                     /locus_tag="Bsph_0414"
                     /note="active site"
                     /db_xref="CDD:199833"
     gene            437147..437833
                     /locus_tag="Bsph_0415"
                     /db_xref="GeneID:6023309"
     CDS             437147..437833
                     /locus_tag="Bsph_0415"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="YP_001696172.1"
                     /db_xref="GI:169826014"
                     /db_xref="GeneID:6023309"
                     /translation="MMTTVLIVDDEQDMRNLIEMMLNNSDIETYTAASGTEAYDIIVR
                     EKIDLVLLDVMMPHEDGFVVCQSIRAMSNVPIIFLTARDANEDKVKGLTLGGDDYIVK
                     PFTHDELAARIYAVLRRSGANIAELQQKYVVFGPIKIDEIARKVSVHGKSIPLTLKEF
                     ELLHLFMKNPGNAYTREQLLERIWDIDYVGGTRTVDTHIKTLRIKLGKEAAAHIQTVW
                     GVGYRFDPGE"
     misc_feature    437159..437824
                     /locus_tag="Bsph_0415"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    437162..437497
                     /locus_tag="Bsph_0415"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(437171..437176,437303..437305,437327..437329,
                     437384..437386,437441..437443,437450..437455)
                     /locus_tag="Bsph_0415"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    437303..437305
                     /locus_tag="Bsph_0415"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(437312..437317,437321..437329)
                     /locus_tag="Bsph_0415"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    437450..437458
                     /locus_tag="Bsph_0415"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    437540..437818
                     /locus_tag="Bsph_0415"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(437612..437614,437669..437674,437726..437728,
                     437735..437737,437759..437764,437792..437794,
                     437807..437809)
                     /locus_tag="Bsph_0415"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            437830..439218
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /db_xref="GeneID:6023310"
     CDS             437830..439218
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_001696173.1"
                     /db_xref="GI:169826015"
                     /db_xref="GeneID:6023310"
                     /translation="MKKIATRIWLLIFAFLIITVVFMYVLTNFLYQRLYVQDTEDTMV
                     EVGLKLQTMYNNGKVTDEFIADIERFNDYSNLNIFAVRNPRELSACVPFDIDYETLIG
                     PEERQKLLSGSYVQKIGYEPRFDRQLISVVLPLVDQNRLEGIIYIYFPLAKISELANS
                     GVILLFISAFIFLMVVSYLIYKGIRHIMRPLNDLQRAVEQMSFGNYETRVPVNSRDEI
                     GKLSSTFNKMAEAIQQEDEAQKTFLATVSHELRTPISYVKGYSEAMQNGIITENQKEE
                     TIQLIVREANRMERLTNELLQLARTENEQTEIVVYPIPLGETLREVQKILTHQADKKN
                     ITLHLDVDDALIIQADEVKLKQIFINIIENAINYSYENSKVEMVAIEKNGSAQITIKD
                     YGIGIPQEDISHVTERFYRVNKARSRADGGSGLGLSIVEQLLKQLQGRLEIKSIIEKG
                     TIVKITLPLMED"
     misc_feature    438202..439215
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    438388..438531
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(438388..438393,438400..438405,438409..438414,
                     438421..438426,438430..438432,438478..438483,
                     438487..438492,438499..438504,438508..438513,
                     438520..438525)
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    438535..438729
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(438553..438555,438565..438567,438577..438579,
                     438586..438588,438598..438600,438607..438609,
                     438658..438660,438670..438672,438679..438681,
                     438691..438693,438700..438702,438712..438714)
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    438571..438573
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    438889..439200
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(438907..438909,438919..438921,438928..438930,
                     438997..438999,439003..439005,439009..439011,
                     439015..439020,439099..439110,439156..439158,
                     439162..439164,439177..439182,439186..439188)
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    438919..438921
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(439009..439011,439015..439017,439099..439101,
                     439105..439107)
                     /gene="resE"
                     /locus_tag="Bsph_0416"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            439222..439749
                     /locus_tag="Bsph_0417"
                     /db_xref="GeneID:6023311"
     CDS             439222..439749
                     /locus_tag="Bsph_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696174.1"
                     /db_xref="GI:169826016"
                     /db_xref="GeneID:6023311"
                     /translation="MKKWLFALIAVPALLVGCGENKEETLPEPEVPQIPEVEILTPKE
                     VALHETIELAAHVEQGGKNVDDAVVEFEVWESGKRDEGQMVDGKLEKDGVYKATTTFD
                     HDGVYYMYAHTTANGVHNMPKQQIIAGSPDMTQVLPEDEKSNNSMDNNMMNHGNGTSD
                     DTDQNEEKKDEKNHH"
     misc_feature    439342..439557
                     /locus_tag="Bsph_0417"
                     /note="YtkA-like; Region: YtkA; pfam13115"
                     /db_xref="CDD:221926"
     gene            439870..440442
                     /locus_tag="Bsph_0418"
                     /db_xref="GeneID:6023312"
     CDS             439870..440442
                     /locus_tag="Bsph_0418"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="YP_001696175.1"
                     /db_xref="GI:169826017"
                     /db_xref="GeneID:6023312"
                     /translation="MDRRQEILEAAAKSFTLFGYKATTMEQVAKIANVGKGTIYTFFA
                     NKEILFQEIAMSLVREMKGEADAVLDASASFMDNAHNALMKMLQFREKHLLFAKLIEE
                     EKELRTPAVKQVLLRIETEILSYVAELIQRRINKGEIRDCDAELVSYLLLKAYLAFVV
                     DWHELHGDAIPEEKILNLFKETIFRGLILT"
     misc_feature    439873..440376
                     /locus_tag="Bsph_0418"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    439888..440028
                     /locus_tag="Bsph_0418"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:201228"
     gene            440572..442761
                     /locus_tag="Bsph_0419"
                     /db_xref="GeneID:6023313"
     CDS             440572..442761
                     /locus_tag="Bsph_0419"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696176.1"
                     /db_xref="GI:169826018"
                     /db_xref="GeneID:6023313"
                     /translation="MIKAEWLKIFKTRKMLVSIIAVLFIPVMYAGMFLWAFWDPYAGL
                     PNLPVAVVNEDTGAEMDDVKLDLGDTLVDKLIDSEQFNFIEVSKEEAEKGLNSRDYYM
                     ILEIPTNFSEHATTLLDDKPSKLVMNYIPNEGLNFLGAQIGETAMDRVRAEVNSQVSA
                     TYAEKLFDSIATLGDGFTEAADGSNKLDEGAQKVANGAKDLKGYLEQLASSTVELSNG
                     TDKLTKGAGDAAKGANDLSSGLVKLQDGTVQLQQGAQQAANGASSLEQGISQYTQGVA
                     KVGAGLNTLNDKQQQISAGAASIAENAGALNGAANQLTAGSAKVEAGITALSNQLQTM
                     MTSMPEEQAAALKQTLAELQAGSASVHNGLTTLSAGTEKLQAGANQVSSGAGQIAAGQ
                     AEVLAGANALTAKSNALVEGAKGLQAGNATLAAKLGELNAGVTTAVTGSKTLASGLNE
                     LANGTTTLNQGTSTLASKSGELAQGSATLADGSTELADGTSTLSGKLGEASEKANEVK
                     ANQDTYDMVGSPVEVEKESVNHVPNYGTGFAPYFISLGLFVGALLISIVFPLVEPAIR
                     PKNGASWFTSKVTVLAVVGLVQTVLTVVIVKWGLGLEVNNMGYFIVTALLTSYVFLAL
                     IQMLVSIFGDPGRFMAIVVLILQLTTSAGTFPLELIPSPLQVFNKLLPMTYTVQAFKS
                     SISTGDTSFLMQNYGVLAGFLVAFLAITFGYFMLLHNKRYSKIAEEN"
     misc_feature    440572..442758
                     /locus_tag="Bsph_0419"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG1511"
                     /db_xref="CDD:224428"
     misc_feature    440581..441072
                     /locus_tag="Bsph_0419"
                     /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
                     TIGR03061"
                     /db_xref="CDD:132105"
     misc_feature    442111..442728
                     /locus_tag="Bsph_0419"
                     /note="YhgE/Pip C-terminal domain; Region: pip_yhgE_Cterm;
                     TIGR03062"
                     /db_xref="CDD:234099"
     gene            complement(442960..443085)
                     /locus_tag="Bsph_0420"
                     /db_xref="GeneID:6023134"
     CDS             complement(442960..443085)
                     /locus_tag="Bsph_0420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696177.1"
                     /db_xref="GI:169826019"
                     /db_xref="GeneID:6023134"
                     /translation="MLENVVEFFKNLPAKQCTECGEKIEEQSECYSNTCEKCNHL"
     misc_feature    complement(442972..443082)
                     /locus_tag="Bsph_0420"
                     /note="YhfH-like protein; Region: YhfH; pfam14149"
                     /db_xref="CDD:206318"
     gene            443230..444222
                     /locus_tag="Bsph_0421"
                     /db_xref="GeneID:6023135"
     CDS             443230..444222
                     /locus_tag="Bsph_0421"
                     /EC_number="6.3.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate-protein ligase A"
                     /protein_id="YP_001696178.1"
                     /db_xref="GI:169826020"
                     /db_xref="GeneID:6023135"
                     /translation="MIFVDNKGIHDPRVNLAIEEYLLKTMDVEKEPVLLFYINQPSII
                     IGKNQNTIEEINTDYVEDNGIIVVRRLSGGGAVYHDLGNLNFSFITNDDGDSFMNYKK
                     FTQPVVDALAKMGVNAELSGRNDILAEGRKVSGNAQFSTRGRMFSHGTLMFDTEIDAV
                     VSALKVKKDKIESKGIKSIRSRVANISEFLKEKMTIEEFRLEILKSIFGGETNIRYYE
                     LTDEDWVNIHKLSAERYQTWEWNYGKSPRFNIQKTHRFPTGGIDIRLEVNHGVIEEAH
                     IFGDFFGVGDMTDIEQRLVGTNHDRTAIANALVDIDIPTYFGGISTEDFLQLIY"
     misc_feature    443230..443961
                     /locus_tag="Bsph_0421"
                     /note="Lipoate-protein ligase A [Coenzyme metabolism];
                     Region: LplA; COG0095"
                     /db_xref="CDD:223173"
     misc_feature    443236..444201
                     /locus_tag="Bsph_0421"
                     /note="lipoyltransferase and lipoate-protein ligase;
                     Region: lipoyltrans; TIGR00545"
                     /db_xref="CDD:161920"
     misc_feature    443959..444213
                     /locus_tag="Bsph_0421"
                     /note="Bacterial lipoate protein ligase C-terminus;
                     Region: Lip_prot_lig_C; pfam10437"
                     /db_xref="CDD:151014"
     gene            444323..445027
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /db_xref="GeneID:6023136"
     CDS             444323..445027
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696179.1"
                     /db_xref="GI:169826021"
                     /db_xref="GeneID:6023136"
                     /translation="MEKHRIFIVEDDVKIASLLAETLRKYQYEVETIQEFDHLIEEFT
                     AFNPHMVLLDINLPSYDGYYWCRQLRQHTTCPIIFISARSGEMDQIFALENGGDDFIT
                     KPFNYEIVLAKIRSHLRRTYGEYATRQEERTIKQGQLILHLERMELHKNELEIPLQKK
                     ECIILELLMGNAPKVVTREQLLEELWDDQAFVDENTLNVNMTRVRKKLADYHISSTIE
                     TVRGAGYRFILSAGEL"
     misc_feature    444332..445003
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    444341..444676
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(444350..444355,444482..444484,444506..444508,
                     444563..444565,444620..444622,444629..444634)
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    444482..444484
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(444491..444496,444500..444508)
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    444629..444637
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    444722..445003
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(444794..444796,444851..444856,444908..444910,
                     444917..444919,444941..444946,444977..444979,
                     444992..444994)
                     /gene="yxdJ"
                     /locus_tag="Bsph_0422"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            445204..445602
                     /locus_tag="Bsph_0423"
                     /db_xref="GeneID:6023137"
     CDS             445204..445602
                     /locus_tag="Bsph_0423"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_001696180.1"
                     /db_xref="GI:169826022"
                     /db_xref="GeneID:6023137"
                     /translation="MRQRYLLKISQLPTAMEDVLQKNAKTPEAMQAEKYMHELYRLYQ
                     HELHSLYASQKRHDQFMNQWVHQMKTPISVIELLLQDDRPLDKKNVQEEIDRLRRGLD
                     MVLVNARLENFEDAYASRTGCIKDNSDCNC"
     misc_feature    445213..>445539
                     /locus_tag="Bsph_0423"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    445375..445539
                     /locus_tag="Bsph_0423"
                     /note="His Kinase A (phosphoacceptor) domain; Region:
                     HisKA; smart00388"
                     /db_xref="CDD:214644"
     misc_feature    order(445381..445383,445393..445395,445405..445407,
                     445414..445416,445426..445428,445471..445473,
                     445480..445482,445492..445494,445501..445503,
                     445513..445515)
                     /locus_tag="Bsph_0423"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    445399..445401
                     /locus_tag="Bsph_0423"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     gene            445553..446011
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /db_xref="GeneID:6023138"
     CDS             445553..446011
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_001696181.1"
                     /db_xref="GI:169826023"
                     /db_xref="GeneID:6023138"
                     /translation="MQVEQVALKTIVTATVNENKRLFITKRVFPEIHIEDDLIVASDS
                     KWLRFILGQFVTNAVKYTFEANKKIVISAIKKDDYVQLAICDEGIGIPASDLSRVTKA
                     FFTGENGRKTGESTGMGLYLAKEICEKLGHDLAISSEVGKGTIVTVTFTN"
     misc_feature    <445553..446002
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    445691..446002
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(445709..445711,445721..445723,445730..445732,
                     445802..445804,445808..445810,445814..445816,
                     445820..445825,445901..445912,445958..445960,
                     445964..445966,445979..445984,445988..445990)
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    445721..445723
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(445814..445816,445820..445822,445901..445903,
                     445907..445909)
                     /gene="yxdK"
                     /locus_tag="Bsph_0424"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            446023..446448
                     /locus_tag="Bsph_0425"
                     /db_xref="GeneID:6022973"
     CDS             446023..446448
                     /locus_tag="Bsph_0425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696182.1"
                     /db_xref="GI:169826024"
                     /db_xref="GeneID:6022973"
                     /translation="MTEVSIEGWLLNINKEKTKALYMTHLQEGDQVSYQNFVMANEVL
                     NEELLHFSNILGLNLQQPTLLQAFPVDGQQIMYSGHYTVYGEILEGEMDAWDVIIGEH
                     CFSLVAEESVLGLTEPHFQIGFEVVLQWLLPQSLELMKK"
     gene            446461..447237
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /db_xref="GeneID:6022974"
     CDS             446461..447237
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_001696183.1"
                     /db_xref="GI:169826025"
                     /db_xref="GeneID:6022974"
                     /translation="MPILQIKDVTKVYEGKVTHRALNQLSFEVEEGEFLAVMGPSGSG
                     KTTLLNIISTIDEPTSGEIILDGMNPHTLNATELAYFRRRQLGFVFQDFNLLHMLTVE
                     ENIVLPLTLDQQPLEVMEERLANIVEKLDLTPFLHKRPNEISGGQAQRTAIGRALIHN
                     PSLILADEPTGNLDSNSSRDVLELLTKVNKDKRTTIVMVTHDPIAASYCDRVLFIKDG
                     EFFNEIYRDDRRQMFFQRILNVLSLLGGGQVGDLSTIRLP"
     misc_feature    446467..447132
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    446470..447117
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    446575..446598
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(446584..446589,446593..446601,446731..446733,
                     446959..446964,447061..447063)
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    446722..446733
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    446887..446916
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    446947..446964
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    446971..446982
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    447049..447069
                     /gene="yxdL"
                     /locus_tag="Bsph_0426"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            447275..449143
                     /locus_tag="Bsph_0427"
                     /db_xref="GeneID:6022975"
     CDS             447275..449143
                     /locus_tag="Bsph_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_001696184.1"
                     /db_xref="GI:169826026"
                     /db_xref="GeneID:6022975"
                     /translation="MASFFSVAVFFIYSMLMFHPDIERGILGEVSLIGMVGAEIVLVL
                     FTLFFLYYSMSAFLEARSHEFAILLHLGMEKRQMNKLVFLETMIIGAGSIIVGIVFGF
                     SFSKFFFMIVREILHLDELPLYVSWQPFLLTIGVFTSAFVVISFISVYFTRERKLRDL
                     IKGSDYLNSLTTYSKIRAVYGIALILGTYILAFVVGHTSLIGLTLLIPFSATFGTYYF
                     FSDSVPCFLDLARGKRKFHWQRYRLLSLAEQTHIMMDNVKMFFVVTMVSTLAFLSVGV
                     LATMSSYTTQYDRLNPLGLVYKGDIDNPYEREHINSLRLQLEEKGLSYQLSRFVVIKQ
                     TSSFTQNEVEVFRESDMNVLLSSYSYPLLDLGSGEAVFIPYSEDSLKKLKNRVVHTVL
                     EENSIPITIDSVYPKIVFPGSIVSVNSIVISDEDFAKLIHPISEKNLIQPSYHLFTFV
                     IPQWMETKEVGKDIDYLESNLYFLKKDKFSPFYFENAGLNYSYILATYSLFTLVGVLV
                     ATVFLLAAGSFIYFKLHTSLEREKRKFDVLKRMGLTDIELKKLVNRHLFPQFFLPWGV
                     AMMHSAFAFLMVQGILKDIANISIVKEVFFAFGFFVLIQVVYFYLIRWRYISHIRS"
     gene            449286..450833
                     /locus_tag="Bsph_0428"
                     /db_xref="GeneID:6022976"
     CDS             449286..450833
                     /locus_tag="Bsph_0428"
                     /EC_number="6.2.1.3"
                     /note="activates fatty acids by binding to coenzyme A"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="YP_001696185.1"
                     /db_xref="GI:169826027"
                     /db_xref="GeneID:6022976"
                     /translation="MNLVSRVRQQATEQPDKVAYHFMGKDTTYGEFEQTVGRFAKGLQ
                     DLGIEKGDHVAFLLGNTPHYLIALYATMRIGATAIPVNPIYTPDEISYILHNGDVKAV
                     IALDLLLPLVEKGVQAFPQVKAFVVCETTADIAEKVAALSLKAQEKTHLFTQIVKNTS
                     QSLQPVEVADDDNAIILYTSGTTGTPKGAMLTHENVYSNARDVAHYLDIQEKDRVIAT
                     LPVFHVFALTVVVNAPLLSGATVLLAPKFSPTEIFALAREQKATVFAGVPTMYNFLYQ
                     LPEGNPEDFSTIRLAISGGASLPVALLHNFEQKFNVRVSEGYGLSEASPVTCFNPLDR
                     DRKAGSIGTSISNVENRVVDVNGQEVPVGEVGELIVRGPNVMKGYYKMPEETAMAIRD
                     GWLYTGDLAKVDDEGYFYIVDRKKDMIIVGGFNVYPREVEEVLFAHNNIVEAAVVGFP
                     DPNLGEAVHAYVVLKEVAATTTEDLLSYCGKHMVKYKVPKVIEIMDELPKNTTGKILR
                     RSLKEKV"
     misc_feature    449286..450827
                     /locus_tag="Bsph_0428"
                     /note="long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07656"
                     /db_xref="CDD:236072"
     misc_feature    449292..450821
                     /locus_tag="Bsph_0428"
                     /note="Prokaryotic long-chain fatty acid CoA synthetases
                     similar to Escherichia coli FadD; Region:
                     FC-FACS_FadD_like; cd05936"
                     /db_xref="CDD:213302"
     misc_feature    order(449811..449813,449820..449837,449841..449846)
                     /locus_tag="Bsph_0428"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(449820..449822,450165..450170,450231..450248,
                     450480..450482,450516..450518,450525..450527,
                     450558..450560,450798..450800)
                     /locus_tag="Bsph_0428"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(449820..449822,449940..449945,450084..450086,
                     450090..450095,450102..450104,450165..450170,
                     450231..450248,450480..450482,450516..450518,
                     450525..450527,450549..450560,450741..450743)
                     /locus_tag="Bsph_0428"
                     /note="putative active site [active]"
                     /db_xref="CDD:213302"
     misc_feature    order(449940..449942,450090..450095,450102..450104,
                     450165..450167,450549..450557,450723..450725,
                     450741..450743)
                     /locus_tag="Bsph_0428"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     gene            451086..451733
                     /locus_tag="Bsph_0429"
                     /db_xref="GeneID:6022977"
     CDS             451086..451733
                     /locus_tag="Bsph_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="protein dedA (protein DSG-1)"
                     /protein_id="YP_001696186.1"
                     /db_xref="GI:169826028"
                     /db_xref="GeneID:6022977"
                     /translation="MIELIKELISFIVHIDVHLEEIIRDFGNWSYLILFAIVFVETGV
                     VIFPFLPGDSLLFASGTLAAAMGAFDMWILIPVFLAAAILGDTMNYHIGHKVGTSIPP
                     KSLLGRVVKKERMEAAEKFFNTHGGKTIVIARFMPFIRTFIPFVAGASKMNYSYFLLY
                     NILGAILWVFSCTLLGYFFGNIPIIKDNFSVVLILIIFISVVPAVIGAIKAKVGK"
     misc_feature    451089..451721
                     /locus_tag="Bsph_0429"
                     /note="SNARE associated Golgi protein; Region:
                     SNARE_assoc; cl00429"
                     /db_xref="CDD:241858"
     misc_feature    451128..451730
                     /locus_tag="Bsph_0429"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            451905..453134
                     /locus_tag="Bsph_0430"
                     /db_xref="GeneID:6022001"
     CDS             451905..453134
                     /locus_tag="Bsph_0430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696187.1"
                     /db_xref="GI:169826029"
                     /db_xref="GeneID:6022001"
                     /translation="MEVFIGRQPIFNLHEQVVAYELLYRGKNVNAFPMVDSDAATIDV
                     LVNSFLSIGFEEVTKGKPGFVNFTDNLLMSSIHEFLNPSQVVIEILEDVPLTSQLVKR
                     VVELKNYGFQIALDDFIMDEQVDIYDELFEQVDFIKVDFLATSMVKRMEIENKVKGNY
                     PHIQLLAEKVETRHQFEVAKSSGYVLFQGYFFEQPQIIKATDIPANTIQYIHIISLLK
                     EEEPNIQLLAENIERDISLTYKLLQMINNSSKRSKSKVRSIKQAIVLLGISNLRKWIY
                     LLAMREIDIDADSDLFKEVMCMSLFRAKVCEKLAKLSYKKNFSEYFLVGMFSLIDTLL
                     QRPMSVILHQLPFSEDITNTILGHETDMTSFLEFSIALGKLDWARLEELSAQLNIQLN
                     DMDHLYYEAMEWAEKSF"
     misc_feature    451905..453125
                     /locus_tag="Bsph_0430"
                     /note="Predicted signal transduction protein containing
                     EAL and modified HD-GYP domains [Signal transduction
                     mechanisms]; Region: COG3434"
                     /db_xref="CDD:225968"
     misc_feature    451926..452489
                     /locus_tag="Bsph_0430"
                     /note="EAL domain; Region: EAL; pfam00563"
                     /db_xref="CDD:215995"
     gene            complement(453187..453333)
                     /locus_tag="Bsph_0431"
                     /db_xref="GeneID:6022002"
     CDS             complement(453187..453333)
                     /locus_tag="Bsph_0431"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696188.1"
                     /db_xref="GI:169826030"
                     /db_xref="GeneID:6022002"
                     /translation="MFSLTSCFISPRPLQLSEFFKDEMIIANTLHIENFILMKGLAIV
                     EDKK"
     gene            453335..454150
                     /locus_tag="Bsph_0432"
                     /db_xref="GeneID:6022003"
     CDS             453335..454150
                     /locus_tag="Bsph_0432"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696189.1"
                     /db_xref="GI:169826031"
                     /db_xref="GeneID:6022003"
                     /translation="MDYVYVIVGAAVIAIGFNVFLLPNQVASGGVSGISTILHGLFGW
                     NPGIVQYAFNIPLFIAGVLLLGKKFGIKSFIGTITLPFIVLLTNSWEPWTDNPLLGAL
                     FGGIVVGLGIGLVFKGNASTGGTDLLAQIITKYTGLTLGTSVLLIDGIIAISAAVVFD
                     LEKGLYALIGLYVTTKTIDIIQLGFSQSKMVYIITLKQDEVREAIYAEINRGVTKLQA
                     FGGYTGEARPVLMVVVYQTEFTKLKQLIKSVDPSAFVIVSDAYEVLGEGFKRA"
     misc_feature    453383..454147
                     /locus_tag="Bsph_0432"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1284"
                     /db_xref="CDD:224203"
     misc_feature    453383..453586
                     /locus_tag="Bsph_0432"
                     /note="Uncharacterized BCR, YitT family COG1284; Region:
                     DUF161; pfam02588"
                     /db_xref="CDD:217125"
     misc_feature    <453683..453868
                     /locus_tag="Bsph_0432"
                     /note="Uncharacterized BCR, YitT family COG1284; Region:
                     DUF161; pfam02588"
                     /db_xref="CDD:217125"
     misc_feature    453965..454129
                     /locus_tag="Bsph_0432"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2179); Region: DUF2179; pfam10035"
                     /db_xref="CDD:204383"
     gene            454203..454487
                     /locus_tag="Bsph_0433"
                     /db_xref="GeneID:6022004"
     CDS             454203..454487
                     /locus_tag="Bsph_0433"
                     /note="COG: Cytochrome c, mono- and diheme variants"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696190.1"
                     /db_xref="GI:169826032"
                     /db_xref="GeneID:6022004"
                     /translation="MKKAMLTLVFGSAIFLAACGGGNKEATNNEGATAPDGEAIAMKS
                     CVTCHGGELQGANGPALNDVGSRLSESEILDIINNGKGGHAWRNCKRRRC"
     misc_feature    454296..>454451
                     /locus_tag="Bsph_0433"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:205620"
     gene            454730..455581
                     /locus_tag="Bsph_0434"
                     /db_xref="GeneID:6022005"
     CDS             454730..455581
                     /locus_tag="Bsph_0434"
                     /EC_number="2.7.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase/phosphorylase"
                     /protein_id="YP_001696191.1"
                     /db_xref="GI:169826033"
                     /db_xref="GeneID:6022005"
                     /translation="MTSDISRPGLEMAGYFTHYPANRVQLLGKTELSFFEMLPTDVKL
                     ERMRLLCSQDTPAIIISRDLEVPEELIQASNEKHVPVFKTHMTTTKFSSRLTNYLEGR
                     LAPMTAAHGVLVDVYGIGILIIGKSGVGKSETALELVKKGHRLVADDCVEIRQESENL
                     LIGSPPPLLEHLLEIRGIGIIDIMTLFGASAVRPYKRITLIIELEIWDPQKVYDRLGL
                     EEEKMKIIDTELTKLTIPVRPGRNVSVIIEVAAMNYRLKKMGVNAAEEFSRRLDEVIS
                     SNDVLDD"
     misc_feature    454733..455554
                     /locus_tag="Bsph_0434"
                     /note="Hpr(Ser) kinase/phosphatase; Region: hpr-ser;
                     TIGR00679"
                     /db_xref="CDD:233088"
     misc_feature    <454733..455029
                     /locus_tag="Bsph_0434"
                     /note="HPr Serine kinase N terminus; Region: Hpr_kinase_N;
                     pfam02603"
                     /db_xref="CDD:190362"
     misc_feature    455057..455491
                     /locus_tag="Bsph_0434"
                     /note="HprK/P, the bifunctional histidine-containing
                     protein kinase/phosphatase, controls the phosphorylation
                     state of the phosphocarrier protein HPr and regulates the
                     utilization of carbon sources by gram-positive bacteria.
                     It catalyzes both the ATP-dependent...; Region: HprK_C;
                     cd01918"
                     /db_xref="CDD:238899"
     misc_feature    order(455057..455059,455108..455113,455120..455122,
                     455135..455137,455147..455149,455174..455179,
                     455183..455185,455231..455233,455249..455251,
                     455261..455269,455282..455284,455372..455380,
                     455429..455431,455462..455464,455471..455473)
                     /locus_tag="Bsph_0434"
                     /note="Hpr binding site; other site"
                     /db_xref="CDD:238899"
     misc_feature    order(455057..455059,455111..455113,455117..455125,
                     455171..455176,455249..455251,455255..455257)
                     /locus_tag="Bsph_0434"
                     /note="active site"
                     /db_xref="CDD:238899"
     misc_feature    order(455129..455131,455135..455137,455147..455152,
                     455159..455161,455231..455233,455243..455245,
                     455261..455263,455267..455275,455282..455290,
                     455426..455428,455474..455479,455483..455485)
                     /locus_tag="Bsph_0434"
                     /note="homohexamer subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238899"
     gene            455627..456448
                     /locus_tag="Bsph_0435"
                     /db_xref="GeneID:6024321"
     CDS             455627..456448
                     /locus_tag="Bsph_0435"
                     /EC_number="2.4.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="YP_001696192.1"
                     /db_xref="GI:169826034"
                     /db_xref="GeneID:6024321"
                     /translation="MDLLLLQINPIAFHLGPIPVRWYGLLIVSGIILAYVVGQREAVK
                     RGLPEDFLADLLLWAVPISIICARIYYVSMRWDYYSENPGKIIEIWNGGIAIHGALIG
                     AFVTAYIFTRIKNVSFLRVADIAAPSILIGQIIGRWGNFMNQEAYGGPVSKEFLENLM
                     LPDWIINQMYIEELGTYVHPTFLYESVWNLIGLIILLILRKVNLNRGEIFFSYLIWYS
                     IGRFYIEGMRTDSLYLVGDLRSAQIVSIIGIVVGLGAIIYRRIKVKPAMKYLDNK"
     misc_feature    455645..456442
                     /locus_tag="Bsph_0435"
                     /note="prolipoprotein diacylglyceryl transferase;
                     Reviewed; Region: PRK12437"
                     /db_xref="CDD:183527"
     gene            456462..457103
                     /locus_tag="Bsph_0436"
                     /db_xref="GeneID:6024322"
     CDS             456462..457103
                     /locus_tag="Bsph_0436"
                     /EC_number="3.6.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase ppaX"
                     /protein_id="YP_001696193.1"
                     /db_xref="GI:169826035"
                     /db_xref="GeneID:6024322"
                     /translation="MAVKALLFDFDGTLLNTNELIIQTFMHVLNERFPGQFSPKDCLK
                     FIGPSLKQTFNDIAPGEEEALIAKYRAWNIEHHDELVSQYPDVVSTLEQLKAQGIRLA
                     IVSTKRNDTIDRGLSILGATHLFDVRIGTDDVHNVKPDPEPVLLALERLGINKDDAIM
                     IGDNSHDIEAGHRAGVRAAGVAWAIKGEAYLQQFQPEYILHHMTDLLDIVKEG"
     misc_feature    456462..457091
                     /locus_tag="Bsph_0436"
                     /note="pyrophosphatase PpaX; Provisional; Region:
                     PRK13288"
                     /db_xref="CDD:237336"
     misc_feature    456474..>456857
                     /locus_tag="Bsph_0436"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl17202"
                     /db_xref="CDD:247756"
     misc_feature    456711..456968
                     /locus_tag="Bsph_0436"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    456774..456776
                     /locus_tag="Bsph_0436"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    456873..457079
                     /locus_tag="Bsph_0436"
                     /note="HAD-hyrolase-like; Region: Hydrolase_like;
                     pfam13242"
                     /db_xref="CDD:222003"
     gene            457109..457651
                     /locus_tag="Bsph_0437"
                     /db_xref="GeneID:6024323"
     CDS             457109..457651
                     /locus_tag="Bsph_0437"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_001696194.1"
                     /db_xref="GI:169826036"
                     /db_xref="GeneID:6024323"
                     /translation="MARKTERYRVEGANSLWKIYDTVSFWKVMKCFIVIQIGRFTPFL
                     RVKNWLYRTFLKMTIGEKTSLALMVMPDTMYPERIFIGDNTVIGFNTTILAHEYLIEE
                     YRLGDVRIGHEVMIGANSTILPGVTIGDGAIVSAATLVHKDVPAGCLAGGNPMQIIYT
                     AEQMAERKRHEVVQWCTPKK"
     misc_feature    457109..457582
                     /locus_tag="Bsph_0437"
                     /note="Acetyltransferase (isoleucine patch superfamily)
                     [General function prediction only]; Region: WbbJ; COG0110"
                     /db_xref="CDD:223188"
     misc_feature    457274..457582
                     /locus_tag="Bsph_0437"
                     /note="Maltose O-acyltransferase (MAT)-like: This family
                     is composed of maltose O-acetyltransferase, galactoside
                     O-acetyltransferase (GAT), xenobiotic acyltransferase
                     (XAT) and similar proteins. MAT and GAT catalyze the
                     CoA-dependent acetylation of the...; Region: LbH_MAT_like;
                     cd04647"
                     /db_xref="CDD:100053"
     misc_feature    order(457292..457294,457298..457300,457322..457324,
                     457358..457360,457364..457366,457382..457384,
                     457400..457408,457445..457447,457451..457453,
                     457460..457462,457517..457519,457565..457567)
                     /locus_tag="Bsph_0437"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100053"
     misc_feature    order(457298..457300,457304..457306,457400..457402,
                     457406..457408,457451..457453,457457..457462,
                     457475..457477,457511..457516,457529..457534,
                     457559..457564,457568..457570)
                     /locus_tag="Bsph_0437"
                     /note="active site"
                     /db_xref="CDD:100053"
     misc_feature    order(457298..457300,457304..457306,457400..457402)
                     /locus_tag="Bsph_0437"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100053"
     misc_feature    order(457400..457402,457406..457408,457451..457453,
                     457457..457462,457475..457477,457505..457507,
                     457511..457516,457529..457534,457553..457555,
                     457559..457564,457568..457570,457580..457582)
                     /locus_tag="Bsph_0437"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100053"
     gene            457917..459074
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /db_xref="GeneID:6024324"
     CDS             457917..459074
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="May allow the feedback regulation of ATP
                     phosphoribosyltransferase activity by histidine"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="YP_001696195.1"
                     /db_xref="GI:169826037"
                     /db_xref="GeneID:6024324"
                     /translation="MFEKPLGMRDTFPQIFEKVEAVRQTGRDFLTKRGYEFIKTPAVE
                     YFDTVGKASAIADTHLFKLVDSQGNTLVLRPDMTTPIARVATSKLLKEMIPQRLAYFA
                     SVFRAQEAEGGRPAEFDQMGIELIGDQSVFADAEVIVTAMELLKHLKLEAFKVTIGHA
                     GILNCILQDYTESIEQQTTLRTLLVHRNYVGFEEAVDSFNLPKAKADALLQFIEEAMD
                     VKDIRDIEKYVRKNDALVYMQQLAQLLEMADLAAYVTFDFTLSSHMSYYTGMLFEVFA
                     LGSGFPLGNGGRYDGLLEVFGSKAGATGFSIRVDRLLETLHGQSEMQQEATVVLFDEE
                     QFEAALIKVNTLRAAGKLATLQLRSSLVDEEAFLAHFTEVVVVGQEEIGSE"
     misc_feature    457917..459008
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="ATP phosphoribosyltransferase regulatory subunit;
                     Provisional; Region: hisZ; PRK12292"
                     /db_xref="CDD:237043"
     misc_feature    457965..458867
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(457974..457976,458010..458012,458025..458045,
                     458103..458108,458142..458144,458148..458150,
                     458163..458168,458175..458180,458262..458267,
                     458286..458288,458310..458312,458322..458324,
                     458331..458333,458775..458777,458826..458831)
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    458019..458045
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(458142..458144,458148..458150,458232..458234,
                     458238..458240,458259..458261,458268..458270,
                     458274..458276,458286..458288,458700..458702,
                     458706..458708,458712..458717,458760..458762,
                     458775..458777,458829..458831,458838..458840,
                     458847..458849)
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    458229..458243
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(458826..458840,458847..458849)
                     /gene="hisZ"
                     /locus_tag="Bsph_0438"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     gene            459067..459711
                     /gene="hisG"
                     /locus_tag="Bsph_0439"
                     /db_xref="GeneID:6024325"
     CDS             459067..459711
                     /gene="hisG"
                     /locus_tag="Bsph_0439"
                     /EC_number="2.4.2.17"
                     /note="short form of enzyme; requires HisZ for function;
                     catalyzes the formation of N'-5'-phosphoribosyl-ATP from
                     phosphoribosyl pyrophosphate; crucial role in histidine
                     biosynthesis; forms heteromultimer of HisG and HisZ"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="YP_001696196.1"
                     /db_xref="GI:169826038"
                     /db_xref="GeneID:6024325"
                     /translation="MNELTIAMPKGRIFEEAYQMLLKAGFHLPEEVEMSRKLMIEIPE
                     EKIRFILSKPMDVPVYVEHGVADIGIAGKDVLLEQQREVHELLDLNISNCYIASAGLP
                     NTDMNEIAPRIATKYPNIAMKYYKGIGEQVEIIELNGSIELAPMIGLADRIVDIVSTG
                     RTLKENGLVEYEFISTVSSRLIANPVSYRMKGERIIDLVRRLKKCVNEQKSNHI"
     misc_feature    459067..459696
                     /gene="hisG"
                     /locus_tag="Bsph_0439"
                     /note="ATP phosphoribosyltransferase catalytic subunit;
                     Reviewed; Region: hisG; PRK01686"
                     /db_xref="CDD:234971"
     misc_feature    459076..>459708
                     /gene="hisG"
                     /locus_tag="Bsph_0439"
                     /note="ATP phosphoribosyltransferase [Amino acid transport
                     and metabolism]; Region: HisG; COG0040"
                     /db_xref="CDD:223118"
     gene            459744..461018
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /db_xref="GeneID:6022945"
     CDS             459744..461018
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /EC_number="1.1.1.23"
                     /note="catalyzes the oxidation of L-histidinol to
                     L-histidinaldehyde and then to L-histidine in histidine
                     biosynthesis; functions as a dimer"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="YP_001696197.1"
                     /db_xref="GI:169826039"
                     /db_xref="GeneID:6022945"
                     /translation="MKITKLAKGISLKRPLEGGNEEQLKVVRQVLTDVRTQGDVALRA
                     YTERWDGYMPTSLRVTKEEIQEAVNALDQQLYQDLVEAAQNIRLYHEQQSRQGYRLEL
                     GDGSWLGQRVTALDAVGLYVPGGTAAYPSSVLMNVIPAQVAGVKRIVIASPAGLDGKM
                     PAGVLVAAQLLGIEEIYKIGGAQAIAALAYGTETIAPVDKITGPGNIFVALAKREVFG
                     EVAIDMIAGPSEIAVLADDTAFPDEIAADLLSQAEHDRLACAVLVTTSEKLAKKVAEE
                     VEKQLEILPRQEVARASIENFGVIYIAETVSDAVEAINSLAPEHLEIMTNNAEAIAEQ
                     IRHAGGIFIGRYSSEPVGDYFAGTNHVLPTNSTARFASGLNVDDFVKKSSVVYYSEKT
                     WQEHAPKIARLARMEGLEGHARAVESRGWKKE"
     misc_feature    459813..460979
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="Histidinol dehydrogenase, HisD, E.C 1.1.1.23.
                     Histidinol dehydrogenase catalyzes the last two steps in
                     the L-histidine biosynthesis pathway, which is conserved
                     in bacteria, archaea, fungi, and plants. These last two
                     steps are (i) the NAD-dependent...; Region: Histidinol_dh;
                     cd06572"
                     /db_xref="CDD:119329"
     misc_feature    459822..461000
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="histidinol dehydrogenase; Region: hisD; TIGR00069"
                     /db_xref="CDD:232808"
     misc_feature    order(459888..459890,460104..460106,460110..460115,
                     460137..460139,460200..460202,460281..460286,
                     460290..460292,460353..460361,460365..460370,
                     460503..460505)
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(459963..459968,459975..459980,459984..459986,
                     459993..459998,460005..460010,460017..460022,
                     460041..460043,460047..460049,460059..460073,
                     460080..460082,460086..460088,460122..460136,
                     460338..460340,460383..460385,460395..460397,
                     460467..460472,460479..460484,460488..460496,
                     460500..460505,460713..460715,460728..460730,
                     460737..460742,460746..460772,460776..460778,
                     460782..460787,460791..460805,460809..460811,
                     460815..460817,460845..460850,460854..460868,
                     460872..460877,460884..460907,460950..460955,
                     460959..460979)
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(460128..460130,460134..460136,460428..460430,
                     460503..460505,460698..460703,460788..460790,
                     460800..460805,460821..460823,460962..460964,
                     460968..460970,460977..460979)
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="product binding site; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(460134..460136,460428..460430,460494..460496,
                     460503..460505,460698..460703,460788..460790,
                     460800..460805,460821..460823,460962..460964,
                     460968..460970,460977..460979)
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(460494..460496,460503..460505,460800..460802,
                     460977..460979)
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    460698..460703
                     /gene="hisD"
                     /locus_tag="Bsph_0440"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:119329"
     gene            461023..461622
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /db_xref="GeneID:6022946"
     CDS             461023..461622
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /EC_number="4.2.1.19"
                     /note="catalyzes the dehydration of
                     D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate to
                     3-(imidazol-4-yl)-2-oxopropyl phosphate in histidine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="YP_001696198.1"
                     /db_xref="GI:169826040"
                     /db_xref="GeneID:6022946"
                     /translation="MTEKKRYAQVERTTNETQISVAIDLDGEGKADIKTGVGFMDHML
                     DLFIKHGLFNGTIQANGDTYIDDHHTTEDLGIVLGQAIREALGDKKGIKRYGTAFVPM
                     DDALAQVVVDCSNRPHLEYRVPPLKEKVGTFDTELVHEFLWKFALEARMNVHVIVPYG
                     HNTHHIIEAIFKALARAIDAAVEIDPRVKGVPSTKGLLT"
     misc_feature    461044..461616
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /note="Imidazoleglycerol-phosphate dehydratase; Region:
                     IGPD; cd07914"
                     /db_xref="CDD:153419"
     misc_feature    order(461068..461070,461146..461148,461158..461160,
                     461167..461172,461224..461229,461236..461238,
                     461302..461304,461326..461331,461368..461370,
                     461440..461442,461512..461517,461524..461526)
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:153419"
     misc_feature    order(461134..461139,461146..461148,461212..461220,
                     461224..461229,461401..461415,461422..461424,
                     461428..461430,461437..461442,461503..461517)
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /note="4-fold oligomerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:153419"
     misc_feature    order(461146..461148,461224..461229,461236..461238,
                     461440..461442,461512..461517,461524..461526)
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /note="metal binding residues [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153419"
     misc_feature    order(461299..461301,461305..461307,461311..461319,
                     461323..461331,461335..461340,461350..461358,
                     461368..461370,461374..461376,461476..461478,
                     461482..461484,461488..461490,461494..461496,
                     461548..461550,461557..461559,461575..461577)
                     /gene="hisB"
                     /locus_tag="Bsph_0441"
                     /note="3-fold/trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:153419"
     gene            461619..462251
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /db_xref="GeneID:6022947"
     CDS             461619..462251
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit"
                     /protein_id="YP_001696199.1"
                     /db_xref="GI:169826041"
                     /db_xref="GeneID:6022947"
                     /translation="MKIGVVDYGMGNLFSVVQALNRLGCEVIVTANQQLLDTTDALIL
                     PGVGAFPDARKRLAETKLDCYLKNAQSQHRPLLGICLGMQLLFEKSDEVTPTNGLGFF
                     KGHIKRFSGTNEGRAYRVPHMGWNELVMANRPAWLENSAPAKHVYFVHSFYATNIEKS
                     ELVAYADYCGIQVPGIVAKGSVTGMQFHPEKSGELGVYLLEQWLKGVKSC"
     misc_feature    461622..462248
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /note="imidazole glycerol phosphate synthase subunit HisH;
                     Provisional; Region: hisH; PRK13141"
                     /db_xref="CDD:237288"
     misc_feature    461625..462230
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in imidazole glycerol phosphate synthase (IGPS);
                     Region: GATase1_IGP_Synthase; cd01748"
                     /db_xref="CDD:153219"
     misc_feature    order(461739..461762,461850..461864,462180..462182,
                     462186..462188)
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /note="putative active site [active]"
                     /db_xref="CDD:153219"
     misc_feature    461739..461762
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /note="oxyanion strand; other site"
                     /db_xref="CDD:153219"
     misc_feature    order(461856..461858,462180..462182,462186..462188)
                     /gene="hisH"
                     /locus_tag="Bsph_0442"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153219"
     gene            462245..463006
                     /gene="hisF"
                     /locus_tag="Bsph_0443"
                     /db_xref="GeneID:6022948"
     CDS             462245..463006
                     /gene="hisF"
                     /locus_tag="Bsph_0443"
                     /EC_number="4.1.3.-"
                     /note="catalyzes the conversion of
                     5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-
                     1-(5-phosphoribosyl)imidazole-4-carboxamideand glutamine
                     to imidazole-glycerol phosphate,
                     5-aminoimidazol-4-carboxamideribonucleotide and glutamate;
                     the HisF subunit acts as a cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="YP_001696200.1"
                     /db_xref="GI:169826042"
                     /db_xref="GeneID:6022948"
                     /translation="MLTKRIIPCLDVKEGRVVKGIQFVSIRDAGDPVELAKFYDEQGA
                     DELVFLDISASHEGRETMIEVVQQTAATLAIPFTVGGGIRTLDDMKRILRAGADKVSV
                     NTSALERPSLIQEGSDFFGAQCIVVAIDARYSEEDGTWMVYTHGGRNKTTWSAIDWAK
                     EAVRLGAGEILLTSMNQDGEKSGFDLGLTKAVREAVSVPVIASGGAGYAEHFYEVLAE
                     EVDADAALAASIFHYKETSVAQVKEYLRAKGVAVR"
     misc_feature    462254..462988
                     /gene="hisF"
                     /locus_tag="Bsph_0443"
                     /note="The cyclase subunit of imidazoleglycerol phosphate
                     synthase (HisF). Imidazole glycerol phosphate synthase
                     (IGPS) catalyzes the fifth step of histidine biosynthesis,
                     the formation of the imidazole ring. IGPS converts
                     N1-(5'-phosphoribulosyl)...; Region: HisF; cd04731"
                     /db_xref="CDD:240082"
     misc_feature    462257..462949
                     /gene="hisF"
                     /locus_tag="Bsph_0443"
                     /note="Histidine biosynthesis protein; Region:
                     His_biosynth; pfam00977"
                     /db_xref="CDD:216225"
     misc_feature    order(462299..462301,462392..462394,462488..462490,
                     462551..462556,462626..462628,462632..462634,
                     462680..462682,462761..462763,462776..462781,
                     462851..462859,462926..462931)
                     /gene="hisF"
                     /locus_tag="Bsph_0443"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240082"
     misc_feature    order(462362..462364,462377..462379,462443..462445,
                     462455..462457,462464..462466,462470..462472,
                     462527..462529,462536..462541,462611..462613,
                     462749..462751,462833..462835,462911..462913)
                     /gene="hisF"
                     /locus_tag="Bsph_0443"
                     /note="glutamase interaction surface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:240082"
     gene            463003..463620
                     /gene="hisIE"
                     /locus_tag="Bsph_0444"
                     /db_xref="GeneID:6022949"
     CDS             463003..463620
                     /gene="hisIE"
                     /locus_tag="Bsph_0444"
                     /EC_number="3.5.4.19"
                     /EC_number="3.6.1.31"
                     /note="catalyzes the formation of 1-(5-phosphoribosyl)-AMP
                     from 1-(5-phosphoribosyl)-ATP and the subsequent formation
                     of
                     1-(5-phosphoribosyl)-5-((5-
                     phosphoribosylamino)methylideneamino)imidazole-4-
                     carboxamide from 1-(5-phosphoribosyl)-AMP in histidine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphoribosyl-AMP
                     cyclohydrolase/phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="YP_001696201.1"
                     /db_xref="GI:169826043"
                     /db_xref="GeneID:6022949"
                     /translation="MIERIRFDEKGLVTAVVQDANTKEVLTVAYMNKESFVKTMESGE
                     TWFYSRSRQELWHKGATSGHTQKVVAIKTDCDYDAIVVEVLPEGPACHNGTASCFTEV
                     VQQNTGVGSVEIIAKLVRVIEKREQEMPVGAYTTYLFEKGIDKICKKVGEEATEVVIG
                     AKNRDAEEVKWEAADLIYHLLVLLQEQKVSIYDVLDVLKKRHEEK"
     misc_feature    463003..463608
                     /gene="hisIE"
                     /locus_tag="Bsph_0444"
                     /note="bifunctional phosphoribosyl-AMP
                     cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein;
                     Reviewed; Region: PRK02759"
                     /db_xref="CDD:235067"
     misc_feature    463003..463299
                     /gene="hisIE"
                     /locus_tag="Bsph_0444"
                     /note="phosphoribosyl-AMP cyclohydrolase; Reviewed;
                     Region: hisI; PRK00051"
                     /db_xref="CDD:234598"
     misc_feature    463345..463596
                     /gene="hisIE"
                     /locus_tag="Bsph_0444"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain found in Escherichia coli
                     phosphoribosyl-ATP pyrophosphohydrolase (HisIE or
                     PRATP-PH) and its homologs; Region: NTP-PPase_HisIE_like;
                     cd11534"
                     /db_xref="CDD:212141"
     misc_feature    order(463459..463461,463468..463470,463516..463518,
                     463525..463527)
                     /gene="hisIE"
                     /locus_tag="Bsph_0444"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212141"
     gene            463750..465234
                     /locus_tag="Bsph_0445"
                     /db_xref="GeneID:6021270"
     CDS             463750..465234
                     /locus_tag="Bsph_0445"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696202.1"
                     /db_xref="GI:169826044"
                     /db_xref="GeneID:6021270"
                     /translation="MSFIPTGDYYYKKSIQAMNSGQMNKAYKYLQRAVDLSPDDPMII
                     LQLAIIELEGQRFEEAYDLLRRAYQIDPDNPEIIFYMAEVSGCVGIMQDAKRFAEEYL
                     QLEPEGAYADEAAEILEFVAFEQDEFEELEGSGEDLYRQEQARRHMEKGDFPEAITIL
                     EDLIEDRPAFWSAYNNLALAYFYVGEEEQAKALLHTVLRENKGNLHALCNLTVIAYYE
                     KNEEDLQELLNVLVKIQPYTWEHRYKLGATLALIGQYELAYKWLRSMQKRGYVGDAGF
                     YFWLSHAAYFSGHEEVSKSAWGQLLEVDPDKEGFEPWRQHDNEFALDALEHDRNFIVE
                     KLESSYLSERIFGLFLLKATAHKQEIIAHPKWVNIEQFGAFEKLFLAYALGHEFDKKN
                     KVEASFLRAVNVPEILLKQYGKLSTLIVPMFQMWFVLCEQALIQNYRFTNPVAIAGAN
                     DYLFRSSQMLKVTKKEIAQQYGVSVATLSKYIDEILAFLPSSHN"
     misc_feature    463771..463965
                     /locus_tag="Bsph_0445"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:222112"
     misc_feature    463810..464070
                     /locus_tag="Bsph_0445"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(463825..463827,463837..463839,463846..463848,
                     463891..463893,463927..463929,463939..463941,
                     463948..463950,463993..463995,464029..464031,
                     464041..464043,464050..464052)
                     /locus_tag="Bsph_0445"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(463882..463887,463891..463896,463903..463908,
                     463984..463989,463996..464001,464008..464013)
                     /locus_tag="Bsph_0445"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    464173..464457
                     /locus_tag="Bsph_0445"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(464173..464175,464182..464187,464272..464277,
                     464281..464286,464293..464298,464374..464379,
                     464386..464391,464398..464403)
                     /locus_tag="Bsph_0445"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(464179..464181,464215..464217,464227..464229,
                     464236..464238,464281..464283,464317..464319,
                     464329..464331,464338..464340,464383..464385,
                     464419..464421,464431..464433,464440..464442)
                     /locus_tag="Bsph_0445"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    <465121..465195
                     /locus_tag="Bsph_0445"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins, a family of DNA-binding domains unique to
                     bacteria and represented by the Hin protein of Salmonella.
                     The basic HTH domain is a simple fold comprised of three
                     core helices that form a right-handed...; Region:
                     HTH_Hin_like; cl17393"
                     /db_xref="CDD:247947"
     misc_feature    order(465175..465180,465184..465192)
                     /locus_tag="Bsph_0445"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:119388"
     gene            465466..466410
                     /locus_tag="Bsph_0446"
                     /db_xref="GeneID:6021271"
     CDS             465466..466410
                     /locus_tag="Bsph_0446"
                     /EC_number="1.8.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="YP_001696203.1"
                     /db_xref="GI:169826045"
                     /db_xref="GeneID:6021271"
                     /translation="MSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQM
                     ANTEEVENYPGFDTILGPELSTKMFDHAKKFGAEYAYGDVTEIIDGEEFKTIKSGTKE
                     YKTRAIIITTGAEYKKMGVPGEKELGGRGVSYCAVCDGAFFKQKNLVVVGGGDSAVEE
                     GVYLTRFADKVTIVHRRDKLRAQKILQDRAFANDKIDFIWNATVKEINEANGKVGSVT
                     LQSTVDGTESEFTTDGVFVYIGMLPLTKPFESLGILNDAGYILTNDNMETTIPGIFAA
                     GDVREKSLRQIVTATGDGSIAAQAVQHYVEELLEKINA"
     misc_feature    465487..466380
                     /locus_tag="Bsph_0446"
                     /note="thioredoxin-disulfide reductase; Region:
                     TRX_reduct; TIGR01292"
                     /db_xref="CDD:233345"
     misc_feature    465493..465999
                     /locus_tag="Bsph_0446"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl17500"
                     /db_xref="CDD:248054"
     misc_feature    465904..466131
                     /locus_tag="Bsph_0446"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:215691"
     gene            466739..467206
                     /locus_tag="Bsph_0447"
                     /db_xref="GeneID:6021272"
     CDS             466739..467206
                     /locus_tag="Bsph_0447"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NTP pyrophosphohydrolase including oxidative
                     damage repair enzymes"
                     /protein_id="YP_001696204.1"
                     /db_xref="GI:169826046"
                     /db_xref="GeneID:6021272"
                     /translation="MQRIANLIAVKDGKVLLLQKPRRGWYVAPGGKMESGESIFEAAI
                     REFQEETNVIPLHVHLKGVYTMVIKENNEVVDEWMLYTFVARDVEGVPFVETREGKLA
                     WHPVEDLVHLPMAEGDRTNLQFAVSQSGIQYGTFDYTTNFELLHQKIQISKEQ"
     misc_feature    466766..467155
                     /locus_tag="Bsph_0447"
                     /note="MutT homolog-1 (MTH1) is a member of the Nudix
                     hydrolase superfamily. MTH1, the mammalian counterpart of
                     MutT, hydrolyzes oxidized purine nucleoside triphosphates,
                     such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates,
                     thereby preventing the...; Region: MTH1; cd03427"
                     /db_xref="CDD:239519"
     misc_feature    order(466817..466819,466832..466834,466871..466876,
                     466883..466888,466934..466936,466970..466972,
                     466976..466978,467027..467032,467081..467083,
                     467087..467089)
                     /locus_tag="Bsph_0447"
                     /note="putative active site [active]"
                     /db_xref="CDD:239519"
     misc_feature    order(466817..466819,466832..466834,466871..466876,
                     466883..466888,466934..466936,466970..466972,
                     466976..466978,467081..467083,467087..467089)
                     /locus_tag="Bsph_0447"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239519"
     misc_feature    466829..466897
                     /locus_tag="Bsph_0447"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239519"
     misc_feature    467027..467032
                     /locus_tag="Bsph_0447"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239519"
     gene            467216..468109
                     /locus_tag="Bsph_0448"
                     /db_xref="GeneID:6021273"
     CDS             467216..468109
                     /locus_tag="Bsph_0448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696205.1"
                     /db_xref="GI:169826047"
                     /db_xref="GeneID:6021273"
                     /translation="MTVVVEGQQRTHELVIITGMSGAGKTVAIQSFEDLGYYCIDNLP
                     PALLTTFLTLLRDSGKNSTRIAAVMDMRGGNFFDALIGALDHILKEGDIVARILFLDA
                     DDATLVRRYKETRRAHPLAVSGLPLDGIKQERALLSEVKGRANFVYNTSNMKPKQLRE
                     KIVKEFASEADTIFTVNIMSFGFKHGMPIDADLVFDVRFLKNPYYVEELRPKTGLQTE
                     VSSYVLALEDTQILIQKLTDLFDFMIPLYRQEGKSQLVIAFGCTGGQHRSVTLAEFFG
                     AYLASKENTVITHRDINRRKE"
     misc_feature    467252..468106
                     /locus_tag="Bsph_0448"
                     /note="glmZ(sRNA)-inactivating NTPase; Provisional;
                     Region: PRK05416"
                     /db_xref="CDD:235450"
     gene            468114..469082
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /db_xref="GeneID:6021274"
     CDS             468114..469082
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696206.1"
                     /db_xref="GI:169826048"
                     /db_xref="GeneID:6021274"
                     /translation="MGKKQTKLVVIGGGTGLSTLLRGLKHHPFDITAIVTVADDGGSS
                     GRLRDDYDIPPPGDVRNVIAALSDIEPLVEQMFQYRFSASEDLRGHSLGNLMLTALTD
                     ITGDFNHAISEMGKVLKVHGRVIPAANKKINLHAVLEDGSIIEGESKIPTATKRIDRV
                     FLVPENVQPLPEAIRAIQRADYILIGPGSLYTSIIPNLLVKEIGESVVKAKGRKMYVC
                     NLMTQKGETISYTAGDHVSAIHKHVGASFIDSILVNDEELPNPVKELYKEERAEPVTF
                     DVAKLESMGLEVIRRDIATIRPDGTVRHNATNVAEWLVDYAGIYDR"
     misc_feature    468186..469058
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /note="conserved hypothetical protein, cofD-related;
                     Region: CofD_related; TIGR01826"
                     /db_xref="CDD:211689"
     misc_feature    468186..469058
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /note="family of mostly uncharacterized proteins similar
                     to B.subtilis YvcK; Region: YvcK_like; cd07187"
                     /db_xref="CDD:132873"
     misc_feature    order(468228..468230,468240..468242,468282..468284,
                     468291..468293,468393..468395)
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:132873"
     misc_feature    order(468372..468374,468387..468389,468396..468401,
                     468408..468413,468417..468422,468450..468452,
                     468459..468464)
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132873"
     misc_feature    order(468675..468680,468690..468692,468777..468782)
                     /gene="yvcK"
                     /locus_tag="Bsph_0449"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:132873"
     gene            469158..470123
                     /locus_tag="Bsph_0450"
                     /db_xref="GeneID:6021704"
     CDS             469158..470123
                     /locus_tag="Bsph_0450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696207.1"
                     /db_xref="GI:169826049"
                     /db_xref="GeneID:6021704"
                     /translation="MKGGRDMSFASETKKELTQIEADNHCMKAEVSALIRMNGSLSFA
                     NKQLSLDVQTENAAIARRLYTIMKKLYPYNVELLVRKKMRLKKNNVYICRVREGAREL
                     LIDLEIISDDFQFNHTISRKLIKKNGQKRAYLRGAFLAGGSVNNPETSAYHLEIYSLY
                     KEHGEALMDLMNEFELNAKTIERKKGFVTYLKEAEKISDFLNIVGAHQAMMKFEDVRI
                     LRDMRNSVNRIVNCETANLNKTIGAALRQVENIRFIENSIGLDQLPEKLREIARLRVE
                     YQDVTLKELGEMVSSGTVSKSGVNHRLRKIDEIADALRRGEKIGG"
     misc_feature    469176..470111
                     /locus_tag="Bsph_0450"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1481"
                     /db_xref="CDD:224398"
     misc_feature    469230..469484
                     /locus_tag="Bsph_0450"
                     /note="Sporulation Regulator WhiA N terminal; Region:
                     WhiA_N; pfam10298"
                     /db_xref="CDD:150898"
     gene            470237..470494
                     /locus_tag="Bsph_0451"
                     /db_xref="GeneID:6021705"
     CDS             470237..470494
                     /locus_tag="Bsph_0451"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr-like protein crh"
                     /protein_id="YP_001696208.1"
                     /db_xref="GI:169826050"
                     /db_xref="GeneID:6021705"
                     /translation="MIERRVQVKLKLGLQARQAALFVQEANRFSADIFLEKDEKKVNA
                     KSIMGVMSLAVAKGTEVTLSSEGNDAEQAVTALATIIENED"
     misc_feature    470249..470479
                     /locus_tag="Bsph_0451"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    470249..470260
                     /locus_tag="Bsph_0451"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(470276..470278,470282..470287,470291..470296,
                     470306..470308,470315..470317,470369..470380,
                     470387..470392)
                     /locus_tag="Bsph_0451"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    470279..470281
                     /locus_tag="Bsph_0451"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    470372..470374
                     /locus_tag="Bsph_0451"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            complement(470545..471138)
                     /gene="clpP"
                     /locus_tag="Bsph_0452"
                     /db_xref="GeneID:6021706"
     CDS             complement(470545..471138)
                     /gene="clpP"
                     /locus_tag="Bsph_0452"
                     /EC_number="3.4.21.92"
                     /note="hydrolyzes proteins to small peptides; with the
                     ATPase subunits ClpA or ClpX, ClpP degrades specific
                     substrates"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="YP_001696209.1"
                     /db_xref="GI:169826051"
                     /db_xref="GeneID:6021706"
                     /translation="MNLIPTVIEQTSRGERAYDIYSRLLKDRIILLGSAIDDNVANSI
                     VAQLLFLQAEDPDKDISLYINSPGGSITAGMAIYDTMQIIKPKVQTICIGMAASMGAF
                     LLAAGEPGKRFALPNAEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNGILSERTGQ
                     PLEVIARDTDRDNFMTAERAKEYGLIDHIMHRSTDNK"
     misc_feature    complement(470569..471105)
                     /gene="clpP"
                     /locus_tag="Bsph_0452"
                     /note="Clp protease; Region: CLP_protease; pfam00574"
                     /db_xref="CDD:201316"
     misc_feature    complement(470572..471084)
                     /gene="clpP"
                     /locus_tag="Bsph_0452"
                     /note="Caseinolytic protease (ClpP) is an ATP-dependent,
                     highly conserved serine protease; Region: S14_ClpP_2;
                     cd07017"
                     /db_xref="CDD:132928"
     misc_feature    complement(order(470617..470619,470623..470625,
                     470692..470694,470698..470700,470704..470706,
                     470713..470715,470755..470766,470782..470784,
                     470788..470790,470854..470856,470878..470880,
                     470890..470895,470902..470904,470911..470913,
                     470923..470925,470944..470946,470989..470991,
                     470998..471003,471010..471015,471040..471042,
                     471046..471048))
                     /gene="clpP"
                     /locus_tag="Bsph_0452"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132928"
     misc_feature    complement(order(470623..470625,470770..470772,
                     470845..470847))
                     /gene="clpP"
                     /locus_tag="Bsph_0452"
                     /note="active site residues [active]"
                     /db_xref="CDD:132928"
     gene            471455..471529
                     /locus_tag="Bsph_tRNA26"
                     /db_xref="GeneID:6021707"
     tRNA            471455..471529
                     /locus_tag="Bsph_tRNA26"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:6021707"
     gene            472028..472822
                     /locus_tag="Bsph_0453"
                     /db_xref="GeneID:6021708"
     CDS             472028..472822
                     /locus_tag="Bsph_0453"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine-binding protein"
                     /protein_id="YP_001696210.1"
                     /db_xref="GI:169826052"
                     /db_xref="GeneID:6021708"
                     /translation="MKKTAWMLLMILAALTLALAGCGTKDTASSGSTPSEGGDGKKVY
                     KVGTEATFAPFESVDDKGKIVGIDVDILKAIADEMDFEVEWNNIGWEPVFQTIKNGET
                     HIGASGITITDERKESFDFTEPYYESQLLIVVKEDSKIKSLDELKDKKVSVQINATGH
                     MAAKKLQGEASTNIMAFESQPIAIQEMLNGNVDAAIGDNAVVYEYIKAHPDQKIKVIQ
                     DDAFEKEYYGFMVQKGNKELLDKLNEGLKKIKENGKLKEITGTDFE"
     misc_feature    472160..472804
                     /locus_tag="Bsph_0453"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    472160..472801
                     /locus_tag="Bsph_0453"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:215950"
     misc_feature    order(472181..472183,472295..472297,472370..472372,
                     472499..472501,472619..472621)
                     /locus_tag="Bsph_0453"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(472568..472570,472580..472582,472598..472600)
                     /locus_tag="Bsph_0453"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    472694..472711
                     /locus_tag="Bsph_0453"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            472852..473610
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /db_xref="GeneID:6024444"
     CDS             472852..473610
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /codon_start=1
                     /transl_table=11
                     /product="amino-acid ABC transporter permease"
                     /protein_id="YP_001696211.1"
                     /db_xref="GI:169826053"
                     /db_xref="GeneID:6024444"
                     /translation="MLATHLMDVTLKGKWGFRMDIFDLRWDIVWNYRDMFIRGIGVTL
                     ILTLSGYFGGILLGLFLGLGKLSSKKWIYWPSKLYIDLFRGTPMLVQILLIHLAVIPT
                     IFGHSLGYMVSGITALILNCAAYNAEIFRAGIQSIAKGQMEAARSLGLTHNQAMRKVI
                     LPQAFRRMIPPLGNEFIALLKDSSLVTVIAAPDILYASKVVAGASFRFWEPYMVAALL
                     YLILTYGVTKIVAFIEKRFSNSYVPRKAEGREAR"
     misc_feature    473062..473532
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(473077..473088,473092..473121,473128..473133,
                     473137..473139,473209..473214,473218..473220,
                     473224..473226,473233..473238,473242..473244,
                     473254..473259,473266..473268,473317..473319,
                     473359..473364,473371..473373,473392..473403,
                     473410..473415,473452..473457,473485..473490,
                     473497..473502,473506..473511,473518..473523,
                     473530..473532)
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(473095..473139,473392..473409)
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(473137..473139,473194..473196,473410..473412,
                     473446..473448,473455..473457,473485..473487)
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(473269..473307,473323..473328,473338..473340)
                     /gene="yckA"
                     /locus_tag="Bsph_0454"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            473607..474329
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /db_xref="GeneID:6024445"
     CDS             473607..474329
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine transport ATP-binding protein"
                     /protein_id="YP_001696212.1"
                     /db_xref="GI:169826054"
                     /db_xref="GeneID:6024445"
                     /translation="MIKIENLHKYFGKLEVLKGIDYEIQEKQVVCVIGPSGSGKSTFL
                     RCINMLEEVTDGAIYIEDVKINDPKTNINAIRAEVGMVFQQFNLFPHMNVIDNVTMAP
                     MQIRKMSRSEAEALGHELLNKVGLDSKAYNYPEQLSGGQQQRVAIARALAMKPKAILF
                     DEPTSALDPEMVKEVLDVMKNLAAEGMTMVVVTHEMGFAREVGDRVVFMDGGYIVEEG
                     LPEELFGNPQSERTKAFLGKVL"
     misc_feature    473607..474326
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    473610..474248
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    473706..473729
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    order(473715..473720,473724..473732,473856..473858,
                     474087..474092,474186..474188)
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    473847..473858
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    474015..474044
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    474075..474092
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    474099..474110
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    474174..474194
                     /gene="glnQ"
                     /locus_tag="Bsph_0455"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(474384..474998)
                     /locus_tag="Bsph_0456"
                     /db_xref="GeneID:6024446"
     CDS             complement(474384..474998)
                     /locus_tag="Bsph_0456"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696213.1"
                     /db_xref="GI:169826055"
                     /db_xref="GeneID:6024446"
                     /translation="MSQSFYNESSNQTNLNQQHSLNHGGHEMMDMHEAIGEIIAGMNQ
                     AIILRPQVKDQELLSILDRQYNFSLGMYNTIVESFKTGHDPSVPTGRYQMETGNDFKY
                     GLTPGQPKKPMQNANEINDEAISGFLLGAQKGVAKCMTAAATETTNPVVRRVVADSIP
                     NCIEMAYELSIYQNKHGYYQVPQYSQQDMQTMLNAFDTTSNPLH"
     misc_feature    complement(474411..474812)
                     /locus_tag="Bsph_0456"
                     /note="Spore coat protein [Cell envelope biogenesis, outer
                     membrane]; Region: COG5577"
                     /db_xref="CDD:227864"
     gene            475137..475717
                     /locus_tag="Bsph_0457"
                     /note="This region contains a gene with one or more
                     premature stops or frameshifts, and is not the result of a
                     sequencing artifact; conserved hypothetical protein;
                     identified by sequence similarity"
                     /pseudo
                     /db_xref="GeneID:6024447"
     gene            475804..476466
                     /locus_tag="Bsph_0459"
                     /db_xref="GeneID:6025139"
     CDS             475804..476466
                     /locus_tag="Bsph_0459"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696214.1"
                     /db_xref="GI:169826056"
                     /db_xref="GeneID:6025139"
                     /translation="MKNTYIHDFANVLSLDVKQKLNHYSEQLDKGTGAEIMVVTVDSL
                     HGQEAKMYATKLIRSWGIGDKEKNNGALILATFGQGKGQNDVVIAVGQGLEGALPDGK
                     LGRILDNAFYPLASEGDNDQAFLATYAEVFRAVAEEYNWNGELPAGANADEEIPIWLM
                     IVIIIAVIIFSSFFSKGGGGPRGRGYGGYPGSFGGRRSGGGSFGGFGGGSSAGGGASR
                     KF"
     misc_feature    475837..476196
                     /locus_tag="Bsph_0459"
                     /note="Repair protein; Region: Repair_PSII; pfam04536"
                     /db_xref="CDD:203039"
     gene            476600..478870
                     /locus_tag="Bsph_0460"
                     /db_xref="GeneID:6025140"
     CDS             476600..478870
                     /locus_tag="Bsph_0460"
                     /EC_number="3.4.14.-"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptidyl peptidase"
                     /protein_id="YP_001696215.1"
                     /db_xref="GI:169826057"
                     /db_xref="GeneID:6025140"
                     /translation="MKKRFLTASLAIILTTATVIPATLQEVRAANETNIVLAQEQQLS
                     AQEFLDLAVTALTFQHGSDSMRQQIKDQWVKAGEITDLSATIKRDQAARILVRAANKE
                     GKEKTLAEYLKKANKLGFFKGISSSTDFISKQEASKLLNNVKKIKNGSSNKGVKEISV
                     EDFVKNPGNFGYELSPDGNYITFASAWENRSNVFVKKMNDNSEPVRVSSSKDRNIAGF
                     FWKDDSLLYLKDKGGDENFHIYSTTFNGSVEKDLTPYPNVTVGILDSLQGVKDEILIM
                     MNKEDATVFDVYKLNVKTGKTTHVAKNPGNITNWLADRNGNVRVAVATDGVKGAILYR
                     DSEKDEFRPFIKMGAGDEVMPLAFSKDNKFIYATSNKGRDKVEVVKYDLQGKEEVIMS
                     NDEVDVSGVLYNAEKDKLLFGAYATDKIHYQFFDKDFEKLFRKIQNKLGVHESELGIN
                     DYNKEMTKFIVSVSSDTIYGKYYYYDSTTDELKELATLSPWLKSADLAEMHPISYKSR
                     DGLTINGYLTLPKNKKAENLPLIVNPHGGPWARDMWGFNPEVQLLANRGYAVLQVNFR
                     SSTGYGKEFLQAGNKQWGLKIQDDITDGVQWAIDQGIADPKRIGIYGASFGGYATLAG
                     ITYTPDLYAAAVDYVGVSNIFTLLDTIPPYWETMRDLFYERVGHPEKDKELLKAVSPV
                     FHVDKIKTPLFVAQGANDPRVNKAESDQIVEALRARGVDVEYMLKDNEGHGFANEENR
                     IEFYNAMVKFLDHHLK"
     misc_feature    477092..478867
                     /locus_tag="Bsph_0460"
                     /note="Dipeptidyl aminopeptidases/acylaminoacyl-peptidases
                     [Amino acid transport and metabolism]; Region: DAP2;
                     COG1506"
                     /db_xref="CDD:224423"
     misc_feature    478229..478867
                     /locus_tag="Bsph_0460"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:215859"
     gene            479073..479306
                     /locus_tag="Bsph_0461"
                     /db_xref="GeneID:6025141"
     CDS             479073..479306
                     /locus_tag="Bsph_0461"
                     /note="COG: Thiol-disulfide isomerase and thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696216.1"
                     /db_xref="GI:169826058"
                     /db_xref="GeneID:6025141"
                     /translation="MIVQFFSRANCPLCVEGLHTLKLVQEDVAFDIEIVNIEEDDHIH
                     EKYMFMIPVVEKDGTVIQYGNLDYATLMEHLGS"
     misc_feature    479079..479297
                     /locus_tag="Bsph_0461"
                     /note="Glutaredoxin-like domain (DUF836); Region: DUF836;
                     pfam05768"
                     /db_xref="CDD:218740"
     gene            479545..479685
                     /locus_tag="Bsph_0462"
                     /db_xref="GeneID:6025142"
     CDS             479545..479685
                     /locus_tag="Bsph_0462"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696217.1"
                     /db_xref="GI:169826059"
                     /db_xref="GeneID:6025142"
                     /translation="MKGDFTMWVITVFEKKDVRIFEFTNKNEATKALEGFKKNAILSF
                     TK"
     gene            479860..480909
                     /locus_tag="Bsph_0463"
                     /db_xref="GeneID:6025143"
     CDS             479860..480909
                     /locus_tag="Bsph_0463"
                     /codon_start=1
                     /transl_table=11
                     /product="central glycolytic genes regulator"
                     /protein_id="YP_001696218.1"
                     /db_xref="GI:169826060"
                     /db_xref="GeneID:6025143"
                     /translation="MFTIPEAQQRLLPEMYPLLQSRYRILQAVQLMQPIGRRTLADSL
                     KMTEREIRKETDILREQGLLDSQKSGMVCTDDGEEVIEKLRAIVYEWSGLTQLAKLLE
                     KHFGIQHVVVVPGDYSEDNTVLTLLGKEAALQFMSTAFDEQVVAVTGGKSVASLAQFL
                     HPLDGQKDITFVAARGGIGHEMQMQANTLVATFAMQMEEQYRTLFLPEHLSEQAYKAM
                     LTEPMVTEMMAFYDRADCVIHGIGSAEEMAIRRNSSSEDLRILEEKGAVSEAFGYYFN
                     AEGEIVHRIRTIGIQLEQVKNSQQVIAVAAGKQKVNAMLSYFKVAPKQTIFITDEAAA
                     KAIAATLPSDNSHFE"
     misc_feature    479884..480852
                     /locus_tag="Bsph_0463"
                     /note="Transcriptional regulator, contains sigma
                     factor-related N-terminal domain [Transcription]; Region:
                     DeoR; COG2390"
                     /db_xref="CDD:225263"
     misc_feature    479932..>480111
                     /locus_tag="Bsph_0463"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG3388"
                     /db_xref="CDD:225923"
     misc_feature    480124..480852
                     /locus_tag="Bsph_0463"
                     /note="Putative sugar-binding domain; Region: Sugar-bind;
                     pfam04198"
                     /db_xref="CDD:217959"
     gene            481024..482055
                     /locus_tag="Bsph_0464"
                     /db_xref="GeneID:6022039"
     CDS             481024..482055
                     /locus_tag="Bsph_0464"
                     /EC_number="1.2.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="YP_001696219.1"
                     /db_xref="GI:169826061"
                     /db_xref="GeneID:6022039"
                     /translation="MEELTMALKLAINGFGRIGRLVFREAMKQSEFEVVAVNDLTDAG
                     QLAHLLKYDSVHGIYDAEVNADEDSFVVNGQRIKVYAEKDPSQLPWGELGVDVVLECT
                     GHFRSLEEVGKHIEAGAKKAILSAPAKGAMPTFVMGVNHTDYNPATDDVISNASCTTN
                     CLAPVAKVLDEKFGIERGMMTTIHSYTNDQRILDFPHSDPRRARAGAVSMIPTTTGAA
                     VAVSKVLPQLKGKLDGFSMRVPTPNVSCVDLVVELKADVTKEAINAVLKEASENELKG
                     ILDYNELPLVSIDYNGNHHSSTVDGLSTMVLENKMVKVLAWYDNEIGYSTRLMDLALY
                     IAEQGLNNK"
     misc_feature    481039..482037
                     /locus_tag="Bsph_0464"
                     /note="glyceraldehyde-3-phosphate dehydrogenase;
                     Validated; Region: PRK07729"
                     /db_xref="CDD:236079"
     misc_feature    481045..481491
                     /locus_tag="Bsph_0464"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase, NAD
                     binding domain; Region: Gp_dh_N; pfam00044"
                     /db_xref="CDD:215675"
     misc_feature    481507..481977
                     /locus_tag="Bsph_0464"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; pfam02800"
                     /db_xref="CDD:217235"
     gene            482604..483788
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /db_xref="GeneID:6022040"
     CDS             482604..483788
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /EC_number="2.7.2.3"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="YP_001696220.1"
                     /db_xref="GI:169826062"
                     /db_xref="GeneID:6022040"
                     /translation="MLNKKTMKDIDVKGKRVFVRVDFNVPMADGVITDETRIRAAIPT
                     VEYLVEQGAKVILASHLGRPKGEVKEDMRLTAVGIRLAELMSKPVTKLDESIGQAVEK
                     AVANMQDGDILLLENVRFHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGI
                     AKHIPAVSGFLMQTELDVLGKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLII
                     GGGLSFTFIKAQGYDIGKSLLEEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQD
                     AETKVVDVDAIPADWMGLDIGPKTAAHYAEVINNSKLIIWNGPMGVFEMDKFANGTKT
                     VADAMATTSGYTVIGGGDSAAAVEKFKVADKMDHISTGGGASLELMEGKELPGIVALN
                     DK"
     misc_feature    482619..483752
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /note="Phosphoglycerate kinase; Region: PGK; pfam00162"
                     /db_xref="CDD:215761"
     misc_feature    482622..483782
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /note="Phosphoglycerate kinase (PGK) is a monomeric enzyme
                     which catalyzes the transfer of the high-energy phosphate
                     group of 1,3-bisphosphoglycerate to ADP, forming ATP and
                     3-phosphoglycerate. This reaction represents the first of
                     the two substrate-level...; Region:
                     Phosphoglycerate_kinase; cd00318"
                     /db_xref="CDD:238195"
     misc_feature    order(482667..482669,482673..482675,482712..482714,
                     482781..482783,482958..482960)
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238195"
     misc_feature    order(483150..483161,483708..483716)
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /note="hinge regions; other site"
                     /db_xref="CDD:238195"
     misc_feature    order(483264..483266,483480..483482,483552..483554,
                     483558..483560,483564..483575,483654..483662)
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238195"
     misc_feature    483657..483659
                     /gene="pgk"
                     /locus_tag="Bsph_0465"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238195"
     gene            483815..484576
                     /locus_tag="Bsph_0466"
                     /db_xref="GeneID:6022041"
     CDS             483815..484576
                     /locus_tag="Bsph_0466"
                     /EC_number="5.3.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_001696221.1"
                     /db_xref="GI:169826063"
                     /db_xref="GeneID:6022041"
                     /translation="MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPA
                     LYLPTLVQVASESELAIGAQTMHYENEGAFTGEISPAQLASVDVDYVILGHSERREYY
                     NETDEAINKKVAAALAHNIVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQVE
                     HMVIAYEPIWAIGTGKTATADDANQVCGAIRSVVEELFDAATANAVRIQYGGSVKPDN
                     VHELLSKEHIDGALVGGASLQPESYLTLLEAAANA"
     misc_feature    483824..484558
                     /locus_tag="Bsph_0466"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    483827..484573
                     /locus_tag="Bsph_0466"
                     /note="triosephosphate isomerase; Provisional; Region:
                     PRK14565"
                     /db_xref="CDD:237758"
     misc_feature    order(483839..483841,483845..483847,484097..484099,
                     484313..484315,484331..484333,484451..484453,
                     484508..484510,484514..484519)
                     /locus_tag="Bsph_0466"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    order(483839..483841,483848..483850,483944..483952,
                     483956..483958,483965..483967,484004..484006,
                     484058..484060,484067..484072,484103..484108)
                     /locus_tag="Bsph_0466"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    order(483845..483847,484097..484099,484313..484315)
                     /locus_tag="Bsph_0466"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            484569..486110
                     /locus_tag="Bsph_0467"
                     /db_xref="GeneID:6022042"
     CDS             484569..486110
                     /locus_tag="Bsph_0467"
                     /EC_number="5.4.2.1"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="YP_001696222.1"
                     /db_xref="GI:169826064"
                     /db_xref="GeneID:6022042"
                     /translation="MPKKPVALIILDGFAFRDETFGNAVAQAKKPNFDRYWSQFPHAT
                     LTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRLNKSIREGDFFTNQAFLDAVA
                     HVKAHNSKLHIMGLLSDGGVHSHYEHMFALLKLAKQQDLNDVFVHGFLDGRDVGPTTA
                     LDYIEETEKQMSEIGIGQFASIHGRYYAMDRDKRWDRVALTYNVLVDGVGQTAESAKS
                     GVAASYEREVTDEFVIPFSIQEHGEPVATIGDNDAVIFFNFRPDRAIQLSKVFTNEDF
                     DGFAISAKHPKNLKFVSFTHYSDEVNAQIAYENDNLKNTIGEVLAMNGKTQLRIAETE
                     KYPHVTFFMSGGREEKFLGEERILIASPKVATYDLKPEMSAYEVTEALLAEIEAEKFD
                     GIILNFANPDMVGHSGMLEPTIKAIEAVDECLGKVVDALLAKGGAAIITADHGNSDEV
                     VTLAGQPMTAHTTNPVPVIVTKPNVVLRNGGILADLAPTMLELLQVSQPTEMTGQSLI
                     EKEEN"
     misc_feature    484569..486098
                     /locus_tag="Bsph_0467"
                     /note="Phosphoglyceromutase [Carbohydrate transport and
                     metabolism]; Region: GpmI; COG0696"
                     /db_xref="CDD:223768"
     misc_feature    484569..486095
                     /locus_tag="Bsph_0467"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            486113..487405
                     /locus_tag="Bsph_0468"
                     /db_xref="GeneID:6022043"
     CDS             486113..487405
                     /locus_tag="Bsph_0468"
                     /EC_number="4.2.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="YP_001696223.1"
                     /db_xref="GI:169826065"
                     /db_xref="GeneID:6022043"
                     /translation="MPFITQVYAREVLDSRGNPTVEVEVFTESGAFGRSIVPSGASTG
                     EYEAVELRDGDKSRYLGKGVLKAVENVNTIIAQELEGNYSVLDQVVIDKALIELDGTE
                     NKGKLGANAILGVSMAVAHAAADYLDVPLYQYLGGFNSKQLPVPMMNILNGGAHADNN
                     VDIQEFMVMPVGAESFRHALRIGAEIFHNLKAVLKDKGYNTAVGDEGGFAPNLGSNEE
                     AITVILEAIEKAGYKPGEEVKLAMDVASSELFNKEDGKYHLDGEGVVKTSEEMVDWYE
                     ELTNKYPIISIEDGLDENDWAGHKLLTERIGSRVQLVGDDLFVTNTKKLAAGIEQGVG
                     NSILIKVNQIGTLTETFEAIEMAKRAGYTAVISHRSGESEDATIADIAVATNAGQIKT
                     GAPSRTDRVAKYNQLLRIEDQLGSTAEYLGLKSFYNLK"
     misc_feature    486113..487402
                     /locus_tag="Bsph_0468"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    486131..487351
                     /locus_tag="Bsph_0468"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(486134..486136,486140..486166,486176..486178,
                     486212..486214,486581..486589,486650..486655,
                     486662..486667,486674..486679,486716..486721,
                     486740..486742,486746..486748,487226..487234,
                     487301..487309,487313..487318,487325..487327,
                     487334..487339,487346..487348)
                     /locus_tag="Bsph_0468"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(486236..486238,486839..486841,486974..486976,
                     487055..487057)
                     /locus_tag="Bsph_0468"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(486578..486580,486728..486730,487130..487132,
                     487214..487222,487283..487285)
                     /locus_tag="Bsph_0468"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            488117..488653
                     /locus_tag="Bsph_0469"
                     /db_xref="GeneID:6022413"
     CDS             488117..488653
                     /locus_tag="Bsph_0469"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001696224.1"
                     /db_xref="GI:169826066"
                     /db_xref="GeneID:6022413"
                     /translation="MQRKTKSAIVIIAVLVIFGGIFGYFKFTEPMEKPTPVKEKAIVE
                     NAGVTLDDKRVTKEELLYPDNLIEHKMNEAIHSMSHQKVEAKTKWGHTQITQAKVDRL
                     LEISKESNYKFRELYIEILERWSKGDFSHAIEDHNAIWEMQGGDESGNSGKAIRLLTP
                     AEEQAYIENNLTYDLYDK"
     misc_feature    488126..488626
                     /locus_tag="Bsph_0469"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06770"
                     /db_xref="CDD:180687"
     gene            488771..489292
                     /locus_tag="Bsph_0470"
                     /db_xref="GeneID:6022414"
     CDS             488771..489292
                     /locus_tag="Bsph_0470"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine acetyltransferase"
                     /protein_id="YP_001696225.1"
                     /db_xref="GI:169826067"
                     /db_xref="GeneID:6022414"
                     /translation="MKILETERLILRLQTTEDALFILELVNDPSWIQFIGDRGVKTVE
                     EAASYIENGAIRMYEQFGFCLYVVEIKENQTPIGICGFVKRETLEDVDIGFAFLPDYW
                     GKGYAYEAASAVLAYGLVTLGFNRIVAITTQENYASAKLLERIGLQFERVIQFSNDSE
                     ELRLFSLNGEKSK"
     misc_feature    488792..489214
                     /locus_tag="Bsph_0470"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:222034"
     misc_feature    488978..489208
                     /locus_tag="Bsph_0470"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:216007"
     gene            complement(489357..490532)
                     /locus_tag="Bsph_0471"
                     /db_xref="GeneID:6022415"
     CDS             complement(489357..490532)
                     /locus_tag="Bsph_0471"
                     /codon_start=1
                     /transl_table=11
                     /product="protein dltD"
                     /protein_id="YP_001696226.1"
                     /db_xref="GI:169826068"
                     /db_xref="GeneID:6022415"
                     /translation="MIKKGFLSLFIAFALFTGFVFFPNSWIKAWISEDDVEQAKTNMS
                     PLVFQGTYLQERMLQEPTSMPLYGSSELNRFDPFHPYNYTRATDAPYSTFMIGRGGMQ
                     SITHFLNFAAQEKNLAGKKLVFIISPQWFTEKGMGEFHFSPNYSMLHAYDLAFNDDMD
                     ADLRKQAMERLLEFDTVERDRLLKTMYQYQMSNGKKHPVTGRMAMVAGRFHKELLEKK
                     DLYYSLFPRKGHPLKNNDKLVTDQSFEQQIQHAEAYGEKRVSNEYMIENRAFKRLVNA
                     NFSKFKDMRKHEDYTESPEYKDFQLVMDVLKDAGAKPLFISIPVNGYWYDYNGYPKER
                     RQQYYEKMAQLLKDADVDYVDFTDHEYDPYFIMDTIHIGWKGWVYLDQHMDKYWAQQ"
     misc_feature    complement(489369..490517)
                     /locus_tag="Bsph_0471"
                     /note="D-alanyl-lipoteichoic acid biosynthesis protein
                     DltD; Region: LTA_DltD; TIGR04092"
                     /db_xref="CDD:234465"
     misc_feature    complement(490248..490433)
                     /locus_tag="Bsph_0471"
                     /note="DltD N-terminal region; Region: DltD_N; pfam04915"
                     /db_xref="CDD:218326"
     misc_feature    complement(489750..490247)
                     /locus_tag="Bsph_0471"
                     /note="DltD central region; Region: DltD_M; pfam04918"
                     /db_xref="CDD:113682"
     misc_feature    complement(489360..489749)
                     /locus_tag="Bsph_0471"
                     /note="DltD C-terminal region; Region: DltD_C; pfam04914"
                     /db_xref="CDD:147203"
     gene            complement(490529..490762)
                     /locus_tag="Bsph_0472"
                     /db_xref="GeneID:6022416"
     CDS             complement(490529..490762)
                     /locus_tag="Bsph_0472"
                     /EC_number="6.1.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--poly(phosphoribitol) ligase subunit
                     2"
                     /protein_id="YP_001696227.1"
                     /db_xref="GI:169826069"
                     /db_xref="GeneID:6022416"
                     /translation="MDKQQVLEMLVELCEDEIIVENPDIDLFEEGLLDSFGTINLLVE
                     IENRFNISVPITDFNREEWNTPNRIAGKLAERQ"
     misc_feature    complement(490532..490756)
                     /locus_tag="Bsph_0472"
                     /note="D-alanine--poly(phosphoribitol) ligase subunit 2;
                     Validated; Region: PRK05087"
                     /db_xref="CDD:179929"
     gene            complement(490811..491974)
                     /locus_tag="Bsph_0473"
                     /db_xref="GeneID:6022417"
     CDS             complement(490811..491974)
                     /locus_tag="Bsph_0473"
                     /codon_start=1
                     /transl_table=11
                     /product="protein dltB"
                     /protein_id="YP_001696228.1"
                     /db_xref="GI:169826070"
                     /db_xref="GeneID:6022417"
                     /translation="MTPYGNIAFFLIIGLLLLPTILLGLRGKSAKHYNLFVSLIVLAL
                     IFGHSLNGSISLILFTVFQIILITAYQRYRLRQNNGPVFVMAVLLSILPLVLVKVLPI
                     LGLHHLFGFLGVSYITFKAVQMILETRDGLMKEKISIAELAYFLLFFPTVSSGPIDRW
                     RRFTKDFHSVPSSEDYQKLLLSGINYIFVGFLYKFILAYLIYNYTLIYLPNHTYNYLT
                     PFQGQLAYMYMYSFYLFFDFAGYSAFAVGVSRIMGIQTPINFNRPFASRNIKDFWNRW
                     HMSLSFWFRDYVYMRFVLWMTKKKWLKNKFTISYIGFFLLFFLMGIWHGLEWHFVVYG
                     LYHALLIISFDKFERWNKKHKLWPKNKWTHAIGVFITFNAVCFGFYIFSGKLF"
     misc_feature    complement(490817..491971)
                     /locus_tag="Bsph_0473"
                     /note="D-alanyl-lipoteichoic acid biosynthesis protein
                     DltB; Region: LTA_dltB; TIGR04091"
                     /db_xref="CDD:188606"
     gene            complement(491971..4934