GenomeNet

Database: RefSeq
Entry: NC_010382
LinkDB: NC_010382
Original site: NC_010382 
LOCUS       NC_010382            4639821 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Lysinibacillus sphaericus C3-41, complete genome.
ACCESSION   NC_010382
VERSION     NC_010382.1  GI:169825618
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604328
            Assembly: GCF_000017965.1
KEYWORDS    RefSeq.
SOURCE      Lysinibacillus sphaericus C3-41
  ORGANISM  Lysinibacillus sphaericus C3-41
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae;
            Lysinibacillus.
REFERENCE   1  (bases 1 to 4639821)
  AUTHORS   Hu,X., Fan,W., Han,B., Liu,H., Zheng,D., Li,Q., Dong,W., Yan,J.,
            Gao,M., Berry,C. and Yuan,Z.
  TITLE     Complete genome sequence of the mosquitocidal bacterium Bacillus
            sphaericus C3-41 and comparison with those of closely related
            Bacillus species
  JOURNAL   J. Bacteriol. 190 (8), 2892-2902 (2008)
   PUBMED   18296527
REFERENCE   2  (bases 1 to 4639821)
  AUTHORS   Yuan,Z., Hu,X., Zheng,D., Yan,J. and Cai,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2007) State Key Laboratory of Virology, Wuhan
            Institute of Virology, Chinese Academy of Sciences, Wuchang
            Xiaohongshan Zhongqu 44, Wuhan, Hubei 430071, P.R.China
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Bacillus sphaericus C3-41 is available from Wuhan Institute of
            Virology, Chinese Academy of Sciences. Email address: yzm@wh.iov.cn
            DNA used for sequencing was isolated from B. sphaericus C3-41
            following standard protocols.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 01/21/2015 18:31:54
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 457180)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,668
            CDS                          :: 4,248
            Pseudo Genes                 :: 304
            CRISPR Arrays                :: 1
            rRNAs                        :: 31 ( 5S, 16S, 23S )
            tRNAs                        :: 85
            ncRNA                        :: 0
            Frameshifted Genes           :: 269
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4639821
                     /organism="Lysinibacillus sphaericus C3-41"
                     /mol_type="genomic DNA"
                     /strain="C3-41"
                     /db_xref="taxon:444177"
     gene            join(4639668..4639821,1..1198)
                     /locus_tag="BSPH_RS00005"
                     /note="chromosomal replication initiation protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319622"
     gene            1369..2505
                     /locus_tag="BSPH_RS00010"
                     /old_locus_tag="Bsph_0005"
                     /db_xref="GeneID:6022198"
     CDS             1369..2505
                     /locus_tag="BSPH_RS00010"
                     /old_locus_tag="Bsph_0005"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_012291829.1"
                     /db_xref="GI:501248811"
                     /db_xref="GeneID:6022198"
                     /translation="MKFDILRDRLLEGLNDVMKAVSSKTTIPILTGIKIDVTEEGIRL
                     TGSDADITIQTFIPVEEDGQQIIHIAETGSIVVQARMFNEIIRKLPTNDVEIQVTPGF
                     QTHIRSGKSEFHLIGSDAAEYPLLPELTEDQKFTIPADLLKTIIRETVFAVATSESRP
                     VLTGVNWQIKNETLICVATDSHRLARRKVQLENLPEVEHSVVIPGKSLNELNKVLEDS
                     TNLVQIVITSQQVLFKTGDVLFFSRLLEGNYPDTSRLIPEEYQTNVTINGKSLLQAID
                     RASLVARGDRNNVVRFEILGHQAVEVSSNSPEIGKVQEEIPVESLEGEGLKISFSAKY
                     MMEALKAIDGQDVVIQFTGAMRPFILRSVHDDAILQLILPVRTY"
     gene            2617..2841
                     /locus_tag="BSPH_RS00015"
                     /old_locus_tag="Bsph_0006"
                     /db_xref="GeneID:6022548"
     CDS             2617..2841
                     /locus_tag="BSPH_RS00015"
                     /old_locus_tag="Bsph_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008177990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291830.1"
                     /db_xref="GI:501248812"
                     /db_xref="GeneID:6022548"
                     /translation="MQDIKIDEEFITLGQLLKISDAISSGGMAKWFLQENAVYVNGEV
                     DDRRGRKLRNGDVVNIPGCGRFQIVGPTGQ"
     gene            2845..3960
                     /locus_tag="BSPH_RS00020"
                     /old_locus_tag="Bsph_0007"
                     /db_xref="GeneID:6022549"
     CDS             2845..3960
                     /locus_tag="BSPH_RS00020"
                     /old_locus_tag="Bsph_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HS35.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase F"
                     /protein_id="WP_012291831.1"
                     /db_xref="GI:501248813"
                     /db_xref="GeneID:6022549"
                     /translation="MHIEQIKLTNYRNYDALALNFSPKINVFIGENAQGKTNVMESIY
                     VLAMAKSHRTTNDKELIRWDSDYGKIEGAVQKRHGILPIELTITKKGKKGKINHIEQS
                     RLSHYIGQMNVVMFAPEDLNVVKGSPQIRRRFIDMEIGQISPVYLHDLLTFQKVLKQR
                     NHFLKMNQGKSMSNDVMYEVYNEQYIHAATQIIRKRFQFMDLLQEWAEPIHAGISQGK
                     ETLIIKYRTVAGIEKEHSSSEIENTLHQKLMEAREREFDRGVTLVGPHRDDLQFLVNG
                     YDVQTYGSQGQQRTTALSLKLAEIELIKQETNETPILLLDDVLSELDDYRQSHLLNTI
                     QGEVQTFVTTTSVEGIHHETMEQAQLFHVKQGAIEKS"
     gene            4062..5987
                     /gene="gyrB"
                     /locus_tag="BSPH_RS00025"
                     /old_locus_tag="Bsph_0008"
                     /db_xref="GeneID:6022550"
     CDS             4062..5987
                     /gene="gyrB"
                     /locus_tag="BSPH_RS00025"
                     /old_locus_tag="Bsph_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374197.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_036162957.1"
                     /db_xref="GI:738207046"
                     /db_xref="GeneID:6022550"
                     /translation="MAIENEGLQNQAYEADQIQVLEGLEAVRKRPGMYIGSTSSKGLH
                     HLVWEIVDNSIDEALAGFCTDIQVTIEKENWIRVEDNGRGIPVSIQEKMGKPAVEVIM
                     TVLHAGGKFGGGGYKVSGGLHGVGASVVNALSVETIVQVHREGHIHEIKFQRGKTIQE
                     LKIIGDTDRNGTTTRFKADPEIFKETTVYEYDILAHRIRELAYLNRGIKITIADEREG
                     EERSTTYHYEGGIRSYVEHLNQSKEPIHDPIDVLGEKDGISVEIAMQYNAGFSSNIFS
                     FANNINTYEGGTHESGFKTALTRVINDYARKGGLLKEADANLTGEDVREGLTAIVSVK
                     HPDPQFEGQTKTKLGNSEVSQITNSLFSDGFERFMLENPTVARKVVEKGLMAARARVA
                     AKKAREFTRRKNALEVSSLPGKLADCSSTNPADCEIYIVEGDSAGGSAKSGRDRHFQA
                     ILPLRGKILNVEKARLDKILSNAEIRAMITAFGTGIGEEFNLEKARYHKIIIMTDADV
                     DGAHIRTLLLTFFFRFLRPLIEAGYIYIAQPPLYQVKQGKHVEYCYDDETLKEILERL
                     PKMPKPNVQRYKGLGEMNAEQLWDTTMDPEHRTLLQVELDDAIKANQAFERLMGDEVE
                     PRRQFIEENAVYANLDI"
     gene            6013..8478
                     /locus_tag="BSPH_RS00030"
                     /old_locus_tag="Bsph_0009"
                     /db_xref="GeneID:6022551"
     CDS             6013..8478
                     /locus_tag="BSPH_RS00030"
                     /old_locus_tag="Bsph_0009"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="WP_012291833.1"
                     /db_xref="GI:501248815"
                     /db_xref="GeneID:6022551"
                     /translation="MSEQERSGVKGINITEEIETSFLDYAMSVIVSRALPDVRDGLKP
                     VHRRILYGMQELGNTADKPYKKSARIVGDVMGKYHPHGDSSIYDAMVRMAQDFSYRYM
                     LVDGHGNFGSVDGDGAAAMRYTESRMSKIAMEMLRDINKDTIDYTDNYDGSEKEPIVL
                     PSRYPNLLVNGAAGIAVGMATNIPPHHLGETIDAVIALSENPAITTEELMEIIPGPDF
                     PTGGLILGRSGIRRAYESGRGSIIIRAKVEIEQKANGKETILVHELPYQVNKAKLIEK
                     IAELVRDKKIDGITNLRDESDRRGMRVVIEVRKDANANVVLNNLYKQTAMQSSFGINM
                     LSLVNGQPKVLGLKEMLYHYLEHQKVIIRRRTEFDLRKAEDRAHILEGLRIALDHIDE
                     IIAIIRGSRSGEEAKPQLMERFNLSERQAQAILDMRLVRLSGLEREKIEAEYQELQVL
                     IAELKAILADEAKIVDIIRTEILELKDRYSDTRRTEITSGGIEMIEDEDLIPVENSVV
                     TLTHNGYIKRLAANTYRSQKRGGRGVQGMGTNEDDFVEHLMNTSTHDTILFFTSKGKV
                     FRAKGYEIPEYGRTAKGLPIVNLLNIDKGEKVTAMIRVGSFDEDAYFIFTTKTGITKR
                     TPVSQFANIRTNGLIAISLREDDDLISVRLTDGDKQIIIGTRDGMLVRFQEDDIRSMG
                     RTAGGVRGIKLRDGDEVVGMEIVEPGQEILVVTEKGYGKRTSEDDYRLQSRGGVGLKT
                     MQITDKNGPMVAVKTVDGSEDIMLITINGMLIRMDVNDISLIGRSTQGVRLIRLGDDE
                     LVATVAKVEKEEELPEDEEEIEE"
     gene            8620..9702
                     /locus_tag="BSPH_RS00035"
                     /old_locus_tag="Bsph_0010"
                     /db_xref="GeneID:6022552"
     CDS             8620..9702
                     /locus_tag="BSPH_RS00035"
                     /old_locus_tag="Bsph_0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008177998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic di-GMP phosphodiesterase"
                     /protein_id="WP_012291834.1"
                     /db_xref="GI:501248816"
                     /db_xref="GeneID:6022552"
                     /translation="METIHVPISELGVGRVISEDIFANTQYPIIFKDTTISHVHLQVF
                     QAFNIFNVPVYKNQNDIHSEKREIDVEVVVEDIPTFRKSYNHSIEQFKKEFKNWEAGS
                     KVDIAKARTIILPLVEMVLEDRTIIFDLNEFSNPKDYLYHHCVATALISSVVAQKLGY
                     DRGTTIQIAIGGLLADCGMAKVHPRIRDKKTPLTEQEFDEIYKHPIYSYNMVKDLTIL
                     KETMKEAIFQHHERLNGSGYPKGEKIANISIFAQIIAVADVFHAMTCERVYRSKQSSF
                     KVIEMINESEFGKFDIKVVRALIDIVADLPIGTIVELSNLERGEVMFVNKFAPTRPLI
                     KLVHTGEIFDLGKNRSFYISRIITNL"
     gene            10093..11646
                     /locus_tag="BSPH_RS00040"
                     /old_locus_tag="Bsph_rRNA0116S"
                     /db_xref="GeneID:6022553"
     rRNA            10093..11646
                     /locus_tag="BSPH_RS00040"
                     /old_locus_tag="Bsph_rRNA0116S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022553"
     gene            11736..11812
                     /locus_tag="BSPH_RS00045"
                     /old_locus_tag="Bsph_tRNA1"
                     /db_xref="GeneID:6021975"
     tRNA            11736..11812
                     /locus_tag="BSPH_RS00045"
                     /old_locus_tag="Bsph_tRNA1"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11770..11772,aa:Ile,seq:gat)
                     /db_xref="GeneID:6021975"
     gene            11825..11900
                     /locus_tag="BSPH_RS00050"
                     /old_locus_tag="Bsph_tRNA2"
                     /db_xref="GeneID:6021976"
     tRNA            11825..11900
                     /locus_tag="BSPH_RS00050"
                     /old_locus_tag="Bsph_tRNA2"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11858..11860,aa:Ala,seq:tgc)
                     /db_xref="GeneID:6021976"
     gene            12114..15048
                     /locus_tag="BSPH_RS00055"
                     /old_locus_tag="Bsph_rRNA0123S"
                     /db_xref="GeneID:6022017"
     rRNA            12114..15048
                     /locus_tag="BSPH_RS00055"
                     /old_locus_tag="Bsph_rRNA0123S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6022017"
     gene            15230..15345
                     /locus_tag="BSPH_RS00060"
                     /old_locus_tag="Bsph_rRNA015S"
                     /db_xref="GeneID:6022018"
     rRNA            15230..15345
                     /locus_tag="BSPH_RS00060"
                     /old_locus_tag="Bsph_rRNA015S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6022018"
     gene            15617..16510
                     /locus_tag="BSPH_RS00065"
                     /old_locus_tag="Bsph_0014"
                     /db_xref="GeneID:6022019"
     CDS             15617..16510
                     /locus_tag="BSPH_RS00065"
                     /old_locus_tag="Bsph_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008181694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291836.1"
                     /db_xref="GI:501248818"
                     /db_xref="GeneID:6022019"
                     /translation="MWIDGVFSGGGLKGFALVGAYQVLEDENFRFKRVAGTSAGAILA
                     AFIAAGYSGREIEMMLEELDVPSLLDSRRTILPFPFMKWINVYNHLGLYKGKALEKWF
                     FKKLAEKGVYTFGDLPKDSLKLVASDLTNGRMIVLPDDLHKYEIDAKNFSVACALRMS
                     CGIPFFFEPVTLKTGKGESIIVDGGVLSNFPLWIFDDREGRKVRPILGLKLSRRREEQ
                     CPHEIKNGLNLFEALFSTMKDAHDERYISRRHERDIIFIPVEDYSATQFDLNEETKET
                     LLEIGRNRTIQFLRNWPRLRL"
     gene            16810..18366
                     /locus_tag="BSPH_RS00070"
                     /old_locus_tag="Bsph_rRNA0216S"
                     /db_xref="GeneID:6022020"
     rRNA            16810..18366
                     /locus_tag="BSPH_RS00070"
                     /old_locus_tag="Bsph_rRNA0216S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022020"
     gene            18456..18532
                     /locus_tag="BSPH_RS00075"
                     /old_locus_tag="Bsph_tRNA3"
                     /db_xref="GeneID:6022021"
     tRNA            18456..18532
                     /locus_tag="BSPH_RS00075"
                     /old_locus_tag="Bsph_tRNA3"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:18490..18492,aa:Ile,seq:gat)
                     /db_xref="GeneID:6022021"
     gene            18545..18620
                     /locus_tag="BSPH_RS00080"
                     /old_locus_tag="Bsph_tRNA4"
                     /db_xref="GeneID:6022571"
     tRNA            18545..18620
                     /locus_tag="BSPH_RS00080"
                     /old_locus_tag="Bsph_tRNA4"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:18578..18580,aa:Ala,seq:tgc)
                     /db_xref="GeneID:6022571"
     gene            18834..21765
                     /locus_tag="BSPH_RS00085"
                     /old_locus_tag="Bsph_rRNA0223S"
                     /db_xref="GeneID:6022572"
     rRNA            18834..21765
                     /locus_tag="BSPH_RS00085"
                     /old_locus_tag="Bsph_rRNA0223S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6022572"
     gene            21950..22065
                     /locus_tag="BSPH_RS00090"
                     /old_locus_tag="Bsph_rRNA025S"
                     /db_xref="GeneID:6021890"
     rRNA            21950..22065
                     /locus_tag="BSPH_RS00090"
                     /old_locus_tag="Bsph_rRNA025S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6021890"
     gene            22358..23821
                     /locus_tag="BSPH_RS00095"
                     /old_locus_tag="Bsph_0017"
                     /db_xref="GeneID:6021891"
     CDS             22358..23821
                     /locus_tag="BSPH_RS00095"
                     /old_locus_tag="Bsph_0017"
                     /EC_number="1.1.1.205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016995109.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine 5'-monophosphate dehydrogenase"
                     /protein_id="WP_012291837.1"
                     /db_xref="GI:501248819"
                     /db_xref="GeneID:6021891"
                     /translation="MWETKFAKEGLTFDDVLLVPAHSEVLPKDVDLSVQLTPKIKLNI
                     PMISAGMDTVTESKMAIAMARQGGIGIIHKNMGIDEQAEQVEKVKRSENGVITNPFFL
                     TPTHQVFDAEHLMGKYRISGVPIVDSMENQKLVGIITNRDLRFISDYSLKIEDVMTKE
                     DLITAPVGTTLEDAEKILQQYKIEKLPIVDEEGRLTGLITIKDIEKVIEFPNAAKDTH
                     GRLLVGAAVGVSKDTMVRIEKLVEAQVDIVVIDTAHGHSEGVLQTIRSIRETYPELEI
                     IAGNVATAEGARALFEAGADVVKVGIGPGSICTTRVVAGVGVPQITAVYDCATVAREL
                     GKTIIADGGIKYSGDIVKALAAGGNVVMLGSLLAGTSESPGETEIFQGRRFKVYRGMG
                     SIGAMEKGSKDRYFQEDAKKLVPEGIEGRLPYKGPLADTIYQLIGGIRAGMGYCGAPH
                     LEYLRENAQFVKMTGAGLRESHPHDVQITKESPNYSM"
     gene            23975..25294
                     /locus_tag="BSPH_RS00100"
                     /old_locus_tag="Bsph_0018"
                     /db_xref="GeneID:6021892"
     CDS             23975..25294
                     /locus_tag="BSPH_RS00100"
                     /old_locus_tag="Bsph_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_036162495.1"
                     /db_xref="GI:738206582"
                     /db_xref="GeneID:6021892"
                     /translation="MNTVLRLLLIPVLLIGIFAGIPAKASAETDLGLTVDAAILIDAD
                     SGKILYEQNADTSLGIASMTKMMTEYLLLDAIDAGTVKWDQEYHVTDYTYRMSQNRAL
                     SNVPLRRDGSYTIRELYEAMAIYSANAATVAIAETIAGTETEFLKLMNKKAEELGLEG
                     YKFVNATGLNNADLFGMHPAGTGPEDENVMPAKYVAKLAYHLLKDHPKVLETSQITKK
                     TFREGTEDAIEMSNWNFMLPGLVFEYQGVDGLKTGTTNFAGHCFTGTAERNGTRLIAV
                     VMKAVDASGQGSYKARFDATAKLFNYGFSQFSKQEILPANYTFKDQKTVKVTKGKEDK
                     VEIAVKEPISFMIKSSDKDLYKPKLVLDKKSLEAGVKKDTVVGKVVIERTEGTDYGFI
                     DGKDISSDIVTTGSVERASGISLFFQGIGNFFGNLWSGISDFVGGLF"
     gene            25395..27230
                     /locus_tag="BSPH_RS00105"
                     /old_locus_tag="Bsph_0019"
                     /db_xref="GeneID:6022059"
     CDS             25395..27230
                     /locus_tag="BSPH_RS00105"
                     /old_locus_tag="Bsph_0019"
                     /EC_number="6.3.5.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="WP_012291839.1"
                     /db_xref="GI:501248821"
                     /db_xref="GeneID:6022059"
                     /translation="MCGITGWASFQKNLKASEKVLQAMTRTLNRRGPDDENIWCSEHI
                     AFGHRRLAVIDLIGGKQPMKKLHDGINYVITYNGELYNTEELRKELEKRGHTFTTHSD
                     TEVLLTAYIEWKEQCVDFLNGIFAFGIWDEQEQSLFLCRDRLGVKPLYFTEQQGGILF
                     ASEVKALLAHPMVQAAINTEGLASMMAVGPSRAPGKTLFQNIEELRPGFAMRFSREGL
                     RKWQYWQLQSRKHEETLEETIEQVRWLLTDAIERQLISDVPICTFLSGGLDSSIITGI
                     AADRFRQQNNQLHTYSIDYEDNERFFNPHAFQTSTDTYWIQKMTEAFKTTHHAEEITQ
                     QQLIDLLVESVIVRDSPGMADVDSSLLWFCREIKRDFTVALSGECADEIFGGYPWFKE
                     KTTGFPWIRSLAERNAILQEKWDKKLKIESYAQQLYTQTITEVPLLDGESPAEVKHRE
                     MFYLNMQWFMQTLLERKDRMSMGASLEVRVPFADHRLVEYAWNIPWEMKNLDGIEKGL
                     LRKSMAHLLPDEVLYRKKNPYPKTYHPVYTAGVQTWLREILKDKNSILHELFEYKKLT
                     ELIESGGSSFKIPWYGQLMAGPQLLAYLGQIHSWFEHYHIQLIES"
     gene            complement(27248..28669)
                     /locus_tag="BSPH_RS00110"
                     /old_locus_tag="Bsph_0020"
                     /db_xref="GeneID:6022060"
     CDS             complement(27248..28669)
                     /locus_tag="BSPH_RS00110"
                     /old_locus_tag="Bsph_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_036162497.1"
                     /db_xref="GI:738206584"
                     /db_xref="GeneID:6022060"
                     /translation="MLLFQLERNGDKPLYDQLYNGIKEAIISKKIAVGEKLPSKRKLA
                     DFLNISQTTIEIAYAQLLAEGYIMSKSRVGYFVEEIDELPYIQQDIVIPFNEHVKKKS
                     YKIDFNPGSIDIDAFPFQIWRKYAKELFDEASKNLLLTGEPQGELSLRTEIANYLYQS
                     RGVICNPEQIVVGSGTEQLLPMILRLFRDDTCFALENPGYPAVHRMFSQHKRKVYPIA
                     VDEEGIVIHELERTQANVVYITPSHQFPTGAVLSATRRAQALNWAAQSSSRYIIEDDY
                     DSEFRYTGKPIPALHALDRNDKVIYMSTFTKSLMPSLRVAYFVLPPQLLATYNDVFNY
                     YSSTVPRFDQHIVANFMHDGHFAKHLNRMRKVYRKKHDQLTSILEKYSSSIKITGEQA
                     GMHILLDVKHELPEKQLQQLAFYAGIGIYPLSDYRLDHGESSQAQFLLGFGGIPVHVI
                     EQSIEQLMDCWGIQKNNPSTTTK"
     gene            28779..29663
                     /locus_tag="BSPH_RS00115"
                     /old_locus_tag="Bsph_0021"
                     /db_xref="GeneID:6022061"
     CDS             28779..29663
                     /locus_tag="BSPH_RS00115"
                     /old_locus_tag="Bsph_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal biosynthesis protein"
                     /protein_id="WP_012291841.1"
                     /db_xref="GI:501248823"
                     /db_xref="GeneID:6022061"
                     /translation="MKQTGTNLVKRGMAEMQKGGVIMDVINAEQAKIAEAAGAVAVMA
                     LERVPSDIRKAGGVARMADPRIVEEVLGAVSIPVMAKARIGHIVEARVLEAMGVDYID
                     ESEVLTPADEEYHLLKSNYTVPFVCGCRDLGEAARRIGEGAAMLRTKGEPGTGNIVEA
                     VRHIRKVNAQVRKVVGMTEDELMTEAKLLGAPFELLREIKRLGRLPVVNFAAGGVATP
                     ADAALMMELGADGVFVGSGIFKSDNPEKFAHAIVEATTHYKDYKLIAEISKELGVPMK
                     GIDIAQLGLNERMQERGW"
     gene            29665..30228
                     /locus_tag="BSPH_RS00120"
                     /old_locus_tag="Bsph_0022"
                     /db_xref="GeneID:6022062"
     CDS             29665..30228
                     /locus_tag="BSPH_RS00120"
                     /old_locus_tag="Bsph_0022"
                     /EC_number="2.6.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179657.1"
                     /note="with PdxST is involved in the biosynthesis of
                     pyridoxal 5'-phosphate; PdxT catalyzes the hydrolysis of
                     glutamine to glutamate and ammonia; PdxS utilizes the
                     ammonia to synthesize pyridoxal 5'-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_012291842.1"
                     /db_xref="GI:501248824"
                     /db_xref="GeneID:6022062"
                     /translation="MKRIGVLALQGAVREHVQMLESLGCEAVEVKHKQDLVKLDGLVL
                     PGGESTTMRKLLDRFELLEPIREIAQRGLPMFGTCAGLILMATTLVNDEPHLAVMDVT
                     VARNSYGRQVDSFEVMLDIPKIGEAIPAVFIRAPHIVKVGKDVEILAEHEGKIILAQD
                     RHLLGCSFHPELTSDTRILEYFVASMV"
     misc_feature    30278..30495
                     /note="T-box leader; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            30638..31918
                     /locus_tag="BSPH_RS00125"
                     /old_locus_tag="Bsph_0023"
                     /db_xref="GeneID:6022063"
     CDS             30638..31918
                     /locus_tag="BSPH_RS00125"
                     /old_locus_tag="Bsph_0023"
                     /EC_number="6.1.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="WP_012291843.1"
                     /db_xref="GI:501248825"
                     /db_xref="GeneID:6022063"
                     /translation="MLDIKRVRDNFAEIKEMLLTRNEDLGNLDDFENLDAKRRELIAK
                     TEELKAERNKVSEQISVMKRNKENADEVIARMRQVGDEIKELDIQLNDVEDRFKDMMM
                     RLPNVPHESVPVGTTEDDNVEEYTWGEIPAFDFEIKAHWDLATDLKIVDFERGAKVTG
                     SRFLFYRGLGARLERALMTFMMDLHAEEHGYEEMLPPVIVNRESLTGTGQLPKFEEDV
                     FKLAETDYFMIPTAEVPVTNFYRDEILTAEALPQGFAAYSACFRSEAGSAGRDTRGLI
                     RQHQFNKVELVRFVKPEESYEQLELLTGHAEKVLQLLGLPYRKLKMCTADLGFTAAKK
                     YDLEVWIPAQNMYREISSCSNFEDFQARRANIRFRREPNAKPEYVHTLNGSGLAIGRT
                     VAAILENYQQADGSVVIPEVLRPYMGGKEVIAPK"
     gene            complement(32373..32855)
                     /locus_tag="BSPH_RS00130"
                     /old_locus_tag="Bsph_0024"
                     /db_xref="GeneID:6022342"
     CDS             complement(32373..32855)
                     /locus_tag="BSPH_RS00130"
                     /old_locus_tag="Bsph_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_036162500.1"
                     /db_xref="GI:738206587"
                     /db_xref="GeneID:6022342"
                     /translation="MKQALEEAKKAAILGEVPIGAVLVYDGEIIARAHNLRETTQNAT
                     THAELMVIQEACQKIGSWRLEKTTLYVTLEPCPMCAGAILQSRVPRVVYGARDIKAGC
                     VDSLYRILNDARFNHECEVSEGILADECGQILTDFFRALRERKKAEKKTRQAAMTEKN
                     "
     gene            33070..33399
                     /locus_tag="BSPH_RS00135"
                     /old_locus_tag="Bsph_0025"
                     /db_xref="GeneID:6022343"
     CDS             33070..33399
                     /locus_tag="BSPH_RS00135"
                     /old_locus_tag="Bsph_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_012291845.1"
                     /db_xref="GI:501248827"
                     /db_xref="GeneID:6022343"
                     /translation="MDEEIKITKMENSQHLDDETLFVVSQTFKALSDPTRIRILNLLC
                     ADEHSVNDIAEILDLGQSTVSHQLRFLKNLRLVKFRREGTTLFYSKDDDHIMNLLKQA
                     IEHAAHN"
     gene            33418..34365
                     /locus_tag="BSPH_RS00140"
                     /old_locus_tag="Bsph_0026"
                     /db_xref="GeneID:6022344"
     CDS             33418..34365
                     /locus_tag="BSPH_RS00140"
                     /old_locus_tag="Bsph_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_012291846.1"
                     /db_xref="GI:501248828"
                     /db_xref="GeneID:6022344"
                     /translation="MGHNHDHGHDHTHGANKKVLIVSFIIITSYMVVEAIGGFLTNSL
                     ALLSDAGHMLSDSISLAIALLAFVFGEKAASYSKTYGYKRFEILAAVLNGVTLIGIAL
                     FIFYEAIERFANPPEVATTGMLIISTIGLLVNILVAWIMMRGSDTKDNLNMRGAFLHV
                     LSDMLGSVGAIVAALLIMFFGWGWADPLASVIVALLVIRSGYYVTKSAIHVLMEGTPS
                     NVDVQEIIQLIEQTDGVESIHDLHIWTITSGTNALSCHAVVNKYLKIVDGEHILRKIE
                     HNLEHKGIKHVTIQLETASHPHESSILCQLKNVHEHHHE"
     gene            34435..34767
                     /locus_tag="BSPH_RS00145"
                     /old_locus_tag="Bsph_0027"
                     /db_xref="GeneID:6022345"
     CDS             34435..34767
                     /locus_tag="BSPH_RS00145"
                     /old_locus_tag="Bsph_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008179668.1"
                     /db_xref="GI:495454974"
                     /db_xref="GeneID:6022345"
                     /translation="MEDIVKEDACHTEGATSCRKSHHPERVKKDLTTRLNRIEGQIRG
                     IKGMIEKDVYCDDVITQLSATQSALNSVAKILLEGHLKGCVVDRLSEGDDAVLDELVV
                     TIQKLMKK"
     gene            34802..35008
                     /locus_tag="BSPH_RS00150"
                     /old_locus_tag="Bsph_0028"
                     /db_xref="GeneID:6022346"
     CDS             34802..35008
                     /locus_tag="BSPH_RS00150"
                     /old_locus_tag="Bsph_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper chaperone CopZ"
                     /protein_id="WP_012291847.1"
                     /db_xref="GI:501248829"
                     /db_xref="GeneID:6022346"
                     /translation="MQNVTLNVQGMSCGHCVNAVEKNVGALTGVEQVKVNLAEGLVDV
                     AFDDAQVSLDQIKETIDDQGYEVK"
     gene            35090..37501
                     /locus_tag="BSPH_RS00155"
                     /old_locus_tag="Bsph_0029"
                     /db_xref="GeneID:6022625"
     CDS             35090..37501
                     /locus_tag="BSPH_RS00155"
                     /old_locus_tag="Bsph_0029"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase P"
                     /protein_id="WP_012291848.1"
                     /db_xref="GI:501248830"
                     /db_xref="GeneID:6022625"
                     /translation="MSSDHKEANLQITGMTCAACATRIEKGLNKMDGVEQATVNLALE
                     KSSIKYDPAKLSEADFEKKIEALGYGVVKQKTELDITGMTCAACATRIEKRLNKMSGV
                     SSANVNLALEKAMIEFNPSEVNIADIIAKVEKLGYGAHQKADEQETEDHREKVIKQQQ
                     QKFILSAILSLPLLWTMVGHFSFTSFLYVPEFLMNPWVQMVLATPVQFIIGKQFYVGA
                     YKALRNGSANMDVLVVMGTSAAYFYSVYQAIVTIGTHHGPHLYFETSAVLITLILLGK
                     LFEAKAKGRSSEAIKKLMGLQAKTAIVVRDGMEREVPLEEVMIGDVILVKPGEKIPVD
                     GEVLEGTTAVDESMLTGESLPVDKKQGDQLFGSTINKNGFIKMTATKVGRDTALAQII
                     KVVEDAQGSKAPIQRLADQISGVFVPIVVGIAIVTFIVWIIWVRPGEFTPALEVLIAV
                     LVIACPCALGLATPTSIMAGSGRAAEFGILFKGGEHLEQTQSIDTVVVDKTGTVTHGK
                     PVLTDVLLAPDQEETHFLSLIGAAEKQSEHPLAEAIVHGIEERGIALGDVQFFEAIPG
                     YGVQATVSGQGVIIGTRKLMQQYGIQLDNILPKMEELERNGKTAMLAAINGQYAGVVA
                     VADTVKDTSKEAIHRLQDMGITVIMMTGDNERTAQAIGTEVGVNQVIAEVLPEGKADE
                     VKKLQAQGKNVAMVGDGINDAPALATANIGMAIGTGTDVAMEAADITLIRGDLNSIAD
                     AILMSRKTMRNIKQNLFWAFAYNTLGIPIAAIGLLAPWVAGAAMAFSSVSVVLNALRL
                     QRVKL"
     gene            37688..38323
                     /locus_tag="BSPH_RS00160"
                     /old_locus_tag="Bsph_0030"
                     /db_xref="GeneID:6022626"
     CDS             37688..38323
                     /locus_tag="BSPH_RS00160"
                     /old_locus_tag="Bsph_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosine kinase"
                     /protein_id="WP_036160336.1"
                     /db_xref="GI:738204418"
                     /db_xref="GeneID:6022626"
                     /translation="MTVPFVTVEGPIGVGKTSLSKEIAATFNYHLLKEIVDENPFLNK
                     FYENIEEWSFQTEMFFLCNRYKQLTDIKKFRLAHAKPVVADYHIFKNLIFAKRTLAST
                     EYEKYEEIYKILTKDMPVPNVVVYLHASVETLMKRIAMRGRDFEKMISRDYMEQLVID
                     YHSFIEHFEKMHPEIPVIRFNGDQLDFVKNPDDLNYVLKIIKDTLQKRSLQ"
     gene            38323..38991
                     /locus_tag="BSPH_RS00165"
                     /old_locus_tag="Bsph_0031"
                     /db_xref="GeneID:6022627"
     CDS             38323..38991
                     /locus_tag="BSPH_RS00165"
                     /old_locus_tag="Bsph_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidine kinase"
                     /protein_id="WP_012291850.1"
                     /db_xref="GI:501248832"
                     /db_xref="GeneID:6022627"
                     /translation="MNLREKYDIPPQTVITIAGTVGVGKSTMTKALAEALNFRTSFEK
                     VDTNPYLDKFYEDFEKWSFHLQVYFLAERFKEQKRIFEYGGGFIQDRSIYEDTGIFAK
                     MHYDKGTMSPTDYETYTNLFDAMVMTPYFPHPDLLVYLEGPIDAVIGRIQERGRAMEQ
                     QTPNDYWIEMHERYENWINNFNSCPVLRLDINDYDLLKNPDAIESIVSRIGHMLKQTS
                     HLRK"
     gene            39081..39608
                     /locus_tag="BSPH_RS00170"
                     /old_locus_tag="Bsph_0032"
                     /db_xref="GeneID:6022628"
     CDS             39081..39608
                     /locus_tag="BSPH_RS00170"
                     /old_locus_tag="Bsph_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291851.1"
                     /db_xref="GI:501248833"
                     /db_xref="GeneID:6022628"
                     /translation="MYCGSGIGRSPVYGEKAAELGAVLAKHGHGVVYGGSKTGLMGKV
                     ADAVLAAGGEVIGVMPTHLQKRELAHASLTEIHFVESMHIRKAKMAELADAFIALPGG
                     AGTLDEYFEVFTWAQIGLHEKPVILYNVNGFYDALLQHFKIMLEEGFIRSEQKSFFRI
                     ANTADDILRLLKKHG"
     gene            39673..40581
                     /locus_tag="BSPH_RS00175"
                     /old_locus_tag="Bsph_0033"
                     /db_xref="GeneID:6022629"
     CDS             39673..40581
                     /locus_tag="BSPH_RS00175"
                     /old_locus_tag="Bsph_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012291852.1"
                     /db_xref="GI:501248834"
                     /db_xref="GeneID:6022629"
                     /translation="MQGADTQVTDDLVVQAIERNIAIIRFDMDRRVAYVNELFAKTLG
                     YTVQELLGKNHKDFCLPNFVHSPAYEQFWRNLVAGNSYQDKIERIDANGHRVWLEATY
                     MPVFANHSNKVIGVSKIATNITERQNEITNVADQLKEMSNGLHQRSETGIQNSQELLS
                     TIQEVSQESKENVSNLTQLQNQADSIKGIVKTIQEIAAQTNLLALNAAIEAARAGEYG
                     RGFDVVAKEVRKLSVRVEQSISEVKDNIEGIEREISQVTDSITKIAEKVEKTHEQITI
                     TTKDFSEIATAAEALDEQSKQFIEII"
     gene            40676..41296
                     /locus_tag="BSPH_RS00180"
                     /old_locus_tag="Bsph_0034"
                     /db_xref="GeneID:6022592"
     CDS             40676..41296
                     /locus_tag="BSPH_RS00180"
                     /old_locus_tag="Bsph_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_031418655.1"
                     /db_xref="GI:670470036"
                     /db_xref="GeneID:6022592"
                     /translation="MTKVEVSFQHVPTTAISDATGGHTNLCSTIKPLADHFKIAGRAV
                     TVRLPDGENGAVLEAIRAANEGDILVIDAKGNTNRAVAGDFVVSLAKGVGVQGFVVDG
                     VIRDIAAIRELDFPVFSLGTTVAAGNKNGGGKVNVPIAIGGVTVHPGDYIIGDVDGVI
                     VVPQQDAEKVIEAAEEKMLKDEKRAQEAHANGKESILAYLDKVLGN"
     gene            complement(41342..42616)
                     /locus_tag="BSPH_RS00185"
                     /old_locus_tag="Bsph_0035"
                     /db_xref="GeneID:6022593"
     CDS             complement(41342..42616)
                     /locus_tag="BSPH_RS00185"
                     /old_locus_tag="Bsph_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proton glutamate symport protein"
                     /protein_id="WP_012291854.1"
                     /db_xref="GI:501248836"
                     /db_xref="GeneID:6022593"
                     /translation="MKKKFKISLAAQILIGLILGIIVGGIFYGNPKIETYLQPLGDIF
                     LHLIKMIVVPIIISTLIVGVAGTGDMKQLGRLGGKSIIYFEIITTVAILVGLLSANIF
                     QPGAGINMSELSQGDISKYVTTTEEVQHEGPFDIIVGIVPTNIIQSMAEGNMLAIIFF
                     SVIFGLGVAAVGERGKPVLDFFQGVADAMFWVTNLVMKFAPIGVFGLIGVTVSKYGFA
                     SLVPLAKLAILVYATMLFFIFVVLGLVAKFAGISIFYLIKVLKDELILAFSTASSEAV
                     LPRIMLKMEKLGAPKDIVSFVIPTGYSFNLDGSTLYQAIAALFIAQMYGIHLSIGEQI
                     TLMLVLMVTSKGIAGVPGVSFVVLLATLGTVGIPLEGLAFIAGIDRILDMGRTVVNVI
                     GNSLASLVMAKWEGRFDREKMKNYFNENENLA"
     gene            complement(42707..43585)
                     /locus_tag="BSPH_RS00190"
                     /old_locus_tag="Bsph_0036"
                     /db_xref="GeneID:6022594"
     CDS             complement(42707..43585)
                     /locus_tag="BSPH_RS00190"
                     /old_locus_tag="Bsph_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012291855.1"
                     /db_xref="GI:501248837"
                     /db_xref="GeneID:6022594"
                     /translation="MRYFIVDDDRASRVMLKQIIEDSGLGTVIGEARNGEDAIPQILM
                     TQPEFVLIDLLMPKLDGIATVEHLIQNRFEGQFIMISQVVNKEMVGEAYEQGIEFFIH
                     KPINRIEVENVLKKTTEQFRLKNSLLVIRQSLTNIELSEQKANKATSRDHIQSILNDM
                     GIVGEIGSEDIIAIIETLLAHQHKIAPLPPLKELYEEIAAVTKATPDEILKESKAIEQ
                     RVRRTILAAMINLANLGVVDYTNSEFEYYAPRYFDFKEIRQLMTQIEDHDNRKAKVNI
                     KKFIQVLYSDILTKVN"
     gene            complement(43586..44827)
                     /locus_tag="BSPH_RS00195"
                     /db_xref="GeneID:23319623"
     CDS             complement(43586..44827)
                     /locus_tag="BSPH_RS00195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_031419464.1"
                     /db_xref="GI:670470894"
                     /db_xref="GeneID:23319623"
                     /translation="MARTSLTWVILIAIMTAIGSEIKIMPFANTTFRFGLGTIIFFLC
                     TLIKPTPIILAGFATSIVTIFFRVFNSYLHDISVLESIFNHLPAGLFYVLFAICLRIL
                     DVQTYREKPLKLGLLVAFSEVISNLAEQIFRFFVQTYTFLFLHDLLILLAVALLRSFF
                     VVGIYSSILIAEQKKRVQEMLNIGSDLYVETLYLKKSMNHIETITASGFELYRQLKAQ
                     GYRAESLQALHIAQEIHEVKKDSQRIYAGISKIVGERSFGPFVLSELLHYIEDGNSKY
                     AELLGKNIEFQTSIDFDFQTREHIALLALLNNLTANAVEAIEEQGIISIAIQRQEDNT
                     VITICDTGKGISQKDFSIIFEPGFTTKYNIDGVAATGIGLSHVAELIEKLKGSITVES
                     NNQYTTFKIIIPTQTIQTGET"
     gene            complement(44973..45065)
                     /locus_tag="BSPH_RS00200"
                     /old_locus_tag="Bsph_tRNA85"
                     /db_xref="GeneID:6022595"
     tRNA            complement(44973..45065)
                     /locus_tag="BSPH_RS00200"
                     /old_locus_tag="Bsph_tRNA85"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(45027..45029),aa:Ser,seq:tga)
                     /db_xref="GeneID:6022595"
     gene            45646..47433
                     /locus_tag="BSPH_RS00205"
                     /old_locus_tag="Bsph_0038"
                     /db_xref="GeneID:6022596"
     CDS             45646..47433
                     /locus_tag="BSPH_RS00205"
                     /old_locus_tag="Bsph_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_031419466.1"
                     /db_xref="GI:670470896"
                     /db_xref="GeneID:6022596"
                     /translation="MTYQAFYRVYRPQSFREMSGQAHVKRTLQNALLANKTTHAYLFS
                     GPRGTGKTSTAKIFAKALNCEHAPSEEPCNECATCLSITDGSHPDVIEFDAASNSRVE
                     EIRDIIEKVRFAPASSRYKVYIIDEVHMLSTSAFNALLKTLEEPPPHAVFILATTEPH
                     KLPATIISRCQRFDFKRLSTNDIIERMKVVLEDIELPYEEQGLKVIAQSAAGGMRDAL
                     SLLDQVVSFSGEKLKLEDTLLVTGSISQEVFYDLANALKAKDVAQMLALLEQLITDGK
                     DPLRLSEDLITFFRDLLLLQTSEDLAELLELVSPEERVLSLAHEFAPDMLYGYIDILA
                     KTQQEMRFSHHTKIYLETALLKMVQFSGGSTNQAISPTSDTVISPDLAQKIVALEQMV
                     QQLSLQLQSGAPAQASQAPKEQRPRAKNPNGYKAPTGRIQEVLKDATKQDVQRIKSIW
                     AQALNQLQKSQSALLAEAEPVAASSSAFVLKFKYDIHCQMVADNQSLKAHFTQLIAGQ
                     TGIMYEMLCIPEESWLKMREEFIRDHSMQHKKISAASENGEELLEPPPAEISDEPFID
                     DAQPLASQDPLVTEAEKLFGKDFVEIMED"
     gene            47455..47769
                     /locus_tag="BSPH_RS00210"
                     /old_locus_tag="Bsph_0039"
                     /db_xref="GeneID:6022142"
     CDS             47455..47769
                     /locus_tag="BSPH_RS00210"
                     /old_locus_tag="Bsph_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008408640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004233957.1"
                     /db_xref="GI:490354184"
                     /db_xref="GeneID:6022142"
                     /translation="MRGMGNMQGMMKKMQKMQKEMMEAQEALNAEQFEGVAGGGMVKV
                     TVSGQREVVSVNLDESVVDPEDIEMLQDLIVIATNEALKKVEEKTNSTMGKFTQGLNL
                     PF"
     gene            47781..48377
                     /locus_tag="BSPH_RS00215"
                     /old_locus_tag="Bsph_0040"
                     /db_xref="GeneID:6022143"
     CDS             47781..48377
                     /locus_tag="BSPH_RS00215"
                     /old_locus_tag="Bsph_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecR"
                     /protein_id="WP_031419468.1"
                     /db_xref="GI:670470898"
                     /db_xref="GeneID:6022143"
                     /translation="MYYPEPISKLIDSFMKLPGIGPKTAARLAFFVLSMKEEDVLSFS
                     KALIDAKRNLSYCSVCGNITDVDPCHICTDKQRDHSIICVVQDTKDVIAMEKMRDYNG
                     MYHVLQGAISPMDGIGPEDINVASLLVRLHDESVQELILATNSTIEGEATAMYISRLV
                     KPSGIRTTRIAHGLPVGGDLEYADEVTLSKAMEGRREL"
     gene            48391..48606
                     /locus_tag="BSPH_RS00220"
                     /old_locus_tag="Bsph_0041"
                     /db_xref="GeneID:6022144"
     CDS             48391..48606
                     /locus_tag="BSPH_RS00220"
                     /old_locus_tag="Bsph_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008179697.1"
                     /db_xref="GI:495455003"
                     /db_xref="GeneID:6022144"
                     /translation="MFFRSKGKLKKEFDDRLVNLIKETKEDLQQAKIIEELMDDYDLG
                     AIAQRKAAESIHFYLFKEARIRRVLIK"
     gene            48680..48952
                     /locus_tag="BSPH_RS00225"
                     /old_locus_tag="Bsph_0042"
                     /db_xref="GeneID:6022145"
     CDS             48680..48952
                     /locus_tag="BSPH_RS00225"
                     /old_locus_tag="Bsph_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008179699.1"
                     /db_xref="GI:495455005"
                     /db_xref="GeneID:6022145"
                     /translation="MSWLVIMSICVPVGLLFLYVIIRHAKLGKILEGLSVFWFRFAFA
                     FLLLFMIHLGIGYIGYNVPINLFSVLTIAVLGIPGVLGITALIFIL"
     gene            49235..50792
                     /locus_tag="BSPH_RS00230"
                     /old_locus_tag="Bsph_rRNA0316S"
                     /db_xref="GeneID:6022180"
     rRNA            49235..50792
                     /locus_tag="BSPH_RS00230"
                     /old_locus_tag="Bsph_rRNA0316S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022180"
     gene            50882..50958
                     /locus_tag="BSPH_RS00235"
                     /old_locus_tag="Bsph_tRNA5"
                     /db_xref="GeneID:6022181"
     tRNA            50882..50958
                     /locus_tag="BSPH_RS00235"
                     /old_locus_tag="Bsph_tRNA5"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:50916..50918,aa:Ile,seq:gat)
                     /db_xref="GeneID:6022181"
     gene            50971..51046
                     /locus_tag="BSPH_RS00240"
                     /old_locus_tag="Bsph_tRNA6"
                     /db_xref="GeneID:6022182"
     tRNA            50971..51046
                     /locus_tag="BSPH_RS00240"
                     /old_locus_tag="Bsph_tRNA6"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:51004..51006,aa:Ala,seq:tgc)
                     /db_xref="GeneID:6022182"
     gene            51259..54189
                     /locus_tag="BSPH_RS00245"
                     /old_locus_tag="Bsph_rRNA0323S"
                     /db_xref="GeneID:6022831"
     rRNA            51259..54189
                     /locus_tag="BSPH_RS00245"
                     /old_locus_tag="Bsph_rRNA0323S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6022831"
     gene            54374..54489
                     /locus_tag="BSPH_RS00250"
                     /old_locus_tag="Bsph_rRNA035S"
                     /db_xref="GeneID:6022832"
     rRNA            54374..54489
                     /locus_tag="BSPH_RS00250"
                     /old_locus_tag="Bsph_rRNA035S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6022832"
     gene            54601..55041
                     /locus_tag="BSPH_RS00255"
                     /old_locus_tag="Bsph_0046"
                     /db_xref="GeneID:6022833"
     CDS             54601..55041
                     /locus_tag="BSPH_RS00255"
                     /old_locus_tag="Bsph_0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291858.1"
                     /db_xref="GI:501248840"
                     /db_xref="GeneID:6022833"
                     /translation="MATGLYTSEAINIQREKLESFIQNREKWAVLIPGYLHHELLNEN
                     NMIWVFQGDFGIIQKAVKVELQMKSLEPHQVLFDLVGLSDPINGDGLFEIKQHQDESL
                     QLTGSLTMKASGFLSGMMNPVLEKFVPQLVEQLVRQMAVTVAKE"
     gene            55227..56660
                     /locus_tag="BSPH_RS00260"
                     /old_locus_tag="Bsph_0047"
                     /db_xref="GeneID:6021801"
     CDS             55227..56660
                     /locus_tag="BSPH_RS00260"
                     /old_locus_tag="Bsph_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine decarboxylase"
                     /protein_id="WP_012291859.1"
                     /db_xref="GI:501248841"
                     /db_xref="GeneID:6021801"
                     /translation="MFVLQKKKPIIEGLERFRQQQNISFHVPGHKHGELSHLPQAFKD
                     VMRYDVTELSGLDDLHYPEEMILEAEHLLADTYGAMKSFFLVGGSTVGNLAMIYATCQ
                     KGDTIIVQRNAHKSIFHAIELVGAKPIFVSPIWDERTLTATHVTFLDLKEAVENYSEA
                     KAVVLTYPTYYGVTSNEIQQQITYCHEKGIPVLVDEAHGAHFQACSLFQPSALSLGAD
                     VVVQSAHKTLPAMTMASFMHVRSELIGADKIHHYLRMLQSSSPSYVLLASLDDARYYV
                     QTYMESDGAYIIEKRNQWIEALRSISSLDVIEVDDPLKLLLRVKGYSGFQLQEALEAK
                     QVYGELADRNQVLFILPLLKQGHTYPFAEIRVRIKEAVTLLLEAAKTDNIKASQTAYK
                     FVQLTEPVYTFDEMASLNKEWLPYMRTIGRISASMIIPYPPGIPLLVPGERITVAKLS
                     QLEELLAAGATFQGNHRLTEKMIQVIK"
     gene            56679..57308
                     /locus_tag="BSPH_RS00265"
                     /old_locus_tag="Bsph_0048"
                     /db_xref="GeneID:6021802"
     CDS             56679..57308
                     /locus_tag="BSPH_RS00265"
                     /old_locus_tag="Bsph_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="WP_031416090.1"
                     /db_xref="GI:670467331"
                     /db_xref="GeneID:6021802"
                     /translation="MNSNLFITFEGPEGAGKTTVIQKIAERLAEKNIDVLATREPGGI
                     EIAEKIRTIILNPAHTAMDERTEALLYAAARSQHYFEKVRPALDAGKLVICDRFIDSS
                     LAYQGYARGIGIDEVLSINEFAIGKKLPDMTILFDIAPEVGLARIYATGNREVNRLDV
                     ESLPFHQKVHEGYLLLVERYPERIRMVNADQDIDSVVEEVWSLLLKAIQ"
     gene            57471..57800
                     /locus_tag="BSPH_RS00270"
                     /db_xref="GeneID:23319624"
     CDS             57471..57800
                     /locus_tag="BSPH_RS00270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008408314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004229230.1"
                     /db_xref="GI:490349457"
                     /db_xref="GeneID:23319624"
                     /translation="MKLVVAVVQDQDSSRLSNALTKNQFRATKLASTGGFLRSGNTTF
                     LIGTEDSLIPKLLDIIRDNCRAREQMVAPVSPLGGNADSYIPYPVEVEVGGATVFVLP
                     IEQFHHF"
     gene            57932..58372
                     /locus_tag="BSPH_RS00275"
                     /db_xref="GeneID:23319625"
     CDS             57932..58372
                     /locus_tag="BSPH_RS00275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_025116337.1"
                     /db_xref="GI:640692011"
                     /db_xref="GeneID:23319625"
                     /translation="MKINQDIRVGLNTNRKEPLQNNNQNNRFGDMVVKQGTKLQTEQL
                     TRLLGDISTAGDRVARSRNLRELARFKMLVKRFLQETVEHGMELKQSHTWNRFGEGRR
                     LKIIDTIDTRLVELAQDILDEEKEAIDLLDKIGEIKGLLINLYM"
     gene            58669..59673
                     /locus_tag="BSPH_RS00280"
                     /old_locus_tag="Bsph_0051"
                     /db_xref="GeneID:6021885"
     CDS             58669..59673
                     /locus_tag="BSPH_RS00280"
                     /old_locus_tag="Bsph_0051"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="WP_012291863.1"
                     /db_xref="GI:501248845"
                     /db_xref="GeneID:6021885"
                     /translation="MAKNVEELFVLQPVVMKQLQTIFDKNRLAHAYIFDGEKGTGKAD
                     IMHFFVKLMLCEHPNENVPCETCRNCRRVDSGNHPNIHQIYPEGQFIKIDQMRELIGE
                     MKMMGVEEGRKIYVLHHADRLNTASANMILKFLEEPDGEVTAILITEQMQSILPTIRS
                     RCQHIKFQKMPRHVLLQHLQGNNISHSMASTVSMMTNELEMAISLASDEQFALARKTV
                     LKLVEAIRQNVHEAMLIVHEEWLPHFKEKSEMEQALDLLLFAYRDIVSIKANPEAACT
                     YPDMLPLFKEIALYSTYEQLSKQMESILQARASLQRNMNRTLLMEQLMLNLQEGYTFV
                     "
     gene            59666..60481
                     /locus_tag="BSPH_RS00285"
                     /old_locus_tag="Bsph_0052"
                     /db_xref="GeneID:6021886"
     CDS             59666..60481
                     /locus_tag="BSPH_RS00285"
                     /old_locus_tag="Bsph_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage 0 sporulation protein"
                     /protein_id="WP_012291864.1"
                     /db_xref="GI:501248846"
                     /db_xref="GeneID:6021886"
                     /translation="MYNVVGVRFKKAGKIYYFDPASFLLEDSQYVIVETARGVEYGKV
                     VVPQKVVGDNDVVLPLKQVLRPADDRDRIQVEENAAESKRAFELASTKIIEHNLEMKL
                     VDVEYTFDRNKIIFYFTAEGRVDFRDLVKDLASVFRTRIELRQIGVRDEAKLLGGIGP
                     CGRMLCCSTFLGDFEPVSIKMAKDQNLSLNPSKISGLCGRLMCCLKYENDEYEEAKEG
                     MPDLGEVAMTPDGRGKVVGLNVLERLVQVYLQEQERTVEYTLEELLACEKNLI"
     gene            60509..60865
                     /locus_tag="BSPH_RS00290"
                     /old_locus_tag="Bsph_0053"
                     /db_xref="GeneID:6021887"
     CDS             60509..60865
                     /locus_tag="BSPH_RS00290"
                     /old_locus_tag="Bsph_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229222.1"
                     /note="in Bacillus subtilis this protein is involved in
                     the negative regulation of DNA replication initiation;
                     interacts with DnaN and DnaA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication initiation control protein YabA"
                     /protein_id="WP_025116340.1"
                     /db_xref="GI:640692014"
                     /db_xref="GeneID:6021887"
                     /translation="MKDRNFLDTVMEFEQQLEAMQEQFGALKQFVALMMEEHKALETE
                     NHHLRTRLEELLSNTHSVQAAEVKKESPLDIGEGYDNLARLYQEGFHVCHVHFGSSRK
                     GEDCLFCLSFLNKQNV"
     gene            60929..61678
                     /locus_tag="BSPH_RS00295"
                     /old_locus_tag="Bsph_0054"
                     /db_xref="GeneID:6021888"
     CDS             60929..61678
                     /locus_tag="BSPH_RS00295"
                     /old_locus_tag="Bsph_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291866.1"
                     /db_xref="GI:501248848"
                     /db_xref="GeneID:6021888"
                     /translation="MEKWLKDDERLDYLLAENLRIIQSPSVFSFSLDAVLLSKFVNIP
                     YHKGNIVDLCSGNGVIPLFLSVRTKGQITGVELQPRLLDMAERSIRYNQLENQIQMIL
                     GDVKEIPKQLGIEKYDVVTCNPPYFLAHEASDKNLSEHHAIARHELYLTLEEAIQSAS
                     KLLKQGGKAAFVHRPGRLLDIVTAMRANRLEPKRMQLIYPKEGKEANTLLIEGIKDGK
                     PDLKILPPLYVYKNNNEYTAEVREILYGKEQ"
     gene            61662..61925
                     /locus_tag="BSPH_RS00300"
                     /db_xref="GeneID:23319626"
     CDS             61662..61925
                     /locus_tag="BSPH_RS00300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_031416093.1"
                     /db_xref="GI:670467334"
                     /db_xref="GeneID:23319626"
                     /translation="MEKSNNHYFYVLECADQSLYAGYTNNVEKRVAVHNAGKGAKYTR
                     ARGPVKCIYKEEYETKEEAMRAEYAFKQLTRTQKIMYIRRGES"
     gene            61922..62797
                     /locus_tag="BSPH_RS00305"
                     /old_locus_tag="Bsph_0056"
                     /db_xref="GeneID:6022765"
     CDS             61922..62797
                     /locus_tag="BSPH_RS00305"
                     /old_locus_tag="Bsph_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_012291868.1"
                     /db_xref="GI:501248850"
                     /db_xref="GeneID:6022765"
                     /translation="MKSQKSTIHDQTGCLYLVGTPIGNLEDISVRALRILKEVDIIAA
                     EDTRNTRKLCNYFEIETPLMSYHEHNLAVGGEKLLTFLQEGKTIALVSDAGLPCISDP
                     GADIVEKAIAQNFPVVPIPGPNAAITALIASGLTPQPFFFYGFLNRGKKERRQQLELL
                     KKRQETILLYEAPHRIKETLKDMEAILGNRRIVLARELTKKFEEFLRGTLAEAVEWSQ
                     AEEIRGEFCIVIEGNQQVEEEDSEEAYWHTLSIIEHVDYIIEQTDVSSKEAIKEVAKQ
                     RQLAKRDVYNEYHKQ"
     gene            complement(62984..63262)
                     /locus_tag="BSPH_RS00310"
                     /old_locus_tag="Bsph_0057"
                     /db_xref="GeneID:6022766"
     CDS             complement(62984..63262)
                     /locus_tag="BSPH_RS00310"
                     /old_locus_tag="Bsph_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016429968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transition state regulator Abh"
                     /protein_id="WP_012291869.1"
                     /db_xref="GI:501248851"
                     /db_xref="GeneID:6022766"
                     /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALKIYVDDDKII
                     LKKYMPNMTCAVTGEVSDDNFRLVGGKLILSPEGAEMLVKEIQSNLKK"
     gene            63612..65588
                     /locus_tag="BSPH_RS00315"
                     /old_locus_tag="Bsph_0058"
                     /db_xref="GeneID:6022767"
     CDS             63612..65588
                     /locus_tag="BSPH_RS00315"
                     /old_locus_tag="Bsph_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA synthetase"
                     /protein_id="WP_036160345.1"
                     /db_xref="GI:738204427"
                     /db_xref="GeneID:6022767"
                     /translation="MSEQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLRGY
                     DVRFLTGMDEHGQKIQEKAAEAGKHPQDYVNEIAESAKKLWALMDITYDDFIQTTQER
                     HTKAVEKIFQKFLDNGDIYKGEYEGWYCTPCESFFTETQLVDGNCPDCGRPVHKVKEE
                     SYFFNMKKYADRLLAYYEENLEFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIKV
                     PGDAKHVIYVWVDALTNYITSLGYLSDDETLFNKYWPADVHVVGKDIVRFHTIYWPIF
                     LMALDLPLPKKVFAHGFIMMKDGKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFG
                     SDGVFSPESFIERTNFDLANDLGNLLNRTISMINKYFDGIIPSENLQSTEFDAALKEQ
                     AESVRIKYEESMEKMQFSVVLADLWTLVSRTNKYIDETQPWVLAKEEADKPKLGTVMR
                     NLAESLHQIAVMLQPFMTTTPKRMMEQLGLDDKFLAWDTIETFGNTIPANIKVVEKGI
                     PIFPRLESEVEIAYIREEMRGSVKTSQEEEVNSGTKSDENPEIPEITIDDFMKIDLRV
                     ATVTACETVPKADKLLKLQVDLGYEQRQVVSGIAKFYSPDELIGQKVIVVANLKPVKL
                     RGELSQGMILAGEKDGILKLASVDSKLENGAKVK"
     gene            65842..66612
                     /locus_tag="BSPH_RS00320"
                     /old_locus_tag="Bsph_0059"
                     /db_xref="GeneID:6022768"
     CDS             65842..66612
                     /locus_tag="BSPH_RS00320"
                     /old_locus_tag="Bsph_0059"
                     /EC_number="3.1.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008181618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase TatD"
                     /protein_id="WP_012291871.1"
                     /db_xref="GI:501248853"
                     /db_xref="GeneID:6022768"
                     /translation="MFIDTHVHLNADQYEEDLQEVINRALEAKVEKMVVIGFDRKTIE
                     RTMELIEQFDFIYGVIGWHPVDAIDCTQEDLEWIEELAAHPKIVGIGETGLDYYWDKS
                     PKDVQQVIFRKQIQLAQKINLPIIIHNRDATGDVVKILREENAASVGGVMHCFSGSVE
                     TARECIAMNFMISLGGPVTFINARLPKEVATEIPLEHLMIETDAPYLAPHPYRGKRNE
                     PAFVPLVAEEIARLKGLTIEEIAQATTDNAKIFFGIDS"
     gene            66748..67959
                     /locus_tag="BSPH_RS00325"
                     /old_locus_tag="Bsph_0060"
                     /db_xref="GeneID:6022769"
     CDS             66748..67959
                     /locus_tag="BSPH_RS00325"
                     /old_locus_tag="Bsph_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416099.1"
                     /db_xref="GI:670467340"
                     /db_xref="GeneID:6022769"
                     /translation="MSNNSMKNLFLGSLRSKQTVIRIISLVLFVSVISFVLYQGTKKA
                     VKLEANGETIEVSTHAKTVEQLLQDQNIDVAEHDKISPSLNTKIVNGLAIQWEQAKEV
                     TISVDGNQSKVWTTETLVKDILKEANIEVSKHDTLAQGLDTELGAENKIDIQRAFQLT
                     LVDGVNKRQVWSTSTTVANFLKQQGIQLNEFDRVENNLEDVITPASKITVVRVEKVID
                     VVEDSLDFAVEKKRDASLQKGKEKVVATGEKGSVSRTYEVVKENGKVVAKNLQSEAVL
                     KEPKKQVVAVGTKTVVASAATVSRGSAEPASGKEFYVTATAYTPYCNGCSGTSATGIN
                     LRSNSNLKVVAVDPSVIKLGSKVWVEGYGTAIAGDTGGAIKGNKIDILVQTDAQARNW
                     GRKKVRIKVLN"
     gene            68154..68720
                     /locus_tag="BSPH_RS00330"
                     /old_locus_tag="Bsph_0061"
                     /db_xref="GeneID:6022331"
     CDS             68154..68720
                     /locus_tag="BSPH_RS00330"
                     /old_locus_tag="Bsph_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008181614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease M5"
                     /protein_id="WP_012291873.1"
                     /db_xref="GI:501248855"
                     /db_xref="GeneID:6022331"
                     /translation="MQIKEIIVVEGKDDTTAIKRAVQADTIETNGSAISEETLKRIQH
                     AQEKRGVIVFTDPDYPGRRIRAIIEERVKGVKHAFLPKAKTIAKNGKGLGIEHAADDD
                     IREALRLVYTPHLEEPNEDDITLEDLMTARLIGHPQSKHRRDRLGELLNIGATNGKQL
                     HKRLKMFQITEKQFGAAVAQLDQEENDA"
     gene            68713..69594
                     /locus_tag="BSPH_RS00335"
                     /old_locus_tag="Bsph_0062"
                     /db_xref="GeneID:6022332"
     CDS             68713..69594
                     /locus_tag="BSPH_RS00335"
                     /old_locus_tag="Bsph_0062"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008181612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="WP_012291874.1"
                     /db_xref="GI:501248856"
                     /db_xref="GeneID:6022332"
                     /translation="MHKDIATPIRTQEILKKYGFSFKKSLGQNFLIDPNILRNIVSHA
                     KLTENSGAIEVGPGIGALTEHLARSAKKVVSFEIDQRLLPVLEDTLSPYNNVSIVHSD
                     ILKADVAKVIAEEMPGIEDIMVVANLPYYVTTPILMKLLNDRLPIRGFVVMMQKEVAD
                     RITAKPGTKEYGSLSIAIQYYVKADIAMTVPKTVFMPQPNVDSAVIRLIKHDEPPVKV
                     INEDFLFVVTRASFVQRRKTIYNNLQAGLPNGKTQKDFILEALAAANIEPTRRGETLT
                     IQEFGKLADALYPVFAK"
     gene            69751..70011
                     /locus_tag="BSPH_RS00340"
                     /old_locus_tag="Bsph_0063"
                     /db_xref="GeneID:6022333"
     CDS             69751..70011
                     /locus_tag="BSPH_RS00340"
                     /old_locus_tag="Bsph_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="veg"
                     /protein_id="WP_004229199.1"
                     /db_xref="GI:490349426"
                     /db_xref="GeneID:6022333"
                     /translation="MPKTLADIKKSLDCHLGKRLQLKANGGRKKTVECAGILRETYRA
                     IFVVELDQEDNTCKRVSYSYTDILTEAVEITFLDEAKAAVAK"
     gene            70127..70306
                     /locus_tag="BSPH_RS00345"
                     /old_locus_tag="Bsph_0064"
                     /db_xref="GeneID:6022334"
     CDS             70127..70306
                     /locus_tag="BSPH_RS00345"
                     /old_locus_tag="Bsph_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore protein"
                     /protein_id="WP_025116349.1"
                     /db_xref="GI:640692023"
                     /db_xref="GeneID:6022334"
                     /translation="MPRKGIMSPRLKEEIAKELGFYDVVQKEGWGGIKARDAGNMVKR
                     AIEMAERASNEQERK"
     gene            70526..71392
                     /gene="ipk"
                     /locus_tag="BSPH_RS00350"
                     /old_locus_tag="Bsph_0065"
                     /db_xref="GeneID:6022335"
     CDS             70526..71392
                     /gene="ipk"
                     /locus_tag="BSPH_RS00350"
                     /old_locus_tag="Bsph_0065"
                     /EC_number="2.7.1.148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993804.1"
                     /note="An essential enzyme in the nonmevalonate pathway of
                     isopentenyl diphosphate and dimethylallyl diphosphate
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2C-methyl-D-erythritol
                     kinase"
                     /protein_id="WP_031416102.1"
                     /db_xref="GI:670467343"
                     /db_xref="GeneID:6022335"
                     /translation="MLYVKAPAKINLTLDVLYKRPDNFHEVEMVMTTVDLADRISLES
                     REDGVIQIISTDNFVPNDHRNFAYQAARLIKDTYGIKQGVSITIEKEIPIAAGLAGGS
                     SDAAATLKGLNELWNLGLSIDELAELGAKIGSDVSFCVYGGTALATGRGEKIKEIPAP
                     PNCWVVLAKPKIGVSTAEVYGGLKVEGLEHPNTKQMIQAIETKDYELLCSSLGNVLET
                     VTFKLHPEVIMLKEQMKRFGADATLMSGSGPTVFGLVDSEARVSRIYNGLRGFCEEVY
                     AVRILGERNTLA"
     gene            71449..72282
                     /locus_tag="BSPH_RS00355"
                     /old_locus_tag="Bsph_0066"
                     /db_xref="GeneID:6024055"
     CDS             71449..72282
                     /locus_tag="BSPH_RS00355"
                     /old_locus_tag="Bsph_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_012291877.1"
                     /db_xref="GI:501248859"
                     /db_xref="GeneID:6024055"
                     /translation="MKWKRSERLVDMTYYLLEHPHQLIPLTYFSELYQSAKSSISEDL
                     TIVKETFEEKGIGLLMTVPGAAGGVKYIPKMSEAEVRSVIQDLKAELEHSDRLLPGGY
                     LFMTDLLGNPDLINRVGKVFASAFADQQIDVIMTVATKGISIAHAIARHLNVPVVVVR
                     RDSKVTEGSTVSINYVSGSSRRIQTMVLSKRSMKSGQRVLITDDFMKVGGTMNGMKNL
                     LEEFDCQLAGIAVLVEAEHADETLVDDYYSLVKLHEVNEKDRTIALSEGNYFSKRGHD
                     K"
     gene            72279..72653
                     /locus_tag="BSPH_RS00360"
                     /old_locus_tag="Bsph_0067"
                     /db_xref="GeneID:6024056"
     CDS             72279..72653
                     /locus_tag="BSPH_RS00360"
                     /old_locus_tag="Bsph_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_012291878.1"
                     /db_xref="GI:501248860"
                     /db_xref="GeneID:6024056"
                     /translation="MKVVATSNAPAAIGPYSQGISVNGIFYSSGQIPLTATGELVEGD
                     ITVQTNQVFANVKAVLEAAGTSLENVVKTTVFMKDMNDFVAMNEVYASHFGEHKPARS
                     AVEVARLPKDVKVEIEVIAIVK"
     gene            72878..73180
                     /locus_tag="BSPH_RS00365"
                     /old_locus_tag="Bsph_0068"
                     /db_xref="GeneID:6024057"
     CDS             72878..73180
                     /locus_tag="BSPH_RS00365"
                     /old_locus_tag="Bsph_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septation protein spoVG"
                     /protein_id="WP_031416105.1"
                     /db_xref="GI:670467346"
                     /db_xref="GeneID:6024057"
                     /translation="MEVTDVRLRRVQTDGRMRAIASITLDNEFVVHDIRVIDGNTGLF
                     VAMPSKRTPDGEFRDIAHPINSDTRNKIQEIILNAYHNSSELEETDKEEELESMGV"
     gene            73451..74821
                     /gene="glmU"
                     /locus_tag="BSPH_RS00370"
                     /old_locus_tag="Bsph_0070"
                     /db_xref="GeneID:6024059"
     CDS             73451..74821
                     /gene="glmU"
                     /locus_tag="BSPH_RS00370"
                     /old_locus_tag="Bsph_0070"
                     /EC_number="2.3.1.157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291881.1"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase"
                     /protein_id="WP_031416107.1"
                     /db_xref="GI:670467348"
                     /db_xref="GeneID:6024059"
                     /translation="MSNIFAVILAAGQGTRMKSKLYKVLHPVCGKPMVQHVVDHIQTL
                     DVNRIVTVVGHGAEKVQQQLGDKSEYVLQAEQLGTAHAVQQAEGILGNEEGTTLVVCG
                     DTPLIRPETMQALFEHHQAKKAKATILTAIAENPTGYGRILRSENGQVEQIVEQKDAS
                     AAQQLVKEINTGTYCFDNKLLFETLKLVKNDNAQGEYYLPDVIEILQKQGDIVEAYVT
                     DDFEETLGVNDRVALSQAETLMRARINEKHMRNGVTIIHPETTYISAEAVIGSDTVIQ
                     PGCMIEGATVIGEDCNIGPNTQIADSRIGDRTTVHSSVVRESAIAEDTAIGPFAHIRP
                     LSDIGSHVKIGNFVEVKKSKLGNDTKVSHLSYIGDAEIGSNVNVGCGSITVNYDGKNK
                     FKTIIEDDVFVGCNTNLVAPVKVGKGSFIAAGSTITKEVPEDALAIARARQENKPNYV
                     SKLNSK"
     gene            74846..75805
                     /locus_tag="BSPH_RS00375"
                     /old_locus_tag="Bsph_0071"
                     /db_xref="GeneID:6024280"
     CDS             74846..75805
                     /locus_tag="BSPH_RS00375"
                     /old_locus_tag="Bsph_0071"
                     /EC_number="2.7.6.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_012291882.1"
                     /db_xref="GI:501248864"
                     /db_xref="GeneID:6024280"
                     /translation="MPYHYANSQLKIFSLNSNNPLAQEIAQEMGVELGKSSVKHFSDG
                     EVQISIEESIRGCDVFIVQSTSAPVNEHLMELLIMVDAVKRASARTVNVVMPYYGYAR
                     QDRKAKAREPITAKLVANLLETAGATRVIVLDLHAPQIQGFFDILIDHLMAVPLLSDY
                     FKSKGIPEDEIVIVSPDHGGVTRARKMAERLKAPIAIIDKRRPKPNVAEVMNIVGNVD
                     GKVAILIDDIIDTAGTITIGADALRAAGAKEVYACCSHPVLSGPAIERIENSSIKELV
                     VTNTIQLAEDKKSPKITELSVAKLMADAISRVYENKSVSTLFD"
     gene            76069..76665
                     /locus_tag="BSPH_RS00380"
                     /old_locus_tag="Bsph_0072"
                     /db_xref="GeneID:6024281"
     CDS             76069..76665
                     /locus_tag="BSPH_RS00380"
                     /old_locus_tag="Bsph_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HSV6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="WP_012291883.1"
                     /db_xref="GI:501248865"
                     /db_xref="GeneID:6024281"
                     /translation="MSTVLSVTKRETGHRSTLTQLRKGGAIPAVIYGYKLDSTPISIS
                     AKEFKKSIQKNGQNSVFSLDLEGKKVNVVVSEVQQCSLKDEVNHVDFLAINMAEELEV
                     DVPIKLIGQSVGVSEGGILMQPNLELKVKVKPAELPDSIEVDISSLKVGESLTVAEIR
                     HQTPVEIISEDDYLLVTIVAPVSAEQEEVSASVEEEQV"
     gene            76818..77378
                     /locus_tag="BSPH_RS00385"
                     /old_locus_tag="Bsph_0073"
                     /db_xref="GeneID:6024282"
     CDS             76818..77378
                     /locus_tag="BSPH_RS00385"
                     /old_locus_tag="Bsph_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_031416108.1"
                     /db_xref="GI:670467349"
                     /db_xref="GeneID:6024282"
                     /translation="MKIIVGLGNPGKPYEHTRHNIGFDVIDALAEKWGTPLTNSKFNG
                     MYTTVHRPEGKVLLVKPLTYMNLSGECVGPLMDYFDIDVEDLIVIYDDLDLETGKLRL
                     RQKGSAGGHNGIKSLIQHLGTQEFNRIRVGISRPPAGMKVADYVLGKFSKEDQVSMNE
                     AIEKSVNAVEVSLSKPFLDVMNHFNK"
     gene            77582..77809
                     /locus_tag="BSPH_RS00390"
                     /old_locus_tag="Bsph_0074"
                     /db_xref="GeneID:6024283"
     CDS             77582..77809
                     /locus_tag="BSPH_RS00390"
                     /old_locus_tag="Bsph_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008180264.1"
                     /db_xref="GI:495455571"
                     /db_xref="GeneID:6024283"
                     /translation="MSVRYRCRHCEVEIGTLPFDADDTIRKLHIFELGEADDYVEKDQ
                     HGHTTVHCICEQCEDSLRQYPDYHALNKWIQ"
     gene            77952..81461
                     /locus_tag="BSPH_RS00395"
                     /old_locus_tag="Bsph_0075"
                     /db_xref="GeneID:6024284"
     CDS             77952..81461
                     /locus_tag="BSPH_RS00395"
                     /old_locus_tag="Bsph_0075"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="WP_012291885.1"
                     /db_xref="GI:501248867"
                     /db_xref="GeneID:6024284"
                     /translation="MEVLRQLVSRDKHITSFLQDIQSGQTASQLITGLTGSARPVMVD
                     ALFEYVKKPIYIVSPNLLQAQRMVDELAGLLGEENVHYYPADEFIAADLSVASPELRA
                     ERIATLDCLARGEKAVYVIPVAGLRKIMQPKEHWLHYFLQTTVGDEIEVDAWLQTLVE
                     MGYVRNSMVTTPGEFALRGGILDIYPPYLASPIRIELFDTEVDSIRTFSADDQRSINK
                     LQKIRILPASEVILTKSERQTLAERLEKALGASLKKVKRQETKELLYQHIQYDIELLQ
                     QGNLPDYVNKYGSLLYDKSAYLGDYFAQDGIVLFDELGRIQEVMDAWEREEEEWFLSL
                     IEEGKMVHDVKPAFTLKEIVAMLSQQKLSFSLFSRTFSGITFNKTTNFSCKPMQQFHG
                     QMALLQSEIERWLLGKFTVLIVARDKERVKRVQQMLEEYDIHAAIGEPTEPGIYIVDG
                     ALSSGFELPLQRMAIVTEDELFKQQAKKKARTQKMTNAERIKSYTEIKPGDYVVHVHH
                     GIGKYIGVETLEVNGTHKDYLHIRYRADDKLYVPVEQIDLIQKYVASEDREPKLHKLG
                     GAEWKKAKAKVSSAVQDIADDLIKLYAKREAEKGHAFTPDNDDQRNFEAMFAYEETED
                     QLRSIVEVKRDMERERPMDRLVCGDVGYGKTEVAIRAAFKAIQDGKQVAFLVPTTILA
                     QQHYETIRERFQDFAINVGLLSRFRSKKEQTATLKGLKEGQVDIVIGTHRILSKDLIF
                     QDLGLLIVDEEQRFGVTHKEKIKQLKTNVDVLTLTATPIPRTLHMSMVGVRDLSVIET
                     PPANRFPVQTYVMEHSGALVREAIEREMARGGQVFYLYNRVEDMARKVEEIQVLVPEA
                     RIGHAHGKMSETELESVILSFLEGDYDVLVTTTIIETGVDIPNVNTLIVHDADRMGLA
                     QLYQLRGRVGRSNRVAYAYFMYQRDKVLTDVAEQRLQAIKEFTELGSGFKIAMRDLSI
                     RGAGNLLGAQQHGFIDSVGFDLYSQMLQEAIAERQTGVKKEEKPEIEILLSVDAYIPD
                     VYIPDGYQKIQMYKRIKAMDQVEEYGEIMEELEDRFGDLPIETERLLRVARMKVWGLG
                     AGVISVKEKQKLITILLSEQGTANVDGSKIIEESMKFERAVGFGMDGMQLKLTIDERK
                     CGKYQPFDILEELMQIIDKAKKL"
     gene            81709..82245
                     /locus_tag="BSPH_RS00400"
                     /old_locus_tag="Bsph_0076"
                     /db_xref="GeneID:6024349"
     CDS             81709..82245
                     /locus_tag="BSPH_RS00400"
                     /old_locus_tag="Bsph_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage V sporulation protein T"
                     /protein_id="WP_012291886.1"
                     /db_xref="GI:501248868"
                     /db_xref="GeneID:6024349"
                     /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIYTDREGEV
                     ILKKYSPINDLGEFAREYVETLYETLGTPAFVTDRDEVIAVAGIGKKEYINRRITSFA
                     EGFMEERSTKIEKMETSIEIVPGQYEQVKSYCATPIMVNGDPIGCIIVLSKVHFVGEV
                     EVKVVETAANFLAKQMNS"
     gene            82405..84027
                     /locus_tag="BSPH_RS00405"
                     /old_locus_tag="Bsph_0077"
                     /db_xref="GeneID:6024350"
     CDS             82405..84027
                     /locus_tag="BSPH_RS00405"
                     /old_locus_tag="Bsph_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012291887.1"
                     /db_xref="GI:501248869"
                     /db_xref="GeneID:6024350"
                     /translation="MSQRFGMKSYMKGAALLTIAALIVKVLSAIYRVPFQNLVGDEGF
                     YIYQQVYPVISIFVVWTSSGFAIAISKMLADNDCIVDTIERNEKRSMIMRVVFRYLTV
                     LSLLFFAVLFGGADKIAQLMGDTQLAPLIRTGSLVVLVMPALAILKGGFQSRGIMEPI
                     AYAQVVEQAIRVTVILTGTFVIMTTTKSLYAAGKMAVIGTVVGEIIAFVLLAYIFSKR
                     FGLFRVHLRLHKAKSLPIMKEVTWLSLSVSMSGLLLLGYQLVDSFTIYSLLIDHGMDS
                     TVAKETKGIYDRGQPLVQLGVVIASSLSLAIVPLVAHLSKKQEGRSAIPFIQLTYKAS
                     ILFGWAASLGLMLVMPYLNEMLFKTNALSEVLIVYVFQIVPLSIILTFTAILQGYGKL
                     KKPALFLMIGFVLKIILNVRLIGWLGVLGAAIANDIGLLVTAFLLIVYLKTITGIQLA
                     SKEFYKKVGLASISMAVVVLVWLQLVSAFLGHLLSPRSVAVIAGFTAVGLGAFVMLTM
                     IAKKRVLVEKEWYLLPFGRRMAVYQLWLNSKK"
     gene            84037..85506
                     /locus_tag="BSPH_RS00410"
                     /old_locus_tag="Bsph_0078"
                     /db_xref="GeneID:6024351"
     CDS             84037..85506
                     /locus_tag="BSPH_RS00410"
                     /old_locus_tag="Bsph_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160352.1"
                     /db_xref="GI:738204434"
                     /db_xref="GeneID:6024351"
                     /translation="MNTLTIIGLGAGDFNQLQMGVYKKLKAAKKLFVRTVDHPVLEEL
                     AAEGITFESFDKVYEKHDAFQPVYAEIAESLIAATAIEDIMYAVPGHPLVAEQTVQLL
                     IEAANEGTFNLVIEGGQSFLDPIFGALKIDPIEGFQLLDGTSFSMHDINMRQHILIAQ
                     VYDTFSASEVKLTLMEKYDDEYPVTVVTAAGSSEEKIVTVPLYELDQSVEVNNLTTVY
                     VPPVNSQEEALRDWTTFRTIIATLRGPNGCPWDQKQTHESLKKYLLEEAHEYLAAVDA
                     EDDFAMIEELGDVLLQVFLHAQIGEDQGYFKLEDVLASISEKMIRRHPHVFGDVAVED
                     ADGVVANWEAIKAEEKGMTDKPLLDGEYRASSALQTAFNYQNRAAKVGFDWPDVEGAW
                     DKFAEEWQEFRHEVTNGSSISRLDELGDVLFTLVNLARFYKLSPEEAILHANEKFARR
                     FGYVEAQVKASGKSFADFTLDQLDRFWNEAKQLEREKEL"
     gene            85503..85793
                     /locus_tag="BSPH_RS00415"
                     /old_locus_tag="Bsph_0079"
                     /db_xref="GeneID:6024352"
     CDS             85503..85793
                     /locus_tag="BSPH_RS00415"
                     /old_locus_tag="Bsph_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008180273.1"
                     /db_xref="GI:495455580"
                     /db_xref="GeneID:6024352"
                     /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRITINEKVAKASSSVKAG
                     DELAIRFGQKIVTARVEEIRETVKKEDAAKMFTILKEERLEKIEPEFIDDEE"
     gene            85933..86232
                     /locus_tag="BSPH_RS00420"
                     /old_locus_tag="Bsph_0080"
                     /db_xref="GeneID:6024353"
     CDS             85933..86232
                     /locus_tag="BSPH_RS00420"
                     /old_locus_tag="Bsph_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004229167.1"
                     /db_xref="GI:490349394"
                     /db_xref="GeneID:6024353"
                     /translation="MTLHQESNRYTIPSGEHILTIRNRKRMDMTSVKSIERFDQEEFF
                     IKTSQGHLLIRGEELHIVHLDVDKGLLTLEGTVKTLQYDEEESGFSKGFLHKLFG"
     gene            86229..86720
                     /locus_tag="BSPH_RS00425"
                     /old_locus_tag="Bsph_0081"
                     /db_xref="GeneID:6024198"
     CDS             86229..86720
                     /locus_tag="BSPH_RS00425"
                     /old_locus_tag="Bsph_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291889.1"
                     /db_xref="GI:501248871"
                     /db_xref="GeneID:6024198"
                     /translation="MIVSEQFFQLIVMVVSGIAVGFIIDSVRLIVFSTPKRSSLRKWM
                     MVFELLTWILLGGLTYYLLFWLKDGAWRAYDPLAQIAGIFLYQSFFQTILRFIARVLV
                     NITWRPFWFIVRFIVSVIRHILQFLLNIVMIVIRPFVKIYSYLSYTFLKKLRYLKYNK
                     KQQ"
     gene            86738..87142
                     /locus_tag="BSPH_RS00430"
                     /old_locus_tag="Bsph_0082"
                     /db_xref="GeneID:6024199"
     CDS             86738..87142
                     /locus_tag="BSPH_RS00430"
                     /old_locus_tag="Bsph_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein DIVIC"
                     /protein_id="WP_012291890.1"
                     /db_xref="GI:501248872"
                     /db_xref="GeneID:6024199"
                     /translation="MTRRHSSNDEQQNFTKLDNDYVRNTDKAINRKQQARKRKLRRIV
                     FFAIVPVIIIALLLNVLSNQHETLAIKEKSKEEAKQHLSELKEEQDSLNLKIKQLQDD
                     EYIAKLLRKEYYLSEKGEIIFIIPDKEDKKDD"
     gene            87277..87714
                     /locus_tag="BSPH_RS00435"
                     /old_locus_tag="Bsph_0083"
                     /db_xref="GeneID:6024200"
     CDS             87277..87714
                     /locus_tag="BSPH_RS00435"
                     /old_locus_tag="Bsph_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291891.1"
                     /db_xref="GI:501248873"
                     /db_xref="GeneID:6024200"
                     /translation="MSIEVGSKVQGKVTGITTFGAFVELPDGKTGLVHISEVADNYVK
                     DINEHLKVGDEVEVKVMNVEADGKIGLSIRKAKPQAERPERPERPARPRRDNRSNDRN
                     DRHQPKENFEQKMARFLKDSDERLATLKRATESKRGGRGARRG"
     gene            complement(87805..88056)
                     /locus_tag="BSPH_RS00440"
                     /old_locus_tag="Bsph_0084"
                     /db_xref="GeneID:6024201"
     CDS             complement(87805..88056)
                     /locus_tag="BSPH_RS00440"
                     /old_locus_tag="Bsph_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291892.1"
                     /db_xref="GI:501248874"
                     /db_xref="GeneID:6024201"
                     /translation="MSALTKAALICGSGSMIILISILINLPFVIQIMLLLCGLAVSVY
                     GVFLLVKMVVHPAEKVSIAPADEKVVTPIKKKKGPSSTL"
     gene            complement(88201..88272)
                     /locus_tag="BSPH_RS00445"
                     /old_locus_tag="Bsph_tRNA84"
                     /db_xref="GeneID:6024202"
     tRNA            complement(88201..88272)
                     /locus_tag="BSPH_RS00445"
                     /old_locus_tag="Bsph_tRNA84"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(88237..88239),aa:Glu,seq:ttc)
                     /db_xref="GeneID:6024202"
     gene            complement(88278..88354)
                     /locus_tag="BSPH_RS00450"
                     /old_locus_tag="Bsph_tRNA83"
                     /db_xref="GeneID:6024790"
     tRNA            complement(88278..88354)
                     /locus_tag="BSPH_RS00450"
                     /old_locus_tag="Bsph_tRNA83"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(88318..88320),aa:Met,seq:cat)
                     /db_xref="GeneID:6024790"
     gene            complement(88364..88438)
                     /locus_tag="BSPH_RS00455"
                     /old_locus_tag="Bsph_tRNA82"
                     /db_xref="GeneID:6024791"
     tRNA            complement(88364..88438)
                     /locus_tag="BSPH_RS00455"
                     /old_locus_tag="Bsph_tRNA82"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(88404..88406),aa:Gly,seq:gcc)
                     /db_xref="GeneID:6024791"
     gene            88875..91259
                     /locus_tag="BSPH_RS00460"
                     /old_locus_tag="Bsph_0085"
                     /db_xref="GeneID:6024792"
     CDS             88875..91259
                     /locus_tag="BSPH_RS00460"
                     /old_locus_tag="Bsph_0085"
                     /EC_number="3.1.3.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein E"
                     /protein_id="WP_012291893.1"
                     /db_xref="GI:501248875"
                     /db_xref="GeneID:6024792"
                     /translation="MTSIDWYNTADVDDRKLGIKKKQIFIGSLFFLTSFFLAQSVVFE
                     AAVPFSVPFWAIIRTKYREYAKFVLFGSLAGCFFLGFGQVVILALQIIMYECIMRFRY
                     WRLPQSIAVSLAVLLVQFMWQGAMYQGLPPVLVQFYVGCEAALALIMTLFMQVLFVNS
                     YEWFTSHWTYEKLGSGLVVFAAMLTGMQAVVFSYFSLPIFLLQLFICFGALVGSVPLA
                     TVIGAVLGTLIGVAKLSFTGMLSVATLTGLCAGMGAKGGRFGVAIGSILPSVFFLFYD
                     ATLPLDSVYFTSIAIGSVLFLTIPRKYSDKVRDKLFPQREEVLIARQNWLTEHVTYKL
                     EHFQHFVQFMKELVFERFMTAPVEEAKEVSPMNTCLSCFRYDHCWGAQNNGMDKLMTD
                     WFHMKGVGKESAIHRVEEQMRYKCVKSTKIFEELDTELYRERINGQYFHGKKMIALQL
                     RDMSNHLNQLIAEMKEDTVSFVSVEKDIIERLKDAHIECFQLDVLNNKPGARKIVCAL
                     APARVDWEKDTTLAERMILPILYEIFNEPFEIEKVVACEIPFRHIQICFRSAISFEVE
                     YDIYSMSKDATLYSGDSHALFQLHPGLFAILLSDGMGQSKEAQHESRKLIHLMRECLN
                     YNMNPETAMHTLHYVMSLKQQDDMYATLDFALVDLQHGDLWSWKAGGMSTYILRGKEI
                     IKVESNAAPVGFLSISAVEAEKRKLKAGDVILMHSDGLFSSVADWDEQEETFLAYAQQ
                     VASTNNTIQEKLTTIMQSFQDYFEIEDDCTVLMLEVTHVVPTWAVFRPAQYSVS"
     gene            91297..92703
                     /locus_tag="BSPH_RS00465"
                     /old_locus_tag="Bsph_0086"
                     /db_xref="GeneID:6022890"
     CDS             91297..92703
                     /locus_tag="BSPH_RS00465"
                     /old_locus_tag="Bsph_0086"
                     /EC_number="6.3.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="WP_012291894.1"
                     /db_xref="GI:501248876"
                     /db_xref="GeneID:6022890"
                     /translation="MSFELKIKTFIEKEQLLQQGDHLLIAVSGGVDSMALLHYFVQTK
                     EHWNIRVEAVHVDHMLRGEASAEDRAFVQKYCDDNGVYLHATAISIPTILAKENGNIQ
                     LICRRERYRYFKEVLYETNANKLVTAHHADDQLESVLMALTKNATMNSMQGIRPQRNF
                     EGKTLIRPFLTVTKTEIGEYLLRKGLNYREDASNSKDTYVRNRFRHHVVPLLEAENPR
                     VTEQVTHFTSQLQEDNAFLMTLAQDVFSKTITRSNENTYSMEIEAFQLVPLALQRRLI
                     LILLNYLYKDSNTIQSYALLTSILKLCDTTAGYAEIHLPEDFLAVRRYGKLIIRKNSS
                     TEDHASSEKIIISAANGWTTLMNGERLCVVKLHDLSSELITDTAQLFYFNASKLHLPL
                     YIRARKDGDRMLLKGMDQPKRLSRLFIDEKIPLNERNSWPLLISQSDEVVAVIGVRMG
                     MFFSTTPQPNDDTVLIVD"
     gene            92771..93313
                     /locus_tag="BSPH_RS00470"
                     /old_locus_tag="Bsph_0087"
                     /db_xref="GeneID:6022891"
     CDS             92771..93313
                     /locus_tag="BSPH_RS00470"
                     /old_locus_tag="Bsph_0087"
                     /EC_number="2.4.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_012291895.1"
                     /db_xref="GI:501248877"
                     /db_xref="GeneID:6022891"
                     /translation="MLQNDIEKVMITEEQLQERIADLGAQLTEEYKDAFPLAVGVLKG
                     AMPFMTDLMKRFDSFIELDFMDVSSYGNATVSSGEVKILKDLNTSVEGRDVLIIEDII
                     DSGLTLSYLVDLFKYRKAKSIKIVTLLDKPSGRKVNLSADYVGFEVPDGFVVGYGLDY
                     AEKYRNLPYIGILKPEVYSF"
     gene            93595..95619
                     /locus_tag="BSPH_RS00475"
                     /old_locus_tag="Bsph_0088"
                     /db_xref="GeneID:6022892"
     CDS             93595..95619
                     /locus_tag="BSPH_RS00475"
                     /old_locus_tag="Bsph_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_036160354.1"
                     /db_xref="GI:738204436"
                     /db_xref="GeneID:6022892"
                     /translation="MNRIFRYTIFYLLIFLVIIGIFGTFNGGKSPTKELTYHEFQQAL
                     DKKEITSATIQPDKSVYVVEGTLKGYEKGQSFTVNIPRDNQSLMDRIDEAAKEKNSNI
                     KYLAAPETSGWIQFFTGIIPFIIIIFLFFFLMSQSQGGGNKVMSFGKSKAKLYDDQKK
                     KVRFTDVAGADEEKAELVEVVDFLKDHRKFTEIGARIPKGILLVGPPGTGKTLLARAV
                     AGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAG
                     LGGGHDEREQTLNQLLVEMDGFGANEGIIIIAATNRPDILDKALLRPGRFDRQITVGH
                     PDVKGREAILKVHARNKPLADTVDLAAVAQRTPGFSGADLENLLNEAALVAARKSKRT
                     INMADIDEASDRVIAGPAKASRVYSAKEKKLVSFHEAGHVVVGLELDEADTVHKVTIV
                     PRGQAGGYAIMLPKEERFFTTRQELLDRIAGLLGGRVAEEIVLGEVSTGAHNDFQKVT
                     SIARAMVTEYGMSENLGAMQFGSSQGGNVFLGRDFNSDQNYSDSIAYEIDKEMQKIID
                     TQYERTKRILTEKRELLDLIANTLMEKETLNAQEIEHLRDHGVLPEPEAIVEGNNTPK
                     VEAKPTLDTIGEPVVEKELLSKDPNPTTLDLAKEGKESNDTPKGIDEKRE"
     gene            95782..96615
                     /locus_tag="BSPH_RS00480"
                     /old_locus_tag="Bsph_0089"
                     /db_xref="GeneID:6022893"
     CDS             95782..96615
                     /locus_tag="BSPH_RS00480"
                     /old_locus_tag="Bsph_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxal reductase"
                     /protein_id="WP_012291897.1"
                     /db_xref="GI:501248879"
                     /db_xref="GeneID:6022893"
                     /translation="MGTVTLNNGLKMPLVGYGVFRVPEGEDLAEAVKTAIAKGYRSID
                     TAQVYRNEESVGRGIRAAIEEGLVTREELFITSKVWNDGLSYDETLAAYDSSLEKIGL
                     DYLDLYLVHWPGIDTNYLDVYKALEKIYQDGRVRSIGVSNFHVHHLEYLLKEATVVPV
                     INQIEFHPHLTQEEVRAYCTDKGIQVEAWSPLMNGALLEEALIQELASKYGKTPAQIV
                     LRYDVQHNVVTIPKTMTETRMIENLDIFDFALTDDEMTQLDALNDGLRCGPDPEKFNF
                     K"
     gene            96794..97561
                     /locus_tag="BSPH_RS00485"
                     /old_locus_tag="Bsph_0090"
                     /db_xref="GeneID:6022826"
     CDS             96794..97561
                     /locus_tag="BSPH_RS00485"
                     /old_locus_tag="Bsph_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_036160356.1"
                     /db_xref="GI:738204438"
                     /db_xref="GeneID:6022826"
                     /translation="MILVLDAGNSNIVLGVYDDKEQLAFHWRMVTDLYKTEDEYAMQV
                     LSFFNHAGISFEQVTGIIISSVVPPIMYSLEAMCQKYFRKKPLVVGPGVKTGLNIKYE
                     NPREVGSDRIVNAIAALDLYKAPCIIVDFGTATTYCYLNEKGDYMGGAIAPGITISTE
                     ALYTQAARLPRIEIVRPAHIVGKTTVSAMQAGIFYGFVGQVEGIVNRMKGQSKEEPLV
                     IATGGLANLIAGETQIIDVVDPFLTLKGLYKLYKRNQ"
     gene            97583..98464
                     /locus_tag="BSPH_RS00490"
                     /old_locus_tag="Bsph_0091"
                     /db_xref="GeneID:6022827"
     CDS             97583..98464
                     /locus_tag="BSPH_RS00490"
                     /old_locus_tag="Bsph_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp33"
                     /protein_id="WP_031416131.1"
                     /db_xref="GI:670467374"
                     /db_xref="GeneID:6022827"
                     /translation="MKDYLVRGLGFNGQVRVFAARTTATVAEAQRRHDTWPVVSAALG
                     RSMTAAVMMGAMLKGEEKITIKIEGNGPIGPMVIDSNAHGEVRGFVTNPHVHFDLNEQ
                     GKLDVRAGVGTEGALTIVKDLGLRDMFSGQTPIVSGEIAEDFTYYFATSEQVPSSVGL
                     GVLVNPDNTILAAGGFILQLMPGCEEETINEIEQHLATIEPVSKMIEKGFTPEQILEA
                     VLGNGHLQILDSMPVEFKCQCSKERFGAAILGLGIAEIKEMIEEDGSADAQCHFCLET
                     YHFSKEELEGFIDELKS"
     gene            98448..99419
                     /locus_tag="BSPH_RS00495"
                     /old_locus_tag="Bsph_0092"
                     /db_xref="GeneID:6022828"
     CDS             98448..99419
                     /locus_tag="BSPH_RS00495"
                     /old_locus_tag="Bsph_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Foldase prsA precursor"
                     /protein_id="WP_012291900.1"
                     /db_xref="GI:501248882"
                     /db_xref="GeneID:6022828"
                     /translation="MSSNRNRRPSATATTNQTPLLQRRLKTKPALAVIAVLLLGNILW
                     FIGWVIPNKGQEIGSDEQVAAIDGDVITRQEWMIAMEERYGKETLQSLVNETVMEKAA
                     KTYKIKVTDQEIDLELALMRSAQDKFDTAMQNLTAEQLRQKIRSQLILDKVLTKDVVI
                     NEESIEKYYEENQGLYNTKTSYRTNFIEVDAKKAADEALGELKNGSDFSVLAREISLD
                     SASASLGGDVGFLTENQENVDPAIINAVKSTKVNEVSKAFKLDNGHYGIVQVQEILEG
                     QSFTYDDVKEHIERELALEQLPQSVTPEAFWSEFNATWYYGESKKEK"
     gene            99695..100624
                     /locus_tag="BSPH_RS00500"
                     /old_locus_tag="Bsph_0093"
                     /db_xref="GeneID:6022829"
     CDS             99695..100624
                     /locus_tag="BSPH_RS00500"
                     /old_locus_tag="Bsph_0093"
                     /EC_number="2.5.1.47"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_012291901.1"
                     /db_xref="GI:501248883"
                     /db_xref="GeneID:6022829"
                     /translation="MSRLANSIAELVGKTPIVKLNHATSENEGTVYVKLEYFNPGSSV
                     KDRLALAMIEAAEKDGTLQPGGTIIEPTSGNTGIGLAMIAAAKGYKAILVMPETMSLE
                     RRNLLRAYGAELVLTPGPAGMKGAIAKAEELSAEHGYFLPQQFTNPANAVIHRLTTGP
                     EIVEAFDGLTLDAFVAGVGTGGTITGAGSVLKEKYPTIEIIAVEPKDSPVLSGGQPGP
                     HKIQGIGAGFVPTVLDTDIYSSVFPVENEVAFEVARKVAREEGILCGISSGAAIYAAI
                     EAAKRLGKGSNVLAIVPSNGERYLSTPLYQFED"
     gene            100775..102184
                     /locus_tag="BSPH_RS00505"
                     /old_locus_tag="Bsph_0094"
                     /db_xref="GeneID:6022830"
     CDS             100775..102184
                     /locus_tag="BSPH_RS00505"
                     /old_locus_tag="Bsph_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="para-aminobenzoate synthase"
                     /protein_id="WP_036160358.1"
                     /db_xref="GI:738204440"
                     /db_xref="GeneID:6022830"
                     /translation="MKTILTKTVEMDADSFFYSYKKQTETQHSHVFLESGRGGHFTIA
                     AWNPLATAQAVENGLLVNWRNGRSEVLPGESLALLEELVADYQVSYNVELPIFQGGAI
                     GFVTYDYARNIEVLPNTAIDDLHIPDIFFYLFDCWAVHDVKSNTVTLMKLEDCVVDLD
                     EWATNWQVAAQDGLATRKFEKTNAIEVDNDESELLVSFAGTEFEAAVKKIQTYIAEGD
                     VFQVNLSVRQSKNLSATAMDVYEALRAFNPSPYMAYMEAPDFAVVSGSPELLVKRQGK
                     ELSTRPIAGTRPRGKSEAEDLALAQELIDNDKERAEHVMLVDLERNDLGRVSTYGTVE
                     VDEFMVIERYSHVMHIVSNVRGEIAEGKTNADVIRAMFPGGTITGAPKIRTMEIIEEL
                     EPVRRGLYTGSIGWLGYTGDMEFNIVIRTAFIKDGVAHIQAGAGIVIDSVPAREYQES
                     LNKAKAMWQAKAMAEERAK"
     gene            102181..102762
                     /locus_tag="BSPH_RS00510"
                     /old_locus_tag="Bsph_0095"
                     /db_xref="GeneID:6025057"
     CDS             102181..102762
                     /locus_tag="BSPH_RS00510"
                     /old_locus_tag="Bsph_0095"
                     /EC_number="4.1.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180302.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="WP_012291903.1"
                     /db_xref="GI:501248885"
                     /db_xref="GeneID:6025057"
                     /translation="MILMIDNYDSFIYNIVQYLGEFGHEIIVKRNDVLTIEDIEQLAP
                     DMIVISPGPCSPNEAGESLNIIRYFAGNIPILGVCLGHQAIAQVFGGQVIRAERLMHG
                     KTSPVLHAEVGLHKAMPNPFQATRYHSLIVEKETLPTCLEVTAWTEEGEIMGLRHKDY
                     PIEGVQYHPESIMTEQGKKLLRQFIEMYVEGVK"
     gene            102763..103602
                     /locus_tag="BSPH_RS00515"
                     /old_locus_tag="Bsph_0096"
                     /db_xref="GeneID:6025058"
     CDS             102763..103602
                     /locus_tag="BSPH_RS00515"
                     /old_locus_tag="Bsph_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-amino-4-deoxychorismate lyase"
                     /protein_id="WP_036160360.1"
                     /db_xref="GI:738204442"
                     /db_xref="GeneID:6025058"
                     /translation="MRCWINGSYMAEKDLRISPFDHGFLYGLGFFETFRTYKGQVFGW
                     DAHMERLQQALSQYRIHLTYPESVLLEVVQQLNQQARGQDGYFRLNVSAGEHNIGLQP
                     TEYTTPNVILFRKELQDTPRGTEKTAQWLTTPRNSPEQGLRVKSHHFGNNVLGRFELP
                     SLAEQEGFFLTEAGYVAEGVTSNVFWVKNDILYTPSLETGILPGIVRAWVIKKANALG
                     IEVSEGFYRKEDLQQSTECFITNSVQELVPIINVENQQLLGNRGPVYMRLHDAFAQEV
                     EQR"
     gene            103616..104470
                     /locus_tag="BSPH_RS00520"
                     /old_locus_tag="Bsph_0097"
                     /db_xref="GeneID:6025059"
     CDS             103616..104470
                     /locus_tag="BSPH_RS00520"
                     /old_locus_tag="Bsph_0097"
                     /EC_number="2.5.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_012291905.1"
                     /db_xref="GI:501248887"
                     /db_xref="GeneID:6025059"
                     /translation="MLEKYMKPLTINGIPLDFTKETFVMGILNVTPDSFSDGGKFNSV
                     EAAVAQAKKMVADGAKIIDVGGESTRPGYERISDEKEIARIVPVIQALLKEVDAIISV
                     DTYKANVARAAIEAGAHMINDIWGAKAEPEIAQVAADLHVPIILMHNRENLDYGVDFW
                     ASAKADIEKSIVIAHQAGVPDHHIILDPGIGFAKNTEHNIAMMQHLEDLVEMGYPVLL
                     ATSRKSMIGNVLKLPVDERLEGTGATVVYGIEKGCHMIRVHDVKEMARAAHMADVLVG
                     KRLYKEEA"
     gene            104470..104835
                     /locus_tag="BSPH_RS00525"
                     /old_locus_tag="Bsph_0098"
                     /db_xref="GeneID:6025060"
     CDS             104470..104835
                     /locus_tag="BSPH_RS00525"
                     /old_locus_tag="Bsph_0098"
                     /EC_number="4.1.2.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004229125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="WP_012291906.1"
                     /db_xref="GI:501248888"
                     /db_xref="GeneID:6025060"
                     /translation="MDYIHLKDMQFYGYHGVLAAETTLGQRFRANVSLAVDMTMAGET
                     DDLAYTVNYAEVYAVCRDIVEGEPFKLIEALVVKIANVILTTYPEKVKGVRVELIKPD
                     PPIHGYYKEVSVEVTRGDF"
     gene            104835..105347
                     /locus_tag="BSPH_RS00530"
                     /old_locus_tag="Bsph_0099"
                     /db_xref="GeneID:6025061"
     CDS             104835..105347
                     /locus_tag="BSPH_RS00530"
                     /old_locus_tag="Bsph_0099"
                     /EC_number="2.7.6.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_012291907.1"
                     /db_xref="GI:501248889"
                     /db_xref="GeneID:6025061"
                     /translation="MKDVYLSIGTNMGERYENLQKAIALLREKVNIEVVRVSSVYETA
                     AVGYTDQADFLNIAVHLKTDASSTEMLKICQSIEQELGRVREFRWGPRIIDLDILLYN
                     HENIETENLIVPHPRMYERAFVLVPLVEITPTPFGGQLQQAHHLLQQMDCESEGISLW
                     KPTNEPLTVN"
     gene            105417..106457
                     /locus_tag="BSPH_RS00535"
                     /old_locus_tag="Bsph_0100"
                     /db_xref="GeneID:6022868"
     CDS             105417..106457
                     /locus_tag="BSPH_RS00535"
                     /old_locus_tag="Bsph_0100"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase"
                     /protein_id="WP_012291908.1"
                     /db_xref="GI:501248890"
                     /db_xref="GeneID:6022868"
                     /translation="MSQTTEKPFRIGDIVMDNRVVLAPMAGICNSAFRLTVKEFGAGL
                     VYAEMISDKGIVQKNEKTLGMLYIDERENPLSLQIFGGDKETLVEAAKYVDQNTTADI
                     IDINMGCPVNKIIKCEAGARLLLDPNKVYEMVAAVVDAVKKPISVKMRIGWDDEHIFA
                     IENAQAVERAGASAVAVHGRTRVQMYEGKANWDIIRQVKENVKIPVLGNGDVETPQDA
                     KRMLETTGVDAVMIGRAALGNPWMIYRTVQYLETGELKEEPSVREKMDVCLLHFERLL
                     QLKGEGIAVREMRKHASWYLKGIRGNGKARNAINQTETAAELRALLNGLVREYEESES
                     NFFIPEAKEFII"
     gene            106645..108138
                     /locus_tag="BSPH_RS00540"
                     /old_locus_tag="Bsph_0101"
                     /db_xref="GeneID:6022869"
     CDS             106645..108138
                     /locus_tag="BSPH_RS00540"
                     /old_locus_tag="Bsph_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HSY5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="WP_031416137.1"
                     /db_xref="GI:670467380"
                     /db_xref="GeneID:6022869"
                     /translation="MSNIEELNDQLLVRRQKMTTILENGQDPFGSRFERTHLSTEVKE
                     QFADQTKEQLEENLQEVIIAGRIMTKRGKGKAGFAHIQDLGGQIQIYVRQDHVGEEAY
                     ELFKQADLGDIVGIRGNVFRTQVGELSVKAEEFTFLTKALRPMPEKFHGLQDVEQRYR
                     QRYLDLMTNEDSKLTFIARSKIIRAIRNYLDNAGYLEVETPMLHTIAGGAAARPFITH
                     HNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAY
                     ADYQDIMSLTENLIAHVAQEVLGTTTVQYGEDEINLAVGWKRVHMVDAVKEATGVDFW
                     QPMTKEQAQALAKEHGVEVKDVHEVGHIINEFFEQKIEETLVQPTFVYGHPVEISPLA
                     KKNPEDERFTDRFELFIVRREHANAFTELNDPIDQRQRFEAQLAEKAAGNDEAHEMDN
                     DFIEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPTMRHITK"
     gene            108330..108611
                     /locus_tag="BSPH_RS00545"
                     /old_locus_tag="Bsph_0102"
                     /db_xref="GeneID:6022870"
     CDS             108330..108611
                     /locus_tag="BSPH_RS00545"
                     /old_locus_tag="Bsph_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291910.1"
                     /db_xref="GI:501248892"
                     /db_xref="GeneID:6022870"
                     /translation="MNYKIINKQVFEQAQLRSVSDVPFTEEELEHGMKLVVAKKDENL
                     TLYLVEVDGHKKFDVRWDDSSEIFSGWYSAWDNFLWCLNIVDPQDDGLK"
     gene            109233..110788
                     /locus_tag="BSPH_RS00550"
                     /old_locus_tag="Bsph_rRNA0416S"
                     /db_xref="GeneID:6022871"
     rRNA            109233..110788
                     /locus_tag="BSPH_RS00550"
                     /old_locus_tag="Bsph_rRNA0416S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6022871"
     gene            110878..110954
                     /locus_tag="BSPH_RS00555"
                     /old_locus_tag="Bsph_tRNA7"
                     /db_xref="GeneID:6022872"
     tRNA            110878..110954
                     /locus_tag="BSPH_RS00555"
                     /old_locus_tag="Bsph_tRNA7"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:110912..110914,aa:Ile,seq:gat)
                     /db_xref="GeneID:6022872"
     gene            110967..111042
                     /locus_tag="BSPH_RS00560"
                     /old_locus_tag="Bsph_tRNA8"
                     /db_xref="GeneID:6024544"
     tRNA            110967..111042
                     /locus_tag="BSPH_RS00560"
                     /old_locus_tag="Bsph_tRNA8"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:111000..111002,aa:Ala,seq:tgc)
                     /db_xref="GeneID:6024544"
     gene            111255..114184
                     /locus_tag="BSPH_RS00565"
                     /old_locus_tag="Bsph_rRNA0423S"
                     /db_xref="GeneID:6024545"
     rRNA            111255..114184
                     /locus_tag="BSPH_RS00565"
                     /old_locus_tag="Bsph_rRNA0423S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6024545"
     gene            114369..114484
                     /locus_tag="BSPH_RS00570"
                     /old_locus_tag="Bsph_rRNA045S"
                     /db_xref="GeneID:6022589"
     rRNA            114369..114484
                     /locus_tag="BSPH_RS00570"
                     /old_locus_tag="Bsph_rRNA045S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6022589"
     gene            complement(114523..115974)
                     /locus_tag="BSPH_RS00575"
                     /old_locus_tag="Bsph_0105"
                     /db_xref="GeneID:6022590"
     CDS             complement(114523..115974)
                     /locus_tag="BSPH_RS00575"
                     /old_locus_tag="Bsph_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:alanine symporter"
                     /protein_id="WP_012291911.1"
                     /db_xref="GI:501248893"
                     /db_xref="GeneID:6022590"
                     /translation="METIVNTLVDYIWGNALVYLALGVGLYFTVLTKAVQFRYIPEMI
                     RLLRERKESKEGISSFQAFCMALSGRVGVGNIAGVATAIAAGGPGAVFWMGIMAFLGG
                     ASAFIESTLAQLYKEKADDQYRGGSPYYIEKGLRLKGFAIFVACVICLSYGVLVPGIQ
                     ANTIATSFNTAFHIPPFITGALIVILLGLIIFGGVKRIARVADKVVPIMALAYVILTL
                     IILGANVSEIPGMVKLIITSAFGTNAIFGGIVGTAIAWGVRRSVFSNVAGAGEATFSS
                     AAAEVSHPAKQGLVQGFSIYIDTIIVCTATALMILITGMYNVTPSGTTTPLVENIPGV
                     VAGTAYTQAAVSTVFNDFGSGFVATAIFLFAFTTLMAYYYIAETTIVYLDNKLRLPIL
                     KLVLKMVFLLVVYVGSVQSVSLMWGLGDIGFGSMSYLNFIAIVLLTKPAIRVLQDYDR
                     QKKAGLDPIFDPREVGIKNAEFWIEYSNMHKKN"
     gene            complement(116243..117463)
                     /locus_tag="BSPH_RS00580"
                     /old_locus_tag="Bsph_0106"
                     /db_xref="GeneID:6022591"
     CDS             complement(116243..117463)
                     /locus_tag="BSPH_RS00580"
                     /old_locus_tag="Bsph_0106"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha"
                     /protein_id="WP_012291912.1"
                     /db_xref="GI:501248894"
                     /db_xref="GeneID:6022591"
                     /translation="MNNKVIIIGAGPAGLAAAITLAEKNIAVLVIDEYLYAGGRLLGQ
                     LYEEKPGTWWNGIVESERLVERAKAVHVEFLLQTSVSDLEKIGQMWVIHTTKGAFRTQ
                     HLLLATGAAESPFPIPGWTLPGVMSVGAAQVMTNVHRVKPGKRGVIVGVNVLSSAIAM
                     ELQLAGVHVAAITLPPTNLLTEGYSNPLEVMTSLLHVAHMAPSPLVKIGSKLMKNDFM
                     KKLGITFYPKNGVKMWDIPIMLRKAVIEIVGKNQVEGVILATVNTDGSIVKGSEQHIK
                     ADFICIAGGLYPLAELASLAGCPFHYIEQLGGFIPLHNEQMETNLEGLYVAGNITGIE
                     GAKVALAQGEVAALTIAQHLNGGASNHDIKLAIQAVEKTRATAHIQFHPEILAGRQQM
                     KQIWNESVGSLSIH"
     gene            complement(117453..117794)
                     /locus_tag="BSPH_RS00585"
                     /old_locus_tag="Bsph_0107"
                     /db_xref="GeneID:6024506"
     CDS             complement(117453..117794)
                     /locus_tag="BSPH_RS00585"
                     /old_locus_tag="Bsph_0107"
                     /EC_number="1.5.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha"
                     /protein_id="WP_012291913.1"
                     /db_xref="GI:501248895"
                     /db_xref="GeneID:6024506"
                     /translation="MTERIINHPVLGALTQKEKVTFTYDDHLFEGYKGESLAAALLAQ
                     GIRTLRLHEETGQPRGIYCNIGHCFECRVNVNGLEGGRACLTPLSDGMAVKSGQTLPT
                     TVRDWRKNDEQ"
     gene            complement(117791..118060)
                     /locus_tag="BSPH_RS00590"
                     /old_locus_tag="Bsph_0108"
                     /db_xref="GeneID:6024507"
     CDS             complement(117791..118060)
                     /locus_tag="BSPH_RS00590"
                     /old_locus_tag="Bsph_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291914.1"
                     /db_xref="GI:501248896"
                     /db_xref="GeneID:6024507"
                     /translation="MQNKSMIVCRCEEISYDELVESASKYKCSARELKLRTRAGMGYC
                     GGRTCRTMVDSIAHLHHPRKNDEVSLKHQAPIRPVRFSNLGEVKS"
     gene            complement(118199..119884)
                     /locus_tag="BSPH_RS00595"
                     /old_locus_tag="Bsph_0109"
                     /db_xref="GeneID:6024508"
     CDS             complement(118199..119884)
                     /locus_tag="BSPH_RS00595"
                     /old_locus_tag="Bsph_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012291915.1"
                     /db_xref="GI:501248897"
                     /db_xref="GeneID:6024508"
                     /translation="MNKILKRNFAITSTDDIVSKINDASKQYFVIENHKPYGAVRGKR
                     KNDVHYVACHTIQLDCPLKNAIEYMKEYEFLLVCNEEKKYLGYLRRESLAYDLAYELE
                     CGNAYLQTILNTINESCTVINAEQNVVYWTKGAESIFSVSGENIIGKPITHFFKEDQL
                     EILHTLQHRKSVYQQQHFPREDLVVMINSNPVMLHNKTIGAVVAETDITHVKKLNEEL
                     HITSEKLLNLEKQMSTNGLAFDPFTLIRGNSPKLKEVLEKVKKVAETEANILIYGESG
                     VGKELFARAVHAIREKSEAPFVAINCGAIPSGLFESEIFGYEKGAFSGAHQKGKKGKV
                     ELARGGTLFLDEIGEMPLEMQVKILRLLQEKTFYTVGGTKEMDVEFNLVAATNRDLKQ
                     LVTEGKFREDLYYRLNVVNFTVPPLRERASDILEISNYFLYEKSIKYNRPIQGIPTEI
                     ANALLKYHWPGNVRELSNVIERLVVFSDEGAIHMEDLPTDILAVMPKDKAMDVKIDFP
                     LGTELNNQLEHYEREIILDQLAKVNGNKKTCAKNLGITRATLYNRLKKLNIDV"
     gene            120059..121240
                     /locus_tag="BSPH_RS00600"
                     /old_locus_tag="Bsph_0110"
                     /db_xref="GeneID:6024509"
     CDS             120059..121240
                     /locus_tag="BSPH_RS00600"
                     /old_locus_tag="Bsph_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine oxidase"
                     /protein_id="WP_036160363.1"
                     /db_xref="GI:738204445"
                     /db_xref="GeneID:6024509"
                     /translation="MKNSHHDIVIIGGGIIGGAIAYYCAKAGLDITVLEKNELASGTS
                     SRCDGNILAIDKDPGFDSQMSLVSQRLVHELNRELDMSFEYRNPGSILVCESELEMEA
                     AQQWVNRQQEAGLDFTMLDREDLRNESKYFADDLYGGLECKTDSTVNPYMLTFSMFHS
                     AEKLGAKIKKHTEVKNIKKQPDDTFSLETNEGWITANKVINACGIWAPFIGQMLSVDI
                     PIKPRKGHILVASRQEPVGLRKVMEFGYLISKFGGERKVDADIEKYGVALVFEPTEAQ
                     NFLIGSSREFVGFDTKVNHDVAKMIARRAVRFYPKIADMSIIRTYAGLRPWTEDHLPI
                     ICEVEEVPGFYIAAGHEGDGISLAAVTGKLIQELLQHKDSCIPTEPVHLSRFQKGVLH
                     E"
     gene            121237..122256
                     /locus_tag="BSPH_RS00605"
                     /old_locus_tag="Bsph_0111"
                     /db_xref="GeneID:6024510"
     CDS             121237..122256
                     /locus_tag="BSPH_RS00605"
                     /old_locus_tag="Bsph_0111"
                     /EC_number="5.1.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291917.1"
                     /db_xref="GI:501248899"
                     /db_xref="GeneID:6024510"
                     /translation="MNFQKLFTTIDTHTGGNPTRSLISGMPKLEGKTMSEKMLFMQEN
                     YDWIRKFLMNEPRGHSVMSGVIITEPCQPEADFGVIYIETGGYLPMCGHDTIGVCTAL
                     IEANLIEVTTPFTNIKLDTPAGLIDVQIKVTDGVAKEVTFKNVPSFLLKTIEINDSEL
                     GVVECEIAYGGNFYGIIDARKINLDLAVDNSTKIINTAIRLRNAVNAVEDIVHPEYSF
                     IHGLTHIEFYTDPVNPLADLKNTVVVPPGGIDRSPCGTGTSAKIATLYLKNKLVLNES
                     FVYESIVGTMFKARVLEEVTISGLTAVIPEVTGSAWIMGMHRFFYNDQDPLKEGYLMI
                     PPMDH"
     gene            122269..123141
                     /locus_tag="BSPH_RS00610"
                     /old_locus_tag="Bsph_0112"
                     /db_xref="GeneID:6025195"
     CDS             122269..123141
                     /locus_tag="BSPH_RS00610"
                     /old_locus_tag="Bsph_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008177023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline racemase"
                     /protein_id="WP_012291918.1"
                     /db_xref="GI:501248900"
                     /db_xref="GeneID:6025195"
                     /translation="MNFHKSFQTIDTQVVGEAFRIIVQSPIMLMHEDILEADHQLNTQ
                     FEDTKQLLLNEPRGHRGMNGCLVLPSAIASYRLLFFQHAASTNFKYEALVATMTALIE
                     QGTIELSKNNTYSIETVKGVYEAYVKLSEKRDAVLSVHLILKPAQLEGEQVIIDNERR
                     YIVVEKPQQFKAIVLEELAEISTWGLLESEKYSTADGVIMYEQLNSSVRSVTFERDGY
                     ILRSPGVDSILALIAVLGEEAVRKNDSIFGSSIEIIQKHEAGYEVALTAYITGIHQFV
                     VDREDPLHHGFIIV"
     gene            123169..124071
                     /locus_tag="BSPH_RS00615"
                     /old_locus_tag="Bsph_0113"
                     /db_xref="GeneID:6025196"
     CDS             123169..124071
                     /locus_tag="BSPH_RS00615"
                     /old_locus_tag="Bsph_0113"
                     /EC_number="4.2.1.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="WP_012291919.1"
                     /db_xref="GI:501248901"
                     /db_xref="GeneID:6025196"
                     /translation="MKKLEGVFPVLVTPMKNQTDIDWDGYRQNIEHFIEAGVTGIAIN
                     GSTGEFVSLTKEERFKAVEVAVDQIKGRMTLIVGTAAETTAEAIIYTQQAEQAGADAA
                     LLINSYYAHPKDEEIYVHFKSVAESVKFPIMIYNNPFTSGVDIGLETILKVGRDVPNI
                     THIKESSGSIGKARDIVRQGQNDIEVFCGSEDLAIESLLVGAVGWISVSGNIVPELVT
                     KLYSQVKEGNLEAAWAIYDRLLPLCAFLEGSGKYVQITKRAMELKGWAGGPCRLPRLP
                     LTEEEDAQLKAIMTNLDVLAIEHY"
     gene            124092..125573
                     /locus_tag="BSPH_RS00620"
                     /old_locus_tag="Bsph_0114"
                     /db_xref="GeneID:6025197"
     CDS             124092..125573
                     /locus_tag="BSPH_RS00620"
                     /old_locus_tag="Bsph_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="betaine-aldehyde dehydrogenase"
                     /protein_id="WP_036160366.1"
                     /db_xref="GI:738204448"
                     /db_xref="GeneID:6025197"
                     /translation="MEAVLTLKPQIKEFLQSTIGLYIDGKYVQAQSGKTLNVLNPANE
                     EVIAVVSEAQAEDIDLAVHAAQQAFEGQWSMMEAAERSRIIYKLADLLEEHREELAQL
                     ESLDNGKPYKAALADDVDGTVQHFRYYAGWATKITGQTVQVSKDYLNYIVHEPVGVVG
                     QIIPWNFPLAMAAWKLGAALAVGCTVVIKPAAETPLSLLYVGQLMKQAGFPDGVVNIV
                     PGTGEAGEAIVTHKGVAKVAFTGSTKTGIHVMKKAADDVKSITLELGGKSPAIVLPDA
                     DVEEAIEGTFAGTMYNHGQNCSACTRVFVHSSLYNLFIERLAEKAKALKIGSGLDPET
                     DMGPLVSQKQLNTVLDYIEKGKEEGARIVAGGDRALEKGYFVQPTIFADVQDTMIIAQ
                     EEIFGPVMSILSFETVDEVIVRANNSKYGLAASIWTENVKKAHYIASKLQAGTVWIND
                     FGLEWETMPFGGYKQSGIGREMGGEYGLSNYTEVKSVFVNMKQ"
     gene            complement(125643..126929)
                     /locus_tag="BSPH_RS00625"
                     /old_locus_tag="Bsph_0115"
                     /db_xref="GeneID:6025198"
     CDS             complement(125643..126929)
                     /locus_tag="BSPH_RS00625"
                     /old_locus_tag="Bsph_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-54"
                     /protein_id="WP_012291921.1"
                     /db_xref="GI:501248903"
                     /db_xref="GeneID:6025198"
                     /translation="MQLSIKQTQELQIVMSAQLRQAIELLQYSTQELEQYIREQELVN
                     PLIELSEPTFKEHLQISKTCGRHYNNWHLSTKCEKNIRDELFQQVRLTFDNEKDIQLL
                     KHIIYHLDDNGYYEQSIQSSYNDLEIEKGIHLLQTIGPLGIGARNLKECLLLQTIYGP
                     NSPAHADTIISNYLEELAHNNWKKISKELDISLNDLQIIYLFIQSLQPKLSSLFYQEL
                     VHTTIPDIIVDIVDGGITFSLNDYYLPKVSIHADYFPYIKAHSSEKSYFKKHLADYHW
                     LVNSIEQRRNTMINIMKALIEKQRKFFLDGLDAIQPLTLREIADQIDVHESTVSRITT
                     NKYVQTAFGTFELKELFSSKLSTANGHSVSQIKVKSLLSDYIKSENKAKPFSDQKIAE
                     YFNSALGIEISRRTIAKYREDMSIPSSARRKIIPFK"
     gene            complement(127111..128175)
                     /locus_tag="BSPH_RS00630"
                     /old_locus_tag="Bsph_0116"
                     /db_xref="GeneID:6025199"
     CDS             complement(127111..128175)
                     /locus_tag="BSPH_RS00630"
                     /old_locus_tag="Bsph_0116"
                     /EC_number="3.4.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008177016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="WP_012291922.1"
                     /db_xref="GI:501248904"
                     /db_xref="GeneID:6025199"
                     /translation="MSKLEQLRNALQAQGTSAIIITNAQNRRYLTGFTGSAGTVIVTN
                     TRALLLVDFRYTQQATEQSKTFEVHEIDRNRLYEMIQEILDQESIQSVGFEQHHVTYY
                     TYQLMANKLTATLKPLSTIVENLRMIKTPEEIEIIKKAAWISDEAFKHILTFIKPGLS
                     EIEIANELESHMRKNGATGAAFDMIVASGHRSALPHGVASSKVIEQGDMLTLDFGAYY
                     QGYRSDMTRTIAVGEPPEQLKEIYQIVYDSLQHALSNMKAGITGQNADSYTRDYITAK
                     GYGDNYGHGAGHGIGLDIHEDIFMSTVCEDVLEENMVLTVEPGIYLPQVGGVRIEDDV
                     IITKDGVEVITHSPKELIIL"
     gene            128314..129990
                     /locus_tag="BSPH_RS00635"
                     /old_locus_tag="Bsph_0117"
                     /db_xref="GeneID:6025353"
     CDS             128314..129990
                     /locus_tag="BSPH_RS00635"
                     /old_locus_tag="Bsph_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012291923.1"
                     /db_xref="GI:501248905"
                     /db_xref="GeneID:6025353"
                     /translation="MAKKTKWLFVLLGLMLVILVGCYGKPTSGNTAKSNESDNATADG
                     DDNIATQELHLVATGDLTTMSSLGSVDALAVTAMNSVFEGLYRIGPENTPIPGMAESH
                     EVSEDGTVYTFKIRKDAVWSNGSPVTAYDFEYAWKRAINPETQAIYSYLMLDIKNAAN
                     VQTEEDPLYGKVEEIGIKALNDDTLEVQLNAPIPYFISLTTYAPFFPLNKEFTESQGD
                     QYALEADNMIYNGPFMMESWQHGQGWTFVKNESYWDKDTVKLTKITQKIVKDTATAVN
                     LYEAGEIDTAELSSEYVAQYKDSPEYSTFLKPNTYFIRMNHENKYLSNLNIRKAIDMA
                     WDKQGFADVILQDGSIPAYYLVPQGLSTDDKGNDFRDGNGDMNKTDIELAKEAWATGL
                     KELGVDQVKLEFLTYDRAESKKAAEFIKNQLETNLEGLELTINMQPNKQKLALEGAVD
                     FDLDYGGWGPDYQDPMTYIELFESTAYYNQSNYKNEKVDAFIKQAKTTSDVTERWELM
                     QQAEKLMMEDVAFAPTFQKGLSRLTKPYVKNLYEHPFSADISYKWVEIVK"
     gene            complement(130031..130237)
                     /locus_tag="BSPH_RS00640"
                     /old_locus_tag="Bsph_0119"
                     /db_xref="GeneID:6025354"
     CDS             complement(130031..130237)
                     /locus_tag="BSPH_RS00640"
                     /old_locus_tag="Bsph_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291924.1"
                     /db_xref="GI:501248906"
                     /db_xref="GeneID:6025354"
                     /translation="MQGGLFNGITYSFKRFFARVTKNGVYAFELDGDLEFVHAPSCNF
                     TYPLLLAGIIGCSTTAILSIVFYL"
     gene            complement(<130525..132384)
                     /locus_tag="BSPH_RS00645"
                     /old_locus_tag="Bsph_0120"
                     /db_xref="GeneID:6025356"
     CDS             complement(<130525..132384)
                     /locus_tag="BSPH_RS00645"
                     /old_locus_tag="Bsph_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007890201.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162502.1"
                     /db_xref="GI:738206589"
                     /db_xref="GeneID:6025356"
                     /translation="MKKILEVKNLSVSFNTYNGEVQAVRNISFDLFEGEILAVVGESG
                     SGKSVTSKSLLRLNPTESTMVKSGHIFYNGHDILSSSEQEIRAIRGAEIAMIFQDPMT
                     ALNPTMTIGHQIAESIKKHTTLRGKQITNRVIELLQLVGIKEADKRYKQYPHQFSGGM
                     RQRIVIAMALACEPRIIIADEPTTALDVSIQAQILELLKNIQQNMNLSIIFITHDLGV
                     VAKMANRVAVMYAGKIIEIGLVDEIFYHCQHPYTQGLLAAMPNPDMGTNSLYAIPGTP
                     PNLLHPPTGDAFAARNKHALKIDFIEEPPMFQVSDTHFAATWLLHKHAPKIVPVHQHL
                     AQVQQEKRNASAILDKEHPYLSLKEVKQHFSLGKNSVNKAVDGITFDIYKGEIFGLVG
                     ESGCGKSTTGRSIIGLHSITSGEILVDGRNINDNQTKKDKLTFNSKVQMIFQDPYSSL
                     NPRMKIMDIIAEGLAIHEVPKSEWKPKIYELLNIVGLTKEYANRYPHELSGGQRQRIG
                     IARALAVEPELIIADEPISALDVSIQAQIVNLLKQLQKERGLTYLFIAHDLSMVKYIS
                     DRIGVMYQGKIVELANSQELYDYPVHPYTKSLLSAIPLPDPKLERDRKRIIFNE"
     gene            complement(132398..133429)
                     /locus_tag="BSPH_RS00650"
                     /old_locus_tag="Bsph_0121"
                     /db_xref="GeneID:6025357"
     CDS             complement(132398..133429)
                     /locus_tag="BSPH_RS00650"
                     /old_locus_tag="Bsph_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_012291927.1"
                     /db_xref="GI:501248909"
                     /db_xref="GeneID:6025357"
                     /translation="MTSKLTDSTTKSHPKELFEYAPETDITDDFTYRPEQSFWQDAWR
                     GLRKNKAAIIGLCTIIVVLLLAIFGPFMNSHGYDEQNIARTNLPPKIPILENISFLGL
                     NGVDSRGIDQYEAKGIGEYFWFGTDELGRDLWTRIWEGTRISLYIAFLAATIDLIIGV
                     AYGAVSAFYGGRADNIMQRIIEVLVGIPGLIVNILLILILKPGIISITIAMVIVGWIS
                     MARIVRAQILKLKSYEYVLASRTLGASNQRLIWKHLIPNTLGPIIVATTFTIPGAIFT
                     EALLSFIGLGLQPPTASLGTIVNDSYKLLRIYPHGMIISSIVISLIMISFNLLGDGLR
                     DAFDPKTRK"
     gene            complement(133426..134355)
                     /locus_tag="BSPH_RS00655"
                     /old_locus_tag="Bsph_0122"
                     /db_xref="GeneID:6021566"
     CDS             complement(133426..134355)
                     /locus_tag="BSPH_RS00655"
                     /old_locus_tag="Bsph_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_036160369.1"
                     /db_xref="GI:738204451"
                     /db_xref="GeneID:6021566"
                     /translation="MVRYIFTRIGYMIITLFIIILLSFLLMKALPGSPFNDERLPETQ
                     KELLYKKYGLDKPVPVQFGIYLTNLVQGDLGVSFVFDNRPVTKIIKERIGASAILGFQ
                     AIIVGTIIGLLLGIIAALRHNTIIDYSATILAVLGISIPSFVFAGFLQYWVGVKLGWL
                     PIAFWNGFEYSILPTIALAVGVVATIARFTRMEMLEVLSQEYILTSKAKGLSKPIIIT
                     KHGIRNAMIPIVTIIGPLTVNTITGSLVIEKIFSIPGLGEQFVNSIITNDYQLIMGTT
                     IFYAVLFVTIVLIIDILYGLIDPRIRVTGGDNT"
     gene            134505..134580
                     /locus_tag="BSPH_RS00660"
                     /old_locus_tag="Bsph_tRNA9"
                     /db_xref="GeneID:6021567"
     tRNA            134505..134580
                     /locus_tag="BSPH_RS00660"
                     /old_locus_tag="Bsph_tRNA9"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:134538..134540,aa:Asp,seq:gtc)
                     /db_xref="GeneID:6021567"
     gene            135052..135390
                     /locus_tag="BSPH_RS00665"
                     /old_locus_tag="Bsph_0123"
                     /db_xref="GeneID:6021568"
     CDS             135052..135390
                     /locus_tag="BSPH_RS00665"
                     /old_locus_tag="Bsph_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291929.1"
                     /db_xref="GI:501248911"
                     /db_xref="GeneID:6021568"
                     /translation="MSKDQFLKYFYLPLLIGSMLMMVGCGDPIIEIEEANTYHWQKNM
                     NEVEFEKLKNDMSYIEVVETAGGAGKKVKNNEYRWNDETLLTQAYIVKFKDDKLIAKE
                     IVAVKGHSNR"
     gene            135665..136114
                     /locus_tag="BSPH_RS00670"
                     /old_locus_tag="Bsph_0124"
                     /db_xref="GeneID:6021569"
     CDS             135665..136114
                     /locus_tag="BSPH_RS00670"
                     /old_locus_tag="Bsph_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004224337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_012291930.1"
                     /db_xref="GI:501248912"
                     /db_xref="GeneID:6021569"
                     /translation="MYEIIMNSLDDTERFASKLANKLEAQDTITLEGDLGAGKTTFTK
                     ALAKELGVKRTVNSPTFTIIKQYEGRLPFNHLDVYRLAESDEDLGWDELFYGDAVSVV
                     EWAHLIEQDLPQDRLAIEIYRIGENERRFVLIPRGERYEALCEELMK"
     gene            136111..136818
                     /locus_tag="BSPH_RS00675"
                     /old_locus_tag="Bsph_0125"
                     /db_xref="GeneID:6024511"
     CDS             136111..136818
                     /locus_tag="BSPH_RS00675"
                     /old_locus_tag="Bsph_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291931.1"
                     /db_xref="GI:501248913"
                     /db_xref="GeneID:6024511"
                     /translation="MIWFGIETANTPLSIAVIKDGKIVAEMVQNIKLTHSAGAMPAIE
                     EILARIDVKPNDLDAIAVSEGPGSYTGVRIGVTLAKTLAWTLQKPLVGVSSLKALAAN
                     AALYNGLVCPIFDARRRNVYTAVYQGETLEALVEDHHAHIDDVLVRLKALEQPILFVG
                     TDVDIFWENIVQMLGDYAVRAPFSIDLPRATEVIHIATKMELPSVEATHHFVPQYKRI
                     AEAEANWLKEQKEKEHD"
     gene            136811..137263
                     /locus_tag="BSPH_RS00680"
                     /old_locus_tag="Bsph_0126"
                     /db_xref="GeneID:6024512"
     CDS             136811..137263
                     /locus_tag="BSPH_RS00680"
                     /old_locus_tag="Bsph_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_036160375.1"
                     /db_xref="GI:738204457"
                     /db_xref="GeneID:6024512"
                     /translation="MTRNVTYRKMVSDDVPAVYEIELASFPVPWTLDSFYYEVHENQY
                     AHYVLALDENGSIIGFCGMWMVIDAAQITNVAVIEQARGRGIGEGLMREAMHIARLHG
                     MEVMTLEVRVTNTVAQNLYRKLHFQDGGIRKGYYTDNGEDALVMWVNL"
     gene            137263..138279
                     /locus_tag="BSPH_RS00685"
                     /old_locus_tag="Bsph_0127"
                     /db_xref="GeneID:6024513"
     CDS             137263..138279
                     /locus_tag="BSPH_RS00685"
                     /old_locus_tag="Bsph_0127"
                     /EC_number="3.4.24.57"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA threonylcarbamoyladenosine modification
                     protein TsaD"
                     /protein_id="WP_012291933.1"
                     /db_xref="GI:501248915"
                     /db_xref="GeneID:6024513"
                     /translation="MNNGLILAIESSCDETAAAIIRNGHEIVSNVVASQIESHKRFGG
                     VVPEIASRHHVEQITVVIEEALAQANIKPADLDAVAVTEGPGLVGALLIGINAAKAFA
                     FANNLPIIGVHHIAGHIYANALVQPMEFPLLALVVSGGHTELVYMKEHGSFEVIGETR
                     DDAAGEAYDKVARVLNLPYPGGPRIDQLAHEGEEAVPFPRVWLEEGSYDFSFSGLKSA
                     VINYKHNMDQRGEAISPAGVAKGFQESVVEVLTAKTLRAAREYQVKQVIAAGGVAANK
                     GLRASLEAVFTEEGIPFFVPPLKLCTDNAAMIGAVAMPMYEAGIRGNLTMNGRPGMEL
                     KSWV"
     gene            complement(138725..140668)
                     /locus_tag="BSPH_RS00690"
                     /old_locus_tag="Bsph_0128"
                     /db_xref="GeneID:6024514"
     CDS             complement(138725..140668)
                     /locus_tag="BSPH_RS00690"
                     /old_locus_tag="Bsph_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_012291934.1"
                     /db_xref="GI:501248916"
                     /db_xref="GeneID:6024514"
                     /translation="MIVLQVNQLTKSFLADEILSGVKLEVQHRDRVALVGRNGAGKST
                     LLKIIAGQMSYDSGDIIIPKGIQVGYLEQHAGLNSTLTIWDEMMTIFEPLLAQEQTLR
                     SLEQQMADSTVYENPTLYAKVMSEYDQLQHTFKDAGGYQYESDMRSVLHGMQFYPEDY
                     DKPISSLSGGQRTRLALAKLLLSKPDLLILDEPTNHLDIETLSWLESYLKSYEGAILI
                     VSHDRYFLDQVVSIVYEVSRHRVTKYTGNYSAYLDVKAKNYERDVKLFERQQDEKAKL
                     EDFIQKNIARASTTKMAQSRRKMLERTEWMESPDGDEKSASFGFTIERQSGNDVLSVD
                     DLTIGYGDQRISSGIKLRTFREDRIALVGPNGVGKSTLLKTIVKDLTPLAGDIRYGTN
                     VQIGYYDQEQAKLSSNKSVSKELWDEWPLMNEKDIRTVLGRFLFSGEDVDKVVSSLSG
                     GEKARLALSKLMMQKAHFVILDEPTNHLDLDSKEVLENALIDYPGTLLFVSHDRYFIN
                     RIATKVVELSGTGSFEYLGDYDYYVEKKQELFELAQMKSASQPQLQQALPDKTSTSKI
                     DKEAKKRERQIRRAIEELEGKMQETTTIIDRLEEALCDPAIFTDHEKIAQLQGELATA
                     KEKHELLELEWLELNEELEHINM"
     gene            140922..141557
                     /locus_tag="BSPH_RS00695"
                     /old_locus_tag="Bsph_0129"
                     /db_xref="GeneID:6024515"
     CDS             140922..141557
                     /locus_tag="BSPH_RS00695"
                     /old_locus_tag="Bsph_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HT11.1"
                     /note="modulates transcription in response to the
                     NADH/NAD(+) redox state; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redox-sensing transcriptional repressor Rex"
                     /protein_id="WP_012291935.1"
                     /db_xref="GI:501248917"
                     /db_xref="GeneID:6024515"
                     /translation="MKQELKIPQATTKRLPLYYRFIQNFAQEGMERISSKELSEAMKI
                     DSATIRRDFSYFGALGKKGYGYDVQHLLQFFSQTLDQHETTKVALIGVGNLGSALLKY
                     NFQKNHNTHIVVAFDSKAPKDGKMISNIPVFHPDLLEEKYAEYGAELAILTVSPRSAQ
                     KMADRLAAMNAKGILNFTPERLTVPDSMQLLTIDLSVELQALIYLIRNQEV"
     gene            141723..141908
                     /locus_tag="BSPH_RS00700"
                     /old_locus_tag="Bsph_0130"
                     /db_xref="GeneID:6025107"
     CDS             141723..141908
                     /locus_tag="BSPH_RS00700"
                     /old_locus_tag="Bsph_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent protein translocase"
                     /protein_id="WP_010857065.1"
                     /db_xref="GI:499128267"
                     /db_xref="GeneID:6025107"
                     /translation="MGGIGPMSLIIIGIVALLIFGPKKLPELGKAFGSTLREFKNATK
                     GLADEDDDDKKKKELDK"
     gene            141926..142750
                     /locus_tag="BSPH_RS00705"
                     /old_locus_tag="Bsph_0131"
                     /db_xref="GeneID:6025108"
     CDS             141926..142750
                     /locus_tag="BSPH_RS00705"
                     /old_locus_tag="Bsph_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatC"
                     /protein_id="WP_012291937.1"
                     /db_xref="GI:501248919"
                     /db_xref="GeneID:6025108"
                     /translation="MNPKDLTVIEHIEELRKRLFIVAVFFVLAMAGAFFVAKPLVKYL
                     QTTGAKYNIELHAFDVVTPLAIYIQVVFLIAFILSSPVLMYQLWSFISPGLREVERRA
                     TLSYIPYSFLLFIAGLSFSYFLLFPYVIKFMMNLSNDLDIQQTIGIHEYFTFLFKLTI
                     PFGFLFQLPIVVLFFSRIGILSPDLLIRIRKYSYFGLFVCAALIAPPELASHLMVSVP
                     LFILYEISIMISRVGYRKYLKSEEIRLKEEQEAEQKRQIEEALEQQRRQIEELNNQ"
     gene            complement(142826..143590)
                     /locus_tag="BSPH_RS00710"
                     /old_locus_tag="Bsph_0132"
                     /db_xref="GeneID:6025109"
     CDS             complement(142826..143590)
                     /locus_tag="BSPH_RS00710"
                     /old_locus_tag="Bsph_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004224356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX protease"
                     /protein_id="WP_031416324.1"
                     /db_xref="GI:670467580"
                     /db_xref="GeneID:6025109"
                     /translation="MERILTVTNSPKVTKHKKTALYVLLIYILMQISSRWLLLPFHKL
                     VMKMTDLTSEQAAPITQGWYIALSFAIALILSLILTSRDKTFWNVYQGKKETIPLTII
                     WGILGFILVFFGQMIGAAIEMAVFGIEGGSQNTADIVAIAKGAPIAILAIVVFGPILE
                     EFVFRRVIFGSLVQTTNFWVAAIVSAIFFAIIHFDFSHILLYTICGLIFAFLYHKTKR
                     IWTSIIAHVMLNGFVTLVQFYAEPLQKFLQELEKMQ"
     gene            144172..145806
                     /gene="groEL"
                     /locus_tag="BSPH_RS00715"
                     /old_locus_tag="Bsph_0133"
                     /db_xref="GeneID:6025110"
     CDS             144172..145806
                     /gene="groEL"
                     /locus_tag="BSPH_RS00715"
                     /old_locus_tag="Bsph_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HT15.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_012291939.1"
                     /db_xref="GI:501248921"
                     /db_xref="GeneID:6025110"
                     /translation="MAKDIKFSEDARSLMLQGVDKLANAVKITLGPKGRNVVLEKKFG
                     SPLITNDGVTIAKEIELENPYENMGAKLVAEVASKTNEIAGDGTTTATVLAQAIIREG
                     LKNVTAGANPVGIRKGIDKAVAAALTELHTISRPVSNKDEIAQVAAISAADDEVGQLI
                     AEAMERVGNDGVITIEESKGFTTELDVVEGMQFDRGYASHYMVTDTDKMEAVLDNPYI
                     LITDKKITNIQEVLPLLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKA
                     PGFGDRRKAMLEDIAILTGGQVITEELGLDLKSADISSLGRAAKVVVTKDNTTIVEGV
                     GGADAIEARIGQIRAQLAETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKL
                     RIEDALNSTRAAVEEGIVSGGGTALLNVYAAVEKVSESEEGDVATGVKIVLRALEEPV
                     RQIANNAGLEGSIIVDRLKREEIGIGFNAATGEWVNMMEAGVVDPAKVTRSALQNAAS
                     VAALFLTTEAVVADIPEPAGAGMPDMSGMGGMPGMM"
     gene            146013..147092
                     /locus_tag="BSPH_RS00720"
                     /old_locus_tag="Bsph_0134"
                     /db_xref="GeneID:6025111"
     CDS             146013..147092
                     /locus_tag="BSPH_RS00720"
                     /old_locus_tag="Bsph_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_031416326.1"
                     /db_xref="GI:670467582"
                     /db_xref="GeneID:6025111"
                     /translation="MDKQEANRIGMGNIYYVIVLLLIASIVISAIFSVSIGQVSIPFK
                     QSMDILLHAVSNGRFGTLDSVDSESYLNIILQVRMPRVIFALLIGIGLALCGAVMQAV
                     VQNPLADPYILGISSGASLGATFAILVGFGSSALLAQFGVAFGAFAGAMLTSMAVLIL
                     SSIGGKATSVKLVLSGVVIGALCSSFSSLIIFFANNAEGIKTVTFWSMGSLASASWDK
                     TPILAIVIVLGAALFLFQHRVLNTMLLGDESAITLGINLSVYRKLYMILTSLITGTMV
                     AYAGMIGFVGLIIPHITRGIFGADHKRLMLGTLLLGGLFMIWADILSRTLIENVELPI
                     GIITSVIGSPLFIYMIVKKGYNFGG"
     gene            147097..147858
                     /locus_tag="BSPH_RS00725"
                     /old_locus_tag="Bsph_0135"
                     /db_xref="GeneID:6021632"
     CDS             147097..147858
                     /locus_tag="BSPH_RS00725"
                     /old_locus_tag="Bsph_0135"
                     /EC_number="3.6.3.34"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012291941.1"
                     /db_xref="GI:501248923"
                     /db_xref="GeneID:6021632"
                     /translation="MELVAKEIEVKIGKKEIVKNISIHVNKQQFVGLIGPNGCGKSTL
                     LKSIYKSLVPQKGMVFLDDLDVLKSPEKKISQHLGVVGQFNEMHFDLTVQQMVMLGRT
                     PHKKMLESDNQKDFDIVEEALTRTNLQAYKGRSFLSLSGGEKQRVILARTIAQQPKFM
                     ILDEPTNHLDIRYQIEILSCVRSLNIGVLAALHDLEMAAHYCDYLYAVKDGEIYAHGT
                     PEQVLTPEIIEALYHIKCQTFTNPVTNGLGFAYGL"
     gene            147872..148882
                     /locus_tag="BSPH_RS00730"
                     /old_locus_tag="Bsph_0136"
                     /db_xref="GeneID:6021633"
     CDS             147872..148882
                     /locus_tag="BSPH_RS00730"
                     /old_locus_tag="Bsph_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012291942.1"
                     /db_xref="GI:501248924"
                     /db_xref="GeneID:6021633"
                     /translation="MKKKLLLGIGLAAVLTLTACGNTTKNTSEEAQTKEHYPLTIENF
                     TKAEGGSTWEKKDQVFDKAPEKIMANTRPAAELLLHLGLGDKIVGVGANFGAVDKSVE
                     EAYSKLNILSDEYVGKEVTLGTNPDLVFGRGGLFDNAEWGVGTVDSLNDMGIKTFVLE
                     SSITGGTYDSIYKDIENIGEIFNVQDKATSFIKELKDRQQDITSKLESIKEEKSFAYL
                     HTNDPKELFVYPAHDETFFNDAFKMVKLDNIFKDETGDVSVETLIASDPDVLILPNWD
                     GSDLTKVREEIYANPKLSSMKAIKNKQIYIVDYNYMFGYGYNTIDGMEALAKEMYPDL
                     FK"
     gene            complement(148982..149638)
                     /locus_tag="BSPH_RS00735"
                     /old_locus_tag="Bsph_0137"
                     /db_xref="GeneID:6021634"
     CDS             complement(148982..149638)
                     /locus_tag="BSPH_RS00735"
                     /old_locus_tag="Bsph_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheinyl transferase"
                     /protein_id="WP_012291943.1"
                     /db_xref="GI:501248925"
                     /db_xref="GeneID:6021634"
                     /translation="MSTNDIQLFALPLGEPLTSAEWNVFHNVLPSHVQRNIQQYKQWQ
                     DRQRALLGNTLIRWVLLPFMDKTTFQITQDIYGRPNVASHQHWKGDFNLSHSGDWIVL
                     ALTTNGRVGIDVEEIKPVNKDIMHFALSKQEFHMALHQPLHVFYELWTLKEALFKTGL
                     FPHLSPHMLDTIDIKKTRADLSTQLHYLDQRHPVTICWNNGSTHVKITTLNKHQLLQS
                     "
     gene            complement(149635..152802)
                     /locus_tag="BSPH_RS00740"
                     /old_locus_tag="Bsph_0138"
                     /db_xref="GeneID:6021635"
     CDS             complement(149635..152802)
                     /locus_tag="BSPH_RS00740"
                     /old_locus_tag="Bsph_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_012291944.1"
                     /db_xref="GI:501248926"
                     /db_xref="GeneID:6021635"
                     /translation="MNNKREFDCPTSQFNKHFSKQEKLLSNHTQLLNEEDTLAYQTLN
                     RTMADYDKTITIPEVFYQVAQQFADRIALSYEDGKMTYRQLNEQSNQVAHMLLANGLQ
                     KGDYVAIIMDRSKETIISLLGVLKAGGVYVPIDPSYPKERCQYLLHDTGAPFIITKNE
                     YSDLLNDLIHNKFQSHTVLTINQMESGLSKEDLPCNLHPSDLAYIIYTSGSTGKPKGV
                     LLKHTAVINLITDNQRIYHSTEEGVFSQFISYSFDPSVTETFTAFFSGARLHMLTSIE
                     RLSIEAFADMIARERVTTATVPNAFFTQLATHLPVEYRDKLMTLQYLSVGGEALLPAI
                     VQKWQEKFGYSTEIINVYGPTECTVLTSYFKIKSQLTDMQSSIPIGKPIANYEMYVVN
                     EDEQLCPVHVTGELCIAGVGLAAGYLHQPEKTAEVFVPHLFKPDQKMYRTGDLVRLLP
                     NGVIEFVGRKDSQIKVRGFRIELGEIETVLSNYPTIQESVVIAKKMSDGQNHLFAYYT
                     VASGIQLEERNLRDYLHNLLPDYMVPERFIELLEMPLSPTGKIDRTQLASMDTHLSRS
                     NLYVAPENDTQHLLANAWEYVLNVSPIGIHDNFFHIGGHSLKVLEILVQVKKHIPFLK
                     IQDFFQYQTIAELDQYICNHQPEDLDVQTQPTNLVYKDLMEPGPLPISPIVKPLPMTT
                     VLLTGATGYLGSHVLYELLVSTKAHIYCLIRPSEKSTLEDKLMESMQFYFGHNIGRHM
                     QNRVTIIKGDLGKKKLHLTSEDEQTLIDEIDAIIHCGADVRHFGATEHFNNVNVNGTR
                     YLLELAERKPGIHFHYVSTIGIPEELAAIQWGAEEANGDFNYDTKLHNVYTQSKLEAE
                     NLVRNAVHDMIPISIYRVGNLSCHSETGKFQRNIDDNAFYRMIKAMLYLGKTPSVQWH
                     VDFTPINYASQALVCLANQPASNGHVFHLCNPVSLTYLELIDMLKEFGYDLQVMSKQE
                     YTNWLLHDDHSIEVQEYLALAIAQLEGDGASDSPFIFNCKKTIEFLANARIECAAPNT
                     AFIHQMIEYGIETGYFPEPTQVNIR"
     gene            complement(152934..154682)
                     /locus_tag="BSPH_RS00745"
                     /old_locus_tag="Bsph_0139"
                     /db_xref="GeneID:6021636"
     CDS             complement(152934..154682)
                     /locus_tag="BSPH_RS00745"
                     /old_locus_tag="Bsph_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_012291945.1"
                     /db_xref="GI:501248927"
                     /db_xref="GeneID:6021636"
                     /translation="MKKRKKQHMSISKKITAIMVSILLLFGLVTLGLSYYIVRNSNLT
                     DMNQSLDDKGMILAKTIDVNTLKSILDNPSDSNPDALRLTKEMDAINDYSDSITNLFL
                     ITVNGENINAPVLSSSILKLGAEYNQDMIAMGLSPDFLARIKEVFETKEATATDIYSD
                     EFGSYKTGLTPILDDDGNMLAAYAIDYDVSMVTGKAMSEALWTLVVTVIFLIGSSIAV
                     YTLLRKKLTPIQQLSLQSKKVANGNLELEPLPVTSTDEVGTLTQNFNSMIENLKTVIK
                     STTNVSARVSNTANILSTNMQETSDSYNTVASSMQEIASSADLQVQRAKESTITIEEM
                     SIGIQRIAMTSNQISESSILASEEAERGNDSTNKSVAQMNAISQAVNQSAASVKLLGD
                     HSNKIEEIVGIITGIASQTNLLALNAAIEAARAGEAGSGFAVVADEVRKLAEQSEASA
                     REISTLISHIQHDTNESVNIMVRAVEEVDHGIVMINDSEQSFSQILTSIHHVTGQIQE
                     LSATIEEMAAGMEQVTSAVKDMEDFSINSKDSTRAVAATSASQLNTVQQVSEEAQVLS
                     ELSEELLNVVNTFVVK"
     gene            155298..155540
                     /locus_tag="BSPH_RS00750"
                     /db_xref="GeneID:23319627"
     CDS             155298..155540
                     /locus_tag="BSPH_RS00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016994785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160381.1"
                     /db_xref="GI:738204463"
                     /db_xref="GeneID:23319627"
                     /translation="MGVGSLGIVPLEMADMALVVVVDKVVVDKVLVDKVSVDKAAADM
                     ALVGTVAADKVSDRVVDKVVDRNYQEVLLYQPRLFG"
     gene            155867..157204
                     /locus_tag="BSPH_RS00755"
                     /old_locus_tag="Bsph_0141"
                     /db_xref="GeneID:6023175"
     CDS             155867..157204
                     /locus_tag="BSPH_RS00755"
                     /old_locus_tag="Bsph_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291947.1"
                     /db_xref="GI:501248929"
                     /db_xref="GeneID:6023175"
                     /translation="MAIIKVKKINIKNLRNVRHGEIILAVNFETFLKANVVGLYGQNG
                     SGKTTIVDAFGLLKTLISGWLAEVKLPSQEKRLILAGEDTASLDFEFLVENQFGTFFV
                     HYYVELQEDQHRLYTTLERLTYRENDKGKRSKVLMAMTENGIQIRNSHLPDMSEQARI
                     QLLVIQQLARKEYRSFLFHKDLKPLLQERLTEQEIQLLQNMAVDFNRDLHVVNNQNIA
                     PLFEERIMPFSIHLEKTRGQIPYDLKGPALLPEDEFYALCEVIEQSNRVLAAIIPGLT
                     IKINIITKQTMDDGGQGIRFEFLSQRGEQELPLRTESEGILKIISVLSVLIAVYNNPN
                     ACVVIDELDSGVFEYLLGELLTVIDEDGKGQLFFTSHNLRVLEVLAIKNLWFTTTNEN
                     HRYMQLKGIKEVNNARDVYLRAIQLGGQDEEVYKETKTFKIKRAFRKAGVHHD"
     gene            157197..157928
                     /locus_tag="BSPH_RS00760"
                     /old_locus_tag="Bsph_0142"
                     /db_xref="GeneID:6023176"
     CDS             157197..157928
                     /locus_tag="BSPH_RS00760"
                     /old_locus_tag="Bsph_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291948.1"
                     /db_xref="GI:501248930"
                     /db_xref="GeneID:6023176"
                     /translation="MTKKVLLIIVEGQTEQIILEDYLDAYFENATIRFDVQREDVLTK
                     WDAHKRIPNIKNSVIRVIQSYLEKYKFLAKDLTAVVHITDADGCFIAPECVQVDEKIE
                     QKLFYTEEAILVKSNKRKEQIEQRNEMKARNVRILIANDHFSINRLKVPYQLFYFSTN
                     LEHVLWDERNEIPTEKIHKADEFIENLSGTIEDYLKAYLPVDTELPYREKMKKSWSYL
                     MEGSHSLQRGTNVPLLFEMIKTDVQ"
     gene            complement(157973..163057)
                     /locus_tag="BSPH_RS00765"
                     /old_locus_tag="Bsph_0143"
                     /db_xref="GeneID:6023177"
     CDS             complement(157973..163057)
                     /locus_tag="BSPH_RS00765"
                     /old_locus_tag="Bsph_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291949.1"
                     /db_xref="GI:501248931"
                     /db_xref="GeneID:6023177"
                     /translation="MTLSHEQKTHFQSIVDTAPSTIQPLAAALLKYMDNRNYDIEQLI
                     TEQHVQSLEELFSGPLLEVLTLFSSQERASHIKKLALRFDATIFQTDSLRRSFRSASS
                     VQDHLFQCLQLIEEMLTFEEIGLQDLLAHHSQYEHGTYPNYSSYVLKNENEKVMSFHV
                     FEQLLAEELSLENPIIEEKIESILFDEHRSSFFGHPLIRGIFKSSNSRMHEALGKLLV
                     AAARQEGLRQAIVENIDHGNLDAQLKMMKLIQEHQLTRFSSVIRAVDTWMGLGYSSFE
                     NQKITEEVLSLAIQAMEDDHFTEQLLKSERTIDIYVALWATSTKDYTKLELLLADLLK
                     RDKHIQLTTLAFLKNLSKISFTAPFVKELILTTKDIELFAFAWNNFIHANHYINSEYA
                     RDNEWEKTLQGFMKENSQLQGIEYPLFEQLEWAKNEMTKDGLSITGKPLSFVFVHLSF
                     EDLISTQIILAHYLQDEELFQRIIARSDAYPPSSRIGLLNIYCLDPITQGQREFLFNS
                     LRDRSSINRSLALKKIHALTPTQEEIAKIEDLLANKSGALRKEAISLLKVQPQDHVLQ
                     SAERLIKDNKQLKRLGGLELLLEASKDYNLANEQITALCSLLPKITKNEQVFLEQLVA
                     RDVPEYNESNGFGLYTPHAPISYDSITNSSIKMNSEEPWQQLIPLYVQTPTPIEKFFQ
                     YDLDKLLFKLEQLIHILDEYADFEYETFQWNDTKMTTTLGQKYSILATKTDSQRHASL
                     DVYPIPEAIVQWIQSSSFSSEDLAYFNFYSHLSEYPAAHDLSEAAHVLIQPFFQYEEI
                     KKYVAQFNSLKYHYTLQQIFSVLSQDIKNISGETTLHTEAVSLLERHTPVFNSFNQAA
                     GIVLQLLHQIPADQWQVNVRDKGYYYYQSTSTIIDLDIIEAFVDRLSNYATYEDYAKM
                     LAINEELTKRMQKENYSPILYDLSLFQYLDAFKAGLLKQDHLYEAIFTNTLASEIFTE
                     PSKLLDRYQSFDDLTDFLAIRNEAIDRILAIELKRGDTPTAVTKLASSISYFEGIDYF
                     LQILQALDGEKLSRGYIWQAETKKDVFSRLLTSCYPKKEETAQQLKEAWQKTEISKER
                     LIEAMMYNQHWIDLVSEVIDWEGLKESAWYFIAHTTDSLSDFAKDQIALFSSITAEDF
                     GDGAFDLAWFQSAYQTLGSKKFKVVYDAAKYASEGANHRRAQLYADTAIGKLSPKPLM
                     KEIQEKRNKDKLRALGLIPLKSADDKDALDRYQFIQQFLKESKQFGAQRRASEARAAS
                     IALENLARNAGDGEATRFIWRMELSAFNDIQQLFKAQPIEQITAHLQIEEDATITIIV
                     EKDGKRLKNIPTALKKHADVVTLQEARKDLQEQYKRARPALEQAMALETIFSAEELIN
                     LLAHPILAPLLQKLVFISGEHVGMITPEGLQVLSGNVVNLAPTTTLMIAHPYHLLESG
                     QWRQWQAYMFEHKIQQPFKQVFRELYLINADEKGRKQSLRYAGHQVNPSQTVALLKTR
                     GWQISYETGPRKVYYKENIVASLYAQADWFTPAEIEAPTIEGVYFYNRLTGKDIVLDD
                     IPAAIFSEVMRDMDLVVSVAHVGGVDPEASHSTVDMRSIIVEELAKLLKLSNVETKKQ
                     HVLIEGKLASYSLHLGSGIVHQVGGSMIPIVAVPSQHRGRIFLPMVDDDPRTAEIMAK
                     LLLLSEDTKIKDPAILAHIRSYEQTH"
     gene            complement(163071..163490)
                     /locus_tag="BSPH_RS00770"
                     /old_locus_tag="Bsph_0144"
                     /db_xref="GeneID:6023178"
     CDS             complement(163071..163490)
                     /locus_tag="BSPH_RS00770"
                     /old_locus_tag="Bsph_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291950.1"
                     /db_xref="GI:501248932"
                     /db_xref="GeneID:6023178"
                     /translation="MRLFYQQKVIGKKSRKLQKIPFFIEEPVINLQDLLIKIVTQQVQ
                     QYNEKMVDTPLHLYLTDQQLDHAAQYGKVHFGEKKNGSFQPVDQAVSTMLQAFQDELF
                     LVLHNEETIDSLNSPLAVQEDDVFTFIKLTMLAGRIW"
     gene            163974..165263
                     /locus_tag="BSPH_RS00775"
                     /old_locus_tag="Bsph_0146"
                     /db_xref="GeneID:6023380"
     CDS             163974..165263
                     /locus_tag="BSPH_RS00775"
                     /old_locus_tag="Bsph_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore gernimation protein"
                     /protein_id="WP_036160383.1"
                     /db_xref="GI:738204465"
                     /db_xref="GeneID:6023380"
                     /translation="MQIHVVRAGESLWGIAEAYGTTVQSIVDANKIPEPNRLVVGQAL
                     VIPIVGSFYYVQPGDSLWSIGQRLGINYVTLAQVNGINPNQPLAVGMRLYIPQPPKTR
                     AETLAYLEPRGTSVSEVLLDQAREAGPYLTYLALFSYEARRDGTLRIPPSQGVPQITD
                     DTGASLAMVVTNLENFSFSGELARDIFQSTAVQDLLFDNILAEANKLGDVKDIHFDFE
                     NLPGDQREAYNNFLRRAVEKFHTQGYTVSTALAPKTSASDRGPWTAGHDYRAHGEIVD
                     FVLLMTYEWGYSAGPPMAVSPLPEVEEVVKYAVSEIPAGKIMLGQNLYGYDWTLPFVQ
                     GGPIAEALSPQRAIETAKRYNAAIQYDWRAQAPFFEYYDEQGRAHIVWFEDARSIQAK
                     FNLVKQYNLRGIGYWKLGLPFPQNWLLIGANFDVVKK"
     gene            165390..167603
                     /locus_tag="BSPH_RS00780"
                     /old_locus_tag="Bsph_0147"
                     /db_xref="GeneID:6023381"
     CDS             165390..167603
                     /locus_tag="BSPH_RS00780"
                     /old_locus_tag="Bsph_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160386.1"
                     /db_xref="GI:738204468"
                     /db_xref="GeneID:6023381"
                     /translation="MGKFKKLGIILTSTAFSVGMLAPISQASANVKESSERIEIQVAS
                     TETKITKNMLIKKLRSLFPEEFKFVADQDFNSGPGHFYRDDTTVRYELNFYKTIKGKD
                     VHGSFVFKGDDLELEHFYYQPANMAEAIYPAKYSENEAQKIAQKFLGKFVNSDNFKLR
                     DDNNEYGFNITRPLSEPITYSFTYSPIYNGVLIGDQSITINVLANGDVTGMSSNAESI
                     SKASFDNLDQKKKEEDVLAQVRENLAMELRYYIDYDYRSDQSNVKLVYAPVTGFNGVH
                     ALNGQWQTANGFTEQLPKTKSVEKISAQPLPPRKNGITATEAEEFAKNFLKVDESKAK
                     LTIDLVDERENDNGETIYSVNYTYMYGNGGSGSSLEINKATGELVQYHDLSRDFLTDN
                     KVNAISKDAALKKAIDYLKEWAPSYLHEYSMPIEDAVFDQYSKDYYFTFPRIMNGIAV
                     VGDGLHVGIGADGTLRSLSVNKQKIDNWQPIKNVISADKAKEAYSKALTLQLQYVKQD
                     TESKLHYDLVYAPTYNGSLYNQIDAVSGEWLNNVDGSTEKPVISHPTAAKELNYLFNQ
                     NVLDVKDIANFNADAAVTKGEALKILLHSLTYGYYGSGDGEKQSFNNIDKKHPLYGVV
                     EQAVKMGIIQPANQFALDATLSRQEFAEWSIKLLQLDNVAKYKDIYKLNFADAASIDP
                     AYTGYIALANGMGLIDAQQNNFNATKSVSYADLAVSTVRLAKAIQENKVDRNFYY"
     gene            167711..168175
                     /locus_tag="BSPH_RS00785"
                     /old_locus_tag="Bsph_0148"
                     /db_xref="GeneID:6023382"
     CDS             167711..168175
                     /locus_tag="BSPH_RS00785"
                     /old_locus_tag="Bsph_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291954.1"
                     /db_xref="GI:501248936"
                     /db_xref="GeneID:6023382"
                     /translation="MKLKLLLAISFVMVILYGCNKEEVKDVPTNAPADQNASQQTGDT
                     PTDQVTFNFLEFSLDVDYSATESYEVEYENKKTGISAKLQDDRQNVKLQGDEAYTKLE
                     PLFKQLNFDSTTPNDEVIDQVIKVFNIEDNYQSIEVEVEFMDGNEKEFKRLP"
     gene            complement(168226..170211)
                     /locus_tag="BSPH_RS00790"
                     /old_locus_tag="Bsph_0149"
                     /db_xref="GeneID:6023383"
     CDS             complement(168226..170211)
                     /locus_tag="BSPH_RS00790"
                     /old_locus_tag="Bsph_0149"
                     /EC_number="1.11.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroperoxidase II"
                     /protein_id="WP_012291955.1"
                     /db_xref="GI:501248937"
                     /db_xref="GeneID:6023383"
                     /translation="MKKDINQKQHQLEAFRVSDKNQPLTTNQGLKIAEDEHSLKAGNR
                     GPTLLEDFHFREKMTHFDHERIPERVVHARGSAAHGIFETYECASDITKAQFLNGKGT
                     KTPVFVRFSTVAGSRGSADTVRDARGFATKFYTQEGNYDLVGNNIPIFFIQDAIKFPD
                     FVHAVKPEPNNEIPQAQSAHDTFWDFIANNQESAHMVMWHMSDRSIPRSYRMMEGFGV
                     NTYRFINSEGKSHFVKFHWKPVLGVKSLVWDEAQIIAGKDPDFHRRDLWESIERGDYP
                     EWELSVQLIPLEDEFKFNFDILDATKIWPEEEVPVRILGKMTLNKNVDNFFAETEQAA
                     FHVGHVVPGIDFSNDPLLQGRLFSYTDTQLIRLGGPNFHEIPINKPICPFHNNQRDGY
                     GRQTINVGQVSYHKNSLADNTPSPVSEEEGGYTHYEEKVEGHKVRARSESFKDHFTQA
                     RLFWLSMTEIEKEHIINAFSFELGKVKSKAIRKQVVDMFAHVSHSLATAIADNIGIVP
                     PVQVEVPHIMQTSPAVSQILNAVESVKTFKVAVIVAENTEENLNELIATLLSKNIVVE
                     LVSTKQGLLNGFEIHETFATASSVLYDGIYVSGSFHDLNQQAKAEQFIEEAYQHFKTI
                     GLAKNVSFSQHLANKNGVANNLPSFIQLLAKHRHWER"
     gene            170384..170818
                     /locus_tag="BSPH_RS00795"
                     /old_locus_tag="Bsph_0150"
                     /db_xref="GeneID:6024431"
     CDS             170384..170818
                     /locus_tag="BSPH_RS00795"
                     /old_locus_tag="Bsph_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_012291956.1"
                     /db_xref="GI:501248938"
                     /db_xref="GeneID:6024431"
                     /translation="MKEDNRNLKAFTVLFRAYQTIQEATKRDLLQFDLNQTEFSVLEF
                     LYHRGEQPIQVIGKRILIASSSITYVIDKLEQKGYVYRKSCPRDRRVTYVLLTHEGQI
                     LMEEIFPKHEQKINEIFEVLEPQELDTMILSLKKVGKNANEH"
     gene            170868..171851
                     /locus_tag="BSPH_RS00800"
                     /old_locus_tag="Bsph_0151"
                     /db_xref="GeneID:6024432"
     CDS             170868..171851
                     /locus_tag="BSPH_RS00800"
                     /old_locus_tag="Bsph_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_012291957.1"
                     /db_xref="GI:501248939"
                     /db_xref="GeneID:6024432"
                     /translation="MNHLKGVHHVTAITSSAEENYKFFTYVLGMRLVKKTVNQDDIQT
                     YHLFFADDKGSAGTDMTFFDFPNIQKGVHGTNEISKTSFRVPTDASLEYWEKRFDRLH
                     VKHTGIKEQFGKKTLSFVDFDDQQYQLISDEHDTGIASGTPWQVGPIPLKYAITGLGP
                     VFIRVANFNYFKDVLEKVMLFTEIGEEGDFHLFEVGEGGNGAQVIVEHNTVLPVARQG
                     FGTVHHAAFRVEDRAVLDEWTARFESFGFHTSGYVNRHFFESLYARVAPQILFELATD
                     GPGFMGDEPYETLGEKLSLPPFLEPKRTQIEGLVRPIDTVRSSITFDKEYE"
     gene            171920..172537
                     /locus_tag="BSPH_RS00805"
                     /old_locus_tag="Bsph_0152"
                     /db_xref="GeneID:6024433"
     CDS             171920..172537
                     /locus_tag="BSPH_RS00805"
                     /old_locus_tag="Bsph_0152"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H nitroreductase"
                     /protein_id="WP_012291958.1"
                     /db_xref="GI:501248940"
                     /db_xref="GeneID:6024433"
                     /translation="MEFSKLIDKRRSANNFLKDVKMTEEDIRPILEDVKLAPSAFNLQ
                     HANYIVVLDETMKEKVREAAYGQYKVHSASGVILVLGDKKAYKNTAELSQGMVDLGII
                     TTYELEEIVAENTHFYEDRGDAFMKEEAIRNASLSAMLFMLAAKNRGWDTCPMIGFDN
                     QKMRELFNVPEEQEIALMITIGKEKESSRRLRGYRKPVEEFATYY"
     gene            172602..173144
                     /locus_tag="BSPH_RS00810"
                     /old_locus_tag="Bsph_0153"
                     /db_xref="GeneID:6024434"
     CDS             172602..173144
                     /locus_tag="BSPH_RS00810"
                     /old_locus_tag="Bsph_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="WP_036160389.1"
                     /db_xref="GI:738204471"
                     /db_xref="GeneID:6024434"
                     /translation="MKVVAIVGSIRKESYNMQLAQFIEKRYAEKLDLEVLSLKDLPMY
                     NQDIENEAPQAVLDFKAKVKAADAVLWITPEYNGTVPGVMVNAIDWLSRVDKVMIGKP
                     SIIMGASMGNLGTVKAQLHLRDILFSPGINSPLLSGNDVYIGAVHTKFDEEGNLTDEG
                     TVKFLDVVIDNFLNWSKKYI"
     gene            173274..174674
                     /locus_tag="BSPH_RS00815"
                     /old_locus_tag="Bsph_0154"
                     /db_xref="GeneID:6024435"
     CDS             173274..174674
                     /locus_tag="BSPH_RS00815"
                     /old_locus_tag="Bsph_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012291960.1"
                     /db_xref="GI:501248942"
                     /db_xref="GeneID:6024435"
                     /translation="MRKLSLKLGIIFFITLFCIETFMMFFLHASLTNSRVEEELASLQ
                     ARGNSHRTILEQNFNNETLAHVVLMESEESTDVVVTDAEGIILASSQLHPEIKELIKK
                     IDETIPYEGKILQDNWREVKAIATISPMKREQTTIGYVFMFQNTDSIHALMKRLNKHF
                     LIVGIVSGLVTIAVIIVLSRKLAEPLIQMKEATLKMSKGDFTVALSTNGKDELGDLSN
                     AIQLLSNELNHLRQEREEFLSSIAHELRTPITFIKGYTDILYKRDLSAQDRQKYLAII
                     REETNRLSRLIKDLFDLAKMDENSFIIEKQNLDLQAFFTGIKGKLSPAFQEKDIHFEV
                     CCENGLTLWADEARLEQIIINLLNNALTYCGQGDTTTVNVKKVNGVLTIIIRDTGRGI
                     PNKDLPFIFERFYRVEKSRSRALGGSGLGLAIVKELVQAHGGEVTVKSELNKGTVFEL
                     SFKGVGADENHFMHRR"
     gene            174646..175332
                     /locus_tag="BSPH_RS00820"
                     /old_locus_tag="Bsph_0155"
                     /db_xref="GeneID:6024698"
     CDS             174646..175332
                     /locus_tag="BSPH_RS00820"
                     /old_locus_tag="Bsph_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_036160392.1"
                     /db_xref="GI:738204474"
                     /db_xref="GeneID:6024698"
                     /translation="MKTILCIDDEPRMLDLLTLYLEPVFHCRAMSSIHDALIYLEEEH
                     VDLVLLDIMMPEMDGFQVCQEIRKFWHVPIIMLTAKGEHSDIVKGLNIGADDYILKPF
                     DEEELLARIHAVLRRTKVENKVVVFEGLRLDKESFELYFQQEAIPLTPKEFSMMSLFL
                     DYQNKVFSREHLINTVWGYHVSIEDRTIDSHVRNLREKLRKSGFPADDYLQTVWGIGY
                     KWHKFADRKP"
     gene            complement(175389..175973)
                     /locus_tag="BSPH_RS00825"
                     /old_locus_tag="Bsph_0156"
                     /db_xref="GeneID:6024699"
     CDS             complement(175389..175973)
                     /locus_tag="BSPH_RS00825"
                     /old_locus_tag="Bsph_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291962.1"
                     /db_xref="GI:501248944"
                     /db_xref="GeneID:6024699"
                     /translation="MTFKRRWSGGLLLAVVLLTLSACSEDKTEPSSTSNNTPESEQQT
                     EMDHSTMNHSSSAEVPATLKKAEDPTFPVGSTALIKDGHMEGMKGAEATIVGAYKTTA
                     YIISYNPTSGGERVENHKWIIHEELIDVGEAPLSSDTEVKTTATHMAGMKNATVRIEE
                     AVPTTVYMVDYISTTNGETVKNHKWVTEDELTAQ"
     gene            complement(176090..176688)
                     /locus_tag="BSPH_RS00830"
                     /note="biotin biosynthesis protein BioC; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319628"
     misc_binding    176843..177033
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            177228..178274
                     /locus_tag="BSPH_RS00835"
                     /old_locus_tag="Bsph_0159"
                     /db_xref="GeneID:6024701"
     CDS             177228..178274
                     /locus_tag="BSPH_RS00835"
                     /old_locus_tag="Bsph_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012291963.1"
                     /db_xref="GI:501248945"
                     /db_xref="GeneID:6024701"
                     /translation="MNKKFMLFSLVLLLVLIVSMTFAVMVGSVSVTPLYVWKVILSKL
                     PFIQQTIEQDWSRSQEIIIWQIRVPRVILAAIVGAGLAIAGAAIQALVRNSIADPYIL
                     GISSGAAVGATSVIILGAFSFLGIYALSVSAFIGSLLAIGLVFFLSRVGGRVSIFRLL
                     LAGMAVSFILTAISNFILMMSKQEGALKAVMFWMLGSLAGAKWSNIIIPASIFFIVFA
                     LLWLFYRNLNLLLLGEEAAVTLGVNLQQFRIQLILLVSLLTGVLVAVSGSIGFVGLII
                     PHIVRLIVGSNYKYVIPVSALLGGIFLVWADALARIIIAPQEMPIGIITAFCGGPFFI
                     WLLRRNNYSFGEGD"
     gene            178280..179071
                     /locus_tag="BSPH_RS00840"
                     /old_locus_tag="Bsph_0160"
                     /db_xref="GeneID:6024702"
     CDS             178280..179071
                     /locus_tag="BSPH_RS00840"
                     /old_locus_tag="Bsph_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012291964.1"
                     /db_xref="GI:501248946"
                     /db_xref="GeneID:6024702"
                     /translation="MTLEAKQVSFSIYDQQILHEVSVKIKKKQFVGLIGPNGSGKSTL
                     LKNMYRLLKPESGTVLLNEQDILKQSSKAIAKNLAVVSQETPVLFDFTVHDLVSMGRT
                     PHKKLLELDQEQDFQIVKNALKQTGILHLAKRSFSSLSGGEKKRVMVARALAQQAHVL
                     ILDEPTNHLDIQHQLQLMDLIQTLHLTVVAALHDLNIAAMYCDQIYVLQRGRIVCHGT
                     PEEVLTPSLLQEVFGVFADIQTHTLTGKPYLTYVPEQFARRTNPI"
     gene            complement(179161..179475)
                     /locus_tag="BSPH_RS00845"
                     /old_locus_tag="Bsph_0161"
                     /db_xref="GeneID:6022227"
     CDS             complement(179161..179475)
                     /locus_tag="BSPH_RS00845"
                     /old_locus_tag="Bsph_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein SMR"
                     /protein_id="WP_012291965.1"
                     /db_xref="GI:501248947"
                     /db_xref="GeneID:6022227"
                     /translation="MGWVFVILAAVAEIVGVIGLRFYSQHKTVRNLLLYIGGFGLSFA
                     LLYASFNYLQLSIAYVVWVGIGTVGAVLVNIMFFGESKNLARIISIVAIIIGVAGLKA
                     VS"
     gene            complement(179475..179828)
                     /locus_tag="BSPH_RS00850"
                     /old_locus_tag="Bsph_0162"
                     /db_xref="GeneID:6022228"
     CDS             complement(179475..179828)
                     /locus_tag="BSPH_RS00850"
                     /old_locus_tag="Bsph_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein SMR"
                     /protein_id="WP_012291966.1"
                     /db_xref="GI:501248948"
                     /db_xref="GeneID:6022228"
                     /translation="MQKEWMYVGLTSLFELFWIFGFNVANSWWHWIIIVSIIAIDFHF
                     LSKACEKLPTGTVYAIFAGAGAIGTTLMDIFIFNGDFNAIKGIFMVILVLGVIGLKLA
                     DNPSKDPSTTKGVDA"
     gene            complement(179900..180481)
                     /locus_tag="BSPH_RS00855"
                     /old_locus_tag="Bsph_0163"
                     /db_xref="GeneID:6022229"
     CDS             complement(179900..180481)
                     /locus_tag="BSPH_RS00855"
                     /old_locus_tag="Bsph_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_036162504.1"
                     /db_xref="GI:738206591"
                     /db_xref="GeneID:6022229"
                     /translation="MMSKEEKIIQAAIEVFREKGIEKTKVSDIVKAAGIAQGTFYLYF
                     PSRLSVMPAIAKNMVERIIATVEEGVSDHKPFEQQLEEVVEMIFLITKEYGDIVALIY
                     AGIAQTEHLKEWENIYSPYYHWMSNFLLTAQQQGVIRDSINPSRSAKLIIGLIESAAE
                     QIYLFDDSKDETMQQLKLELLDFLYHALGLRHA"
     gene            180608..180796
                     /locus_tag="BSPH_RS00860"
                     /old_locus_tag="Bsph_0164"
                     /db_xref="GeneID:6022230"
     CDS             180608..180796
                     /locus_tag="BSPH_RS00860"
                     /old_locus_tag="Bsph_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160394.1"
                     /db_xref="GI:738204476"
                     /db_xref="GeneID:6022230"
                     /translation="MKGLMTMEDIKFAQLDPQQLAKINELEKKMGVTLVAYDSSSTPP
                     HSSGAYEENNSTTNHHPS"
     gene            180866..182032
                     /locus_tag="BSPH_RS00865"
                     /old_locus_tag="Bsph_0165"
                     /db_xref="GeneID:6022231"
     CDS             180866..182032
                     /locus_tag="BSPH_RS00865"
                     /old_locus_tag="Bsph_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291969.1"
                     /db_xref="GI:501248951"
                     /db_xref="GeneID:6022231"
                     /translation="MKEFYADLHIHIGRTAKGRAVKITGSKTLTLARILETASARKGL
                     DIIGIIDCHSPEVIEEMKVMIDQGELVELAEGGLRFQETTLIPGSEIEIYDHHCHGPI
                     HVLAYFPTLLRMEQFSDWMSQHMKNIHLSSQRIYCEGRTLQKKVRELGGLFIPAHVFT
                     PFKSLYGKGVHRSLTEVFDPQLIDAIELGLSSDTNMVRQIKELQSYPFVSNSDAHSLG
                     KLAREYQKLRLADANFIELQMALRDQQGRAIIANYGLNPLLGKYHQTVCSKCGEQLSN
                     EAMICTNCESTQIIKGVATRIQELSENFPHEKNRPPYIHQVPLDFIPGIGPKMMERLL
                     HAFGTEMNILHQVTMEQLEQIVPHKIAKLIDAARTGHLDIEVGGGGIYGKVHME"
     gene            182136..183758
                     /locus_tag="BSPH_RS00870"
                     /old_locus_tag="Bsph_0166"
                     /db_xref="GeneID:6024024"
     CDS             182136..183758
                     /locus_tag="BSPH_RS00870"
                     /old_locus_tag="Bsph_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_012291970.1"
                     /db_xref="GI:501248952"
                     /db_xref="GeneID:6024024"
                     /translation="MKLSKKCRFLATSMLALQLTIPVVANAEETGDYIAPSWTTQADY
                     VALGDSIAHGMNEVGAIGLGYPDYVAQALQKEGFITSFNKGFAMSGYTTKNVLADIQN
                     DVAKTVTGFGYPIEQVKLKASIKEAEIITLTIGANDLLPILKESQTAGIDTLAIIKAT
                     KEAVTNIAAILTEIKKLNPQAEVYVMGYYNSFPYYGESLQNQFKILLATMNTTIKTTV
                     EKAGAFFVPTSDIVAKDVPSYLPNPENIHLSEAGYFAVANEAFLPIIKTSSLWDVTNA
                     IQVHVKDHKTVDISWREATDNVGVENYQVYVNGKLASTVTADTTEMTLTDLTENTDYT
                     ITIKAIDAAGNESVQNPTAAFTTRETIRFTDTAHHWAKEYIQQAAEAGMMNGYPDGTF
                     KPNQNVTRAQVASILVRSLGISTQEKTPFTDIAKYDAKTQSEIAAAYAHGIIKGADGK
                     FNPARPVSRAELAVMIERAYEQQFKQPYIVQGSSPFTDITSYNAETKHAITMLFELGI
                     VSGDGQKYSPAASTTRGQAAKIMVNLNQLFNK"
     gene            184264..184632
                     /locus_tag="BSPH_RS00875"
                     /db_xref="GeneID:23319629"
     CDS             184264..184632
                     /locus_tag="BSPH_RS00875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ion channel protein"
                     /protein_id="WP_031416348.1"
                     /db_xref="GI:670467604"
                     /db_xref="GeneID:23319629"
                     /translation="MLSFILSTKRLVKGLWRSFKRPQFLSLFTTLFLIILSGTLFYKG
                     TEGWHWLDAMYFAVVSLIPTGVETGLYPTTSFSKIFTMIYLIVGTGVMFIMLLTLGRS
                     IVDFSLNEEEAVAVKKRLKK"
     gene            complement(184682..184969)
                     /locus_tag="BSPH_RS00880"
                     /old_locus_tag="Bsph_0168"
                     /db_xref="GeneID:6024026"
     CDS             complement(184682..184969)
                     /locus_tag="BSPH_RS00880"
                     /old_locus_tag="Bsph_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008176904.1"
                     /db_xref="GI:495452210"
                     /db_xref="GeneID:6024026"
                     /translation="MAQIINEQDIINAICLSQAYYKSIRPEDVIVELTYDDDTGFGAE
                     VEVNGQIEILNTGAMIGALRVWIKDVLHGDPFSTGIELVLDDEEGIIAKLS"
     gene            complement(184957..185421)
                     /locus_tag="BSPH_RS00885"
                     /old_locus_tag="Bsph_0169"
                     /db_xref="GeneID:6024027"
     CDS             complement(184957..185421)
                     /locus_tag="BSPH_RS00885"
                     /old_locus_tag="Bsph_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291972.1"
                     /db_xref="GI:501248954"
                     /db_xref="GeneID:6024027"
                     /translation="MKKILAALFAATLIFSTVGAALFISDTPTAEAKSYKSGKKGFSN
                     NNNSSNIQKSQDTSKDQKNATTNKNNTNSTNKADTTKKGGFFSGGLMKGLMLGGLAGL
                     LFGSLFSGMGLLGNILGLLINVAAIAVIVMLVVKIMNMFKDKKRKEEAQWHK"
     gene            185606..186622
                     /locus_tag="BSPH_RS00890"
                     /db_xref="GeneID:23319630"
     CDS             185606..186622
                     /locus_tag="BSPH_RS00890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416353.1"
                     /db_xref="GI:670467609"
                     /db_xref="GeneID:23319630"
                     /translation="MLVTFIFFISIFLLLYLTEKRRFLNAVALGLIGVYIVRVLIIHF
                     PLLLPNNQGIISEMGIFIILGSFPSIMFMLSIAMFFNSKVLLEKEGRKVRNLMLAIMG
                     LSFVIMMIGYVFVIFIQIENVLWHILFFYAFLIFGYTMFLYTSVLAYAVLYHFTPIRY
                     EPNYIIALGSGLIGDRVPPLLASRLNEAVKQYKKYGERPFIIVSGGQGTDENVSEAKA
                     MKKYLLDVHDIPANKVLMEDQSTNTEENMIFTKNIMDQHAQGEKYRSIFVTNNFHVFR
                     ASLYAKKAKLDAEGVGSKTAFYYVPNAFTREFIGLLEMNKWAHMTVFLIITLFIGLLL
                     RAYV"
     gene            186694..187980
                     /locus_tag="BSPH_RS00895"
                     /old_locus_tag="Bsph_0171"
                     /db_xref="GeneID:6023459"
     CDS             186694..187980
                     /locus_tag="BSPH_RS00895"
                     /old_locus_tag="Bsph_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160398.1"
                     /db_xref="GI:738204480"
                     /db_xref="GeneID:6023459"
                     /translation="MYEQILAKRNKERIQSLQEIMQTKNTMFAQNITLLTFTEVNLTA
                     LQKILYQIVRGLLKDQQQRHLQIVHSDQTQSVQDNVLTLLAEYDDVLRDAIPQPIYIL
                     IWQISSLERLTSRVEVVDDVLDVVEWYFDHQDDQVKILDEEDLDHEVMIDLYKEAVED
                     QDTDAQYQLGEYYNAKEGNCFQPEKSLKWFELAAAQGNADAQYVLGNFYFEGVGVEEN
                     YTQAFSLYERAALQGHADAANNLADMYFNGEGVPLDFTLARKWFDFAASKNVAEAMFT
                     LGIIYEQGLGVNKDTNAAFNMYKKSAEAGYVEAQYRLGGIYLEGRLDQAKDINRGLFW
                     YERAAEQFHIDAFYDLGFIWSKGLTGIRNIEKGIHWFKQAALQGDADAKLQLGHIYNN
                     GEGIARNLKEALKWYRLAADAGIEEAAKIVEELKGL"
     gene            188610..189902
                     /locus_tag="BSPH_RS00900"
                     /old_locus_tag="Bsph_0172"
                     /db_xref="GeneID:6023460"
     CDS             188610..189902
                     /locus_tag="BSPH_RS00900"
                     /old_locus_tag="Bsph_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_012291975.1"
                     /db_xref="GI:501248957"
                     /db_xref="GeneID:6023460"
                     /translation="MIFQKQSKTKALDLQQYTVKMDLSNRQLMVKQIEMLNVTKQDLQ
                     YLKAFQPYVMDNVDHIVNRFYNMIGTEQHLVNIISHHSSVEKLKVTLRQHIIEMFNGT
                     IDEVYYQRRVKIAKVHVHIGLRTQWYICAFQDLSLSFIDLVEQHIGHPQDQFNTIRAI
                     SKICNFEQQLVLEAYENTVEQHKENMEQEKEVIERQIVQSSELLAAISQETNSSFCRL
                     SEQSGDIEQLAKRSLEVSTLAENQALDGRECLKKQSQNMHNIIQSLHDIEENIEQLSD
                     MSKEMETIMSVVTNIANQTNLLALNAAIEAARAGEAGKGFSVVADEVRKLSIQTKESV
                     TAVALLLQKTSERTEKLEQSLINIQDEVASGEDNMLHTEGQFTNIVGAMTEAKDQNDC
                     MATKIQAIAGILSGLGTSFTEVTNSAEKLASFAQNLKS"
     gene            190094..191487
                     /locus_tag="BSPH_RS00905"
                     /old_locus_tag="Bsph_0174"
                     /note="protoporphyrinogen oxidase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6023462"
     misc_binding    191590..191689
                     /note="SAM riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="S-adenosyl methionine"
     gene            191779..193626
                     /locus_tag="BSPH_RS00910"
                     /old_locus_tag="Bsph_0175"
                     /db_xref="GeneID:6023463"
     CDS             191779..193626
                     /locus_tag="BSPH_RS00910"
                     /old_locus_tag="Bsph_0175"
                     /EC_number="2.1.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008176889.1"
                     /note="catalyzes the formation of
                     5,10-methylenetetrahydrofolate from
                     5-methyltetrahydrofolate and S-adenosyl-L-homocysteine and
                     methionine from S-adenosyl-L-methionine and
                     L-homocysteine; expressed in B. subtilis under methionine
                     starvation conditions; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine methyltransferase"
                     /protein_id="WP_031416357.1"
                     /db_xref="GI:670467613"
                     /db_xref="GeneID:6023463"
                     /translation="MGLLERLKTHVLTADGAIGTVLYGYGLEYCHEEMNVQRPELIEK
                     IHREYIAAGADIIQTNTYGANAIKLARYGLESSVQRFNEAAITIAKRAAADGGQFVLG
                     TIGGIRGIRKSDATLNDILKTVEEQASVLLAGNPDGLLLETYYDFEELTATLKMLRAK
                     TNIPIIAQVSMHEPGVLQNGMSLNIALHELEILGADIVGVNCRLGPYHTIQAFEGVEL
                     PEKAFMSAYPNASLLDLEDGRVVYESEADYFGRAAVELRDQGVRLIGGCCGTTPKHIA
                     AAKKYLEELSPVSEKYAKPAKIEIVRDAEPAKYEPLHEKVKRERSVIVELDTPRHLEI
                     EGFLEGAKQLYEAGADVVMMADNSLASPRISNIAMGALLKSTNGVRPLTHITCRDRNL
                     IGLQSHLMGLNALGIHDVLAVTGDPTKVGDFPGATSVYDVSSMELIQLIKQLNEGVSF
                     SGKPLRKKANFSVAAAFNPNVRVLDRAVARLEKKIEHGADYFISQPVYTKEKMIEIYE
                     ATKHLQAPIYIGIMPVTSYKSAEFLHHEVPGIKLSEDALARMKACGEDKERATLEGIA
                     IAKELVEVAAQYFNGIYLITPFLRYDVTLELMKYIEQLDEQKKGVSING"
     gene            193619..197050
                     /locus_tag="BSPH_RS00915"
                     /old_locus_tag="Bsph_0176"
                     /db_xref="GeneID:6023274"
     CDS             193619..197050
                     /locus_tag="BSPH_RS00915"
                     /old_locus_tag="Bsph_0176"
                     /EC_number="2.1.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydrofolate--homocysteine
                     methyltransferase"
                     /protein_id="WP_012291979.1"
                     /db_xref="GI:501248961"
                     /db_xref="GeneID:6023274"
                     /translation="MAKHLIEEQLDKRILILDGAMGTMLQNENLTADDFGGEELDGCN
                     ENLVLTRPDVIEKIHHKYLEAGADIICTNTFGGTPLVLNEYSLGAKAEEINKRAVEIA
                     RQAVDNYSTSDWPRFVAGAMGPTTKTLSVTGGITFDELEENFYVQAKALIEAGADVLL
                     LETSQDMLNVKAGTLGVTRAFEKTGKELPVMISGTIEPMGTTLAGQTIDAFYISIEHI
                     QPLSVGLNCATGPEFMTDHIRSLAELSTGYISCYPNAGLPDEEGCYHESPESLSQKLK
                     GFAEKGWLNIVGGCCGTTPAHIAAIREALKDEKPRQLPEKTHGHVVSGIEPLLYDDSM
                     RPLFIGERTNVIGSRKFKNLIIDGKFEEAAEIARAQVKNGAHVIDICLANPDRDELAD
                     IRGFMQEVVKKVKVPLVIDSTDEKVIEEALKFSQGKAIINSINLEDGEERFDAVLPLV
                     KKYGASLVVGTIDETGMAVDRHRKLEIAERSYQLLTEKWGIEPEDIIFDPLMFPVGTG
                     DEQYIGSALETIEGIRLIKEKMPRTLTVLGVSNISFGLPPVGREVLNAVYLYHCTQAG
                     LDYAIVNTEKLERYASIPEAEIKLANDLLFNTNDETLAVFTDFYRDKKKEKTEADIPK
                     TVEGRLAYYILEGTKEGLIADLEAAREIFETPLDIINGPLMNGMAEVGRLFNDNQLIV
                     AEVLQSAGVMKAAVAHLEQYMEKNEESAGKGKMVLATVKGDVHDIGKNLVDIILSNNG
                     YKVVDLGIKVTPAQLIEAIRKEKPDFIGLSGLLVKSAQQMVTTAQDFKEAGIDVPILV
                     GGAALSRRFTETKIADEYGGPVIYSKDAMQGLEQANLLMGEGTRENFLAEIAESRQKR
                     LEADEKRAARPAKEVTIKPARTVKEAPVFLPADLRRHVKKEYAVSHLYPYVNMRTLLG
                     HHLGLKGQVQPLLDAGDPRATELKDLVDDYLKSDLLKPSGLYQFFPAQADGDDVIIYD
                     PADSKTEIERFTFPRQQIDPFLCLADFLRTVESGEMDYIALMVVTAGQGVMAKARQLK
                     EDGKFLESHALQSTALELAEGFAERMHQEIRDQWGFPDVTDFTMRDRFAAKYQGQRFS
                     FGYPACPNLEDQEKLFGLLKPEDIGVHLTEGFMMEPEASVSAIVFAHPDARYFNV"
     gene            197151..197660
                     /locus_tag="BSPH_RS00920"
                     /old_locus_tag="Bsph_0177"
                     /db_xref="GeneID:6023275"
     CDS             197151..197660
                     /locus_tag="BSPH_RS00920"
                     /old_locus_tag="Bsph_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphinothricin acetyltransferase"
                     /protein_id="WP_031416360.1"
                     /db_xref="GI:670467616"
                     /db_xref="GeneID:6023275"
                     /translation="MIRLMEEKDIPEVLEIYNDIILTSKAVYRYEIQSLDEKVKWFRE
                     QQALGNPLLVFDDNGMVAGFATYSQFRPYPGYKYTMEHSVYVHKEHYQKGIATNLMLQ
                     LIEIAKEQGVKTLVAGIDGENIGSIKAHEKLGFEYAGTIKNAGYKFEQWLDLVFYQLH
                     LTGPIHKRI"
     gene            197759..198790
                     /locus_tag="BSPH_RS00925"
                     /old_locus_tag="Bsph_0178"
                     /db_xref="GeneID:6023276"
     CDS             197759..198790
                     /locus_tag="BSPH_RS00925"
                     /old_locus_tag="Bsph_0178"
                     /EC_number="1.14.19.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_012291981.1"
                     /db_xref="GI:501248963"
                     /db_xref="GeneID:6023276"
                     /translation="MATIKEKTKKLRQDVAPFAKSDTRKSVFQMINTIVPLIALWVAG
                     YLLVDVSPWLTVGLSVISAGFVVRTFIIFHDCTHGSFFKSKKANDWVGFFTGVLTSFP
                     YEKWKREHTIHHATSSNLDKRGIGDIDMMTVEEYMQASKGQRLWYRFYRNPFVMFGLG
                     PLYMVLVLNRFNRKDAKQKERTNTILTNIVIAGVCAALIFFMGWQAFLLVQGVTLFIA
                     GALGIWLFYIQHTYEDSYFEHDSEWDYVKAAVEGSSYYKLPKILQWVTGNIGFHHVHH
                     LAPRVPNYNLEKAHNETPPLHTATTITLRTSLESLRYKLYDEEQSKFVTFKEVELIIK
                     RKAKGSIAA"
     gene            199113..200063
                     /locus_tag="BSPH_RS00930"
                     /old_locus_tag="Bsph_0179"
                     /db_xref="GeneID:6023277"
     CDS             199113..200063
                     /locus_tag="BSPH_RS00930"
                     /old_locus_tag="Bsph_0179"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012291982.1"
                     /db_xref="GI:501248964"
                     /db_xref="GeneID:6023277"
                     /translation="MWISFEMVINIVMTILYGYVYLSIFTAFFIGNIRRPVGFYIMYG
                     LHIGFTVISTGAGFFVELHLFLSQLPFVVLTILAVVLLPLTIYSKNKRENLEGQLETA
                     NERIAELIVFEERQRIARDLHDTLGQKLSMIGLKSDLASRLIERDPQQALVEIKDIRQ
                     TASIALKEVRELVSDMRTAKFEDELMRISQILKAAEMEFVFEGDKNALQVPPLVENVL
                     SMCLKEAVNNVVKHSGATKCEIAFHQNFKEVYLVVRDNGQGITKKQAWKTGNGLKGMR
                     ERLEFINGSFKIESVDGTTLSVTIPVAITHQSVKENLKNI"
     gene            200080..200691
                     /locus_tag="BSPH_RS00935"
                     /old_locus_tag="Bsph_0180"
                     /db_xref="GeneID:6023278"
     CDS             200080..200691
                     /locus_tag="BSPH_RS00935"
                     /old_locus_tag="Bsph_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008432946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein DesR"
                     /protein_id="WP_031416364.1"
                     /db_xref="GI:670467620"
                     /db_xref="GeneID:6023278"
                     /translation="MIRIVIAEDQGMLLGALRSLLSMEDDMEVVGLAKNGEEAVMLVE
                     EHQPDICVMDIEMPVKTGLDAAEEMHGSGSDCKVIILTTFARPGYFERARKASVRGYL
                     LKDSPIEELVSAIRTIMDGKRIYAPELVDFVYEDDSENPLTERESQVLTLVAEGKTTK
                     EIAAELFLSAGTVRNYISTILEKLNVGNRIEAIARFKEKGWNK"
     gene            complement(200736..201710)
                     /locus_tag="BSPH_RS00940"
                     /old_locus_tag="Bsph_0181"
                     /db_xref="GeneID:6021570"
     CDS             complement(200736..201710)
                     /locus_tag="BSPH_RS00940"
                     /old_locus_tag="Bsph_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline dehydrogenase"
                     /protein_id="WP_012291984.1"
                     /db_xref="GI:501248966"
                     /db_xref="GeneID:6021570"
                     /translation="MLLRDFFIHLSENQLLNSAAKKYGLKLGAQSVVAGTNIEETIAS
                     IKELNAHNISCTVDNLGEFVSSKEEATAAKDKILSVVEAIHENDVKAHISLKPSQLGL
                     DIDVDFCYDNLYEIVEKAAAYDIFVNFDMEDFGRLQTSFDMVEELSKTFSNVGTVIQS
                     YFYRAKDDIEKFKDYRLRIVKGAYKEPVEVAYQDKLDIDLNFIELIEYHLLHGKFTSI
                     ATHDHNIIAHVKRFVADHNIPLDKFEFQMLYGFRTDMQKELAKEGYNFCVYVPFGEDW
                     YGYFMRRLAERPQNLNLVTKQVFTKKTNTVLAVAAGAFVLGRLTKRNK"
     gene            complement(201784..202536)
                     /locus_tag="BSPH_RS00945"
                     /old_locus_tag="Bsph_0182"
                     /db_xref="GeneID:6021571"
     CDS             complement(201784..202536)
                     /locus_tag="BSPH_RS00945"
                     /old_locus_tag="Bsph_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012291985.1"
                     /db_xref="GI:501248967"
                     /db_xref="GeneID:6021571"
                     /translation="MTYTSLSLTLIFVCIPLLLSKTLKLGLEKDTLIATLRSIVQLLA
                     VGYILKFVFDANSYMYIFLMVALMILVATFNARKKGEGIKGITWKIALTLVIIEIITQ
                     GVLLGFNIVPATAQYIIPISGMLIGNSMVLSILFLNRFTAEITSHKDQMELILSLGGT
                     PKQAVHRQLINAVKASMIPTIESQKTIGLVQLPGMMSGQIIGGADPIQAVQFQLLIIF
                     ALLTTATLSSIMIGFLSYPALFNERMQILEMK"
     gene            complement(202533..203264)
                     /locus_tag="BSPH_RS00950"
                     /old_locus_tag="Bsph_0183"
                     /db_xref="GeneID:6021572"
     CDS             complement(202533..203264)
                     /locus_tag="BSPH_RS00950"
                     /old_locus_tag="Bsph_0183"
                     /EC_number="3.6.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_012291986.1"
                     /db_xref="GI:501248968"
                     /db_xref="GeneID:6021572"
                     /translation="MNTLYEPAIHFQQVQFSVNDKMILKSITGSFPKGQITTLVGPSG
                     AGKTTLLKLCNGLLSPTNGQILIDNEPISNYEPSALRRHVGIALQAAPMIAGTVKENI
                     ALPRTLQGKKLSQQEAIQYLEDVGLDESFLYQSTNELSGGQRQKVSIARTLINQSSIL
                     LLDEITSALDRQSVKDIEKLIVTINQKYNVTMIWITHNLQQALTIGHYTWVMMNGELI
                     ETGKSALLKAPTNPRVAEFVQGASI"
     gene            203364..203864
                     /locus_tag="BSPH_RS00955"
                     /old_locus_tag="Bsph_0184"
                     /db_xref="GeneID:6021573"
     CDS             203364..203864
                     /locus_tag="BSPH_RS00955"
                     /old_locus_tag="Bsph_0184"
                     /EC_number="2.1.1.63"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     S-methyltransferase"
                     /protein_id="WP_012291987.1"
                     /db_xref="GI:501248969"
                     /db_xref="GeneID:6021573"
                     /translation="MEKLYFDTLTFAQGSMYIVASNNGLAYIGTPNASFDEVKEWAKK
                     PFKGYSFEENQEQLQPYKEQLTAYFNKELTEFDVPIHVKGTPFQLAVWDALKELPYGS
                     TTSYGSIAERIGNPKAVRAVGSAIGANPILAIIPCHRVIGKNGQLTGFRSGLDVKQFL
                     LELEKA"
     gene            complement(203931..205232)
                     /locus_tag="BSPH_RS00960"
                     /old_locus_tag="Bsph_0185"
                     /db_xref="GeneID:6021574"
     CDS             complement(203931..205232)
                     /locus_tag="BSPH_RS00960"
                     /old_locus_tag="Bsph_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="WP_012291988.1"
                     /db_xref="GI:501248970"
                     /db_xref="GeneID:6021574"
                     /translation="MEEIILSVNLIWVMLGTILVFFMHAGFAMVEAGFTRSKNAVNII
                     MKNFLTISLGGIVYFLCGYAIMFGDTVGGIFGISGFALNGVDDLSFFIFQAMFAATGA
                     TILSGAVAERTNIFAYIGIIILMSLVVYPVVGHWVWSGQGWLTDLGFVDFAGSTVVHL
                     TGAVAAFVAAVMVGPRLGKYENGRVNVITGHSIPLGALGVFLLWFGWFGFNGASTLAA
                     DPELVPNVIANTFFAAAAGVVATAFYTKFRYGHIDGSLTLNGALAGLVGITAGAANVS
                     IIGSIIIGLIAAPLLVEGVRFLEWKLKVDDPVGAIAVHGICGVWGTLAVGLFDSNGQG
                     LFYGGGLSLLGIQAVGVIATIAWVSVSVTAGIFIIKAFVPLRVTAEEEIAGLDVIEHG
                     APAYEFQDIFKSSAVRGETFAHRLTHFGKTQSNVQQEEQHI"
     gene            complement(205246..205587)
                     /locus_tag="BSPH_RS00965"
                     /old_locus_tag="Bsph_0186"
                     /db_xref="GeneID:6023012"
     CDS             complement(205246..205587)
                     /locus_tag="BSPH_RS00965"
                     /old_locus_tag="Bsph_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004224478.1"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of NR-I,
                     the transcriptional activator of the glutamine synthetase
                     gene (glnA); at low nitrogen levels P-II is uridylylated
                     to form PII-UMP and interacts with an adenylyltransferase
                     (GlnE) that activates GlnA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="WP_012291989.1"
                     /db_xref="GI:501248971"
                     /db_xref="GeneID:6023012"
                     /translation="MKKIEVIIRPEVFGAVRDGLAQQGIAGLSVSEIAGCGRQLGRTG
                     LFRGNTYEIEFLPKLKLEMIVDDSKVDGIVEILLREAATGKVGDGKIFIYPVEQAIRI
                     RTKEVGSIAVE"
     gene            205900..207360
                     /locus_tag="BSPH_RS00970"
                     /old_locus_tag="Bsph_0187"
                     /db_xref="GeneID:6023013"
     CDS             205900..207360
                     /locus_tag="BSPH_RS00970"
                     /old_locus_tag="Bsph_0187"
                     /EC_number="6.3.4.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173699.1"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-diphosphate and nicotinate from nicotinate
                     D-ribonucleotide and diphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="WP_036160402.1"
                     /db_xref="GI:738204484"
                     /db_xref="GeneID:6023013"
                     /translation="MRSNYADDSLALHTDLYQINMAESYWADGIHNKKAIFELYFRKL
                     PFGNGYAIFAGLERMLDYLRNFRFSESDITYLREEVGYKEDFIEYLKDIRFTGDMYSM
                     VEGELVFANEPIVRIEAPLVEAQLIETALLNIVNYQTLIATKASRIKQIIKNEVAMEF
                     GTRRAQEMDAAIWGTRAAFIGGFASTSNVRAGKLFNIPVSGTHAHALVQAYKNDYDAF
                     HSYAKRHRDCVFLVDTYNTLKSGVPTAIKVAKELGDKINFIGIRLDSGDIAFLSKEAR
                     RMLDAAGFHDAKIIVSNDLDEYTILNLKAQGAKVDVWGIGTKLITAYDQPALGAVYKM
                     VAIENSEGQLEDTIKISANAEKVTTPGLKNVYRIIDKKNGKAEGDYIAMQDENPQEEE
                     RIKMFHPIHTFVSKFVTNFEAKNLHQHVIHHGEINYTNPTLEEMRDYAAGNLELLWDE
                     YKRAMNPEEYPVDLSQKCWDNKMRNIEEVHNMVKQM"
     gene            207379..208203
                     /locus_tag="BSPH_RS00975"
                     /old_locus_tag="Bsph_0188"
                     /db_xref="GeneID:6023014"
     CDS             207379..208203
                     /locus_tag="BSPH_RS00975"
                     /old_locus_tag="Bsph_0188"
                     /EC_number="6.3.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HTT1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_012291991.1"
                     /db_xref="GI:501248973"
                     /db_xref="GeneID:6023014"
                     /translation="MTLQQQIIEELRVQPTINAQEEIRKSIDFLKEYAKHYSFVKGFV
                     LGISGGQDSTLTGKLAQLAVDELNKEVGEMKYSFWAIRLPYGVQADEQDCQDAIDYIK
                     PTGSYTVNIKDAVDASVKALANAGVELNDFVKGNEKARERMKVQYSIAAMNGGVVLGT
                     DHAAEAITGFYTKFGDGGADLMPIFRLNKRQGKQLLAELNCPEHLYTKVPTADLEENR
                     PSLPDEVALGVSYDQIDDYLEGKEIPEEPRQLLEGYYLRSQHKRHMPITIFDVFWK"
     gene            208361..208681
                     /locus_tag="BSPH_RS00980"
                     /old_locus_tag="Bsph_0189"
                     /db_xref="GeneID:6023015"
     CDS             208361..208681
                     /locus_tag="BSPH_RS00980"
                     /old_locus_tag="Bsph_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_012291992.1"
                     /db_xref="GI:501248974"
                     /db_xref="GeneID:6023015"
                     /translation="MRTSRVNATTSSVFRQENQYLHAGDISHNFGQNPQNLFKNSLQR
                     NKEKKRSSINTPNQQKQHQQTAPIHMDSTNDLQIRRELNETALKLSRLSRQKKLLNSY
                     RSSI"
     gene            208888..209526
                     /locus_tag="BSPH_RS00985"
                     /old_locus_tag="Bsph_0190"
                     /db_xref="GeneID:6023016"
     CDS             208888..209526
                     /locus_tag="BSPH_RS00985"
                     /old_locus_tag="Bsph_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291993.1"
                     /db_xref="GI:501248975"
                     /db_xref="GeneID:6023016"
                     /translation="MKKLWLPALLLLLLAACNSEKPQVKEKGSEQDATEMETEVVDDS
                     VQVASLVDSRLQEPKEDTVCEMCNMKVYMKDHEMGVFSTQAIKEDGTIAFYDDIGCLL
                     NAEVANEEKNAKFVRDFVTKEWAKVEDVTIVKTELKSPMNWGYIYFVNKAEADTYIQE
                     NPNAYVEELQKIKDDALERRKKMMEKKAKEESGDSSSMHSNEMNHGQEGHGH"
     gene            209562..210857
                     /locus_tag="BSPH_RS00990"
                     /old_locus_tag="Bsph_0191"
                     /db_xref="GeneID:6021604"
     CDS             209562..210857
                     /locus_tag="BSPH_RS00990"
                     /old_locus_tag="Bsph_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding protein CusF"
                     /protein_id="WP_012291994.1"
                     /db_xref="GI:501248976"
                     /db_xref="GeneID:6021604"
                     /translation="MLNKVVNVMKRICLFVLFFLWASQTANAEFDLQLAIDQAKPGEI
                     VHIPAGRYQGNFIVKKPIKLLGEKGVELYSQNTEPALKIDHTANVSIENIMISAKNKG
                     IVVNETENLKLKAIEIKNIQVGIHIQRSKHIRIVENKIVGNQLHYAEKGNGVAVFKSE
                     DIAIEHNAIDLVQDGIYVEEAKQIDVRQNEVTNSRYGTHFMYSSDVKVDYNSYFQNVT
                     GLMVMMTTDLEIARNTVRNHNDFNSYGLLMYDTQQAKVRKNSFQNNRVGVALQKCSVI
                     QIQENRFQMNQTALEGTKVDKHSIIKDNQFTGNILTARSDQQGLRLVRNFYDDYRGID
                     VAGDGFGDVPYVAVSSFGQWMVRQPVYQFFVASPSVMILTSLDQQVNKTEQNLLVDNE
                     PRLISHTKEKGLSINILQFIIGLVVTMGGFWLWKRGMLV"
     gene            210854..211306
                     /locus_tag="BSPH_RS00995"
                     /old_locus_tag="Bsph_0192"
                     /db_xref="GeneID:6021605"
     CDS             210854..211306
                     /locus_tag="BSPH_RS00995"
                     /old_locus_tag="Bsph_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416375.1"
                     /db_xref="GI:670467631"
                     /db_xref="GeneID:6021605"
                     /translation="MIRWITILVICSTILGGCSGKVYNPRDIISETDICEICNMSIVH
                     QEYAGQIVLTNGDYKIFDDIGCLMDYLTLNGEGEIGAAYIKNKANNEWIDVYKATYVY
                     NPGYWTPMNYGVLAFATEAEAQEWMTNEGEGQLLAYQDLLTFNWGIHK"
     gene            211351..212106
                     /locus_tag="BSPH_RS01000"
                     /old_locus_tag="Bsph_0193"
                     /db_xref="GeneID:6021606"
     CDS             211351..212106
                     /locus_tag="BSPH_RS01000"
                     /old_locus_tag="Bsph_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162507.1"
                     /db_xref="GI:738206594"
                     /db_xref="GeneID:6021606"
                     /translation="MQLVAFLFTFVFVAIIVIQRMALPDMEGFTRQTASFLNVLLFLL
                     PLFIITIGSMSLAGDIESGWFSLLKTYPMKIAQYIIGKYVAISLAFLLVVLVAFGVVL
                     ALGGLLDGVQLPIILVILTLLCIFIFVSLGIVLGAMAKTRLFALALSLVVWSFFLLLI
                     SYALMALGAVVAGHVLQKLTIISIHINPVEWLRFGYFIFTHQASVLGPAFYGVTKFYS
                     SPEGHVMYVIVTLLWIILPLILATKFLKEDPKR"
     gene            212103..212783
                     /locus_tag="BSPH_RS01005"
                     /old_locus_tag="Bsph_0194"
                     /db_xref="GeneID:6021607"
     CDS             212103..212783
                     /locus_tag="BSPH_RS01005"
                     /old_locus_tag="Bsph_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="WP_012291997.1"
                     /db_xref="GI:501248979"
                     /db_xref="GeneID:6021607"
                     /translation="MILLEAKNVANVYGNGRGLKEATFTLHSGKILALVGGNGAGKST
                     LIRLLTGQEKKKSGEMIWHKPQVIRYMPDDVNFPIMLTAAEIFELLASLKQVDQDEQE
                     RILKRVSLWDVRNQPAKQFSKGMLQRLNLAQSLLGSGSLLILDEPTNGLDPFWIAQLK
                     HVMIEEKKKGNTVIFSTHLLSFAEEIADDVLVLHDGEIIISGPITEIFTQENSTSLEE
                     IWLKRLEL"
     gene            212976..213920
                     /locus_tag="BSPH_RS01010"
                     /old_locus_tag="Bsph_0195"
                     /db_xref="GeneID:6021608"
     CDS             212976..213920
                     /locus_tag="BSPH_RS01010"
                     /old_locus_tag="Bsph_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase"
                     /protein_id="WP_012291998.1"
                     /db_xref="GI:501248980"
                     /db_xref="GeneID:6021608"
                     /translation="MNSQIQNVLENIEKVMIGKREVAELSLVALLARGHVLLEDVPGV
                     GKTMMVRSLAKSFDAQFKRIQFTPDLLPSDVVGISIYNPKTLEFEFRPGPIMGDVILA
                     DEINRTSPKTQSALLEGMEEASVTIDGKTLAINQPFFVMATQNPIEHEGTYPLPEAQL
                     DRFLLKIKMGYPTRGQEVEILRRAENGKAIEKIDAVLSVAQLIELQELVQGVYVEDSV
                     KNYMVELATQTRENSYVYLGVSPRATLALMKASQAYAFMKGRSYVIPDDVQYLVPFVF
                     SHRLVLKPDARYDNVTANEIIERIIAKTPVPTKRFAEQ"
     gene            213917..215098
                     /locus_tag="BSPH_RS01015"
                     /old_locus_tag="Bsph_0196"
                     /db_xref="GeneID:6023901"
     CDS             213917..215098
                     /locus_tag="BSPH_RS01015"
                     /old_locus_tag="Bsph_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012291999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012291999.1"
                     /db_xref="GI:501248981"
                     /db_xref="GeneID:6023901"
                     /translation="MRQWKAFLEKSKHFLLVVFLMVVTFCYAMFQGGFVSWFVFFTVS
                     PFLVYALFFFVVRESILVVERKIEPSHIERGQSAKVTISVERKTRFPFAYMMMEELVD
                     SEGLVQAKLQSSAAIKFVGFRKKFNWHYELVNMPRGEHRYLGVTIAFYDFFGWAKKMV
                     VAEKEQTILVYPRLREMKYSALQTKYDVGPMMSPYSIVKDTTMSVGLREYVPGDRFSW
                     IHWKSFAKTQTLQSKEFEDRQSSELMLVLDAKKSTLFEDKIELVASMLNMIVQELGDI
                     SFIAAGEMTKVFPVIQGEKQLDQVMYHLAAIKPTENVKFRFYDQQAFKQVATLLYVTN
                     EVSDEFLHTLANIVKSCICFVVTKQPPVQSEVTLRYKHIQMVYVDPTDFYHVFTGVMK
                     P"
     gene            215095..217278
                     /locus_tag="BSPH_RS01020"
                     /old_locus_tag="Bsph_0197"
                     /db_xref="GeneID:6023902"
     CDS             215095..217278
                     /locus_tag="BSPH_RS01020"
                     /old_locus_tag="Bsph_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase"
                     /protein_id="WP_012292000.1"
                     /db_xref="GI:501248982"
                     /db_xref="GeneID:6023902"
                     /translation="MKQSLGEFLELAVAYIIVFFILREWLMPIMQLTNTGGFHLFLVF
                     IGLSLALSLFRVHPVLSGIVKLGYIIWCIVFIYSESPVLSGKTISFLLAEWKGNMAAI
                     ISGDFGLVSDAFRTVLFLVLIWMLVYLIHHWVSVRKNIFYFFVMTVFFIATLDTFSEY
                     NGKTAIVKVVILGLMMTGVLFVKRLWLQAGTTSNAFGKWKIVIPMLVSVILFGSIAFF
                     LPKTGPTWADPVPFIQGVTGQDGNGAGMKSVGYSQDDSQLGGPFQGDNTLIFTASSRD
                     RHYWRVETKDTYTSKGWILSEGNFGKNVYESNAPIMTSLQVGLPENERQIQLDIAASM
                     PFLIQTYGLLSVSAQDSTLFIQDEQTERMTIEQQNDTSKSLSNYTLSYSEPVYSMEQL
                     QLSLPATLETLDLSFDRFMQLPVELPQRVRDLALAITQDETTVYDQIKAVEGYFRTNG
                     FRYDKTQAAIPAENQDYVDQFLFDTKVGYCDNFSTSMVVLLRSIGIPARWVKGFAPGT
                     AGPMTDGLREYRITNDNAHSWVEAYIPGTGWMEFEPTIGFSGNANIDYDIPLDTSEQE
                     EILQPEQKPEQPQQQEQVSNKEQSKSTFSLDMLWAWMKKFAYVWGIGLILLLISGIAL
                     YLQRKTWLPKMHVRAYRKKTADWSTFDSSYHILLKQLSRIGLRMRDGETLHMFAERVD
                     ASLETDEMQKLTAVYEQHVYGKDKQEVDFIKLKESWEYLINRTIG"
     misc_binding    217311..217412
                     /note="purine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="guanine and/or adenine"
     gene            217567..219120
                     /locus_tag="BSPH_RS01025"
                     /old_locus_tag="Bsph_0198"
                     /db_xref="GeneID:6023903"
     CDS             217567..219120
                     /locus_tag="BSPH_RS01025"
                     /old_locus_tag="Bsph_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="WP_031416382.1"
                     /db_xref="GI:670467638"
                     /db_xref="GeneID:6023903"
                     /translation="MTASPLLKEQEKIVVLDFGSQFNQLITRRIREFGVFSELHPHTV
                     TAEEIKEMNAAGIIFSGGPNSVYDENAFHVDPAIFELGLPILGICYGMQLMAHTNGGK
                     VEGAETREYGKAEIKVTASNKLFGELPTEQIVWMSHGDHVTEVPAGFEVIATSASCPI
                     AAMANVERKLYAVQFHPEVRHSVYGNDLLRQFVFDVCEAKGDWSMANFIELEIAKIRE
                     IVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCMFVDHNLNRKGEVEQVMKTFTEDF
                     DMNLIKIDARKRFMDKLAGVSDPEKKRKIIGNEFIYVFDEEASKLEGMDFLAQGTLYT
                     DIIESGTSTAQTIKSHHNVGGLPEDMQFQLIEPLKTLFKDEVRALGLELGLDEKIVWR
                     QPFPGPGLGIRVLGEVTEEKLEIVRESDFILREEIANAGLDRDIWQYFTVLPDIRSVG
                     VMGDARTYDYAIGIRAVTSIDGMTSDWARIPWDVLEKISVRLVNEVKHVNRVVYDITS
                     KPPATIEWE"
     gene            219294..219962
                     /locus_tag="BSPH_RS01030"
                     /old_locus_tag="Bsph_0199"
                     /db_xref="GeneID:6023904"
     CDS             219294..219962
                     /locus_tag="BSPH_RS01030"
                     /old_locus_tag="Bsph_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurase"
                     /protein_id="WP_031416432.1"
                     /db_xref="GI:670467690"
                     /db_xref="GeneID:6023904"
                     /translation="MEKNKPIIHTLAVGMPKELIDSKGRSMITGIEKQKIQEVYLSAH
                     GFDGDDVADKKHHGGPDRAVCLYPAEHYIQWEQELGKPLPTAAFGENLTVTNMLEADT
                     CIGDIYKIGDAVIQITQGRVPCSTIDKYTESNTLLKRMIETGYTGFLGRVLEEGTICA
                     SSNIELVEKHPAQVSVLYCNEVYFKNKDADAMKHIRAVDALAEDWKQKLEKRIQVLQS
                     KVMN"
     gene            220423..221724
                     /locus_tag="BSPH_RS01035"
                     /note="guanine permease; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319631"
     gene            222201..223758
                     /locus_tag="BSPH_RS01040"
                     /old_locus_tag="Bsph_rRNA0516S"
                     /db_xref="GeneID:6024017"
     rRNA            222201..223758
                     /locus_tag="BSPH_RS01040"
                     /old_locus_tag="Bsph_rRNA0516S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6024017"
     gene            224062..226991
                     /locus_tag="BSPH_RS01045"
                     /old_locus_tag="Bsph_rRNA0523S"
                     /db_xref="GeneID:6024018"
     rRNA            224062..226991
                     /locus_tag="BSPH_RS01045"
                     /old_locus_tag="Bsph_rRNA0523S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6024018"
     gene            227177..227292
                     /locus_tag="BSPH_RS01050"
                     /old_locus_tag="Bsph_rRNA055S"
                     /db_xref="GeneID:6024019"
     rRNA            227177..227292
                     /locus_tag="BSPH_RS01050"
                     /old_locus_tag="Bsph_rRNA055S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6024019"
     gene            227450..227719
                     /locus_tag="BSPH_RS01055"
                     /db_xref="GeneID:23319632"
     CDS             227450..227719
                     /locus_tag="BSPH_RS01055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160410.1"
                     /db_xref="GI:738204492"
                     /db_xref="GeneID:23319632"
                     /translation="MKRNMFSTLSILCLLLTFLMFGYDSTKWYGSFFKFLSDLSIFTP
                     FILGGIGMVSTFLGIKEYRFILVVLHSFLLLLILGIYIKALYGFY"
     gene            227869..228063
                     /locus_tag="BSPH_RS01060"
                     /old_locus_tag="Bsph_0206"
                     /db_xref="GeneID:6022045"
     CDS             227869..228063
                     /locus_tag="BSPH_RS01060"
                     /old_locus_tag="Bsph_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292006.1"
                     /db_xref="GI:501248988"
                     /db_xref="GeneID:6022045"
                     /translation="MGKKQIWYEVQENESIEECLERMRNDGYMAIGRKEEPLFHLVDG
                     EPTLLRQKIQFKAILTQDME"
     misc_binding    228157..228255
                     /note="purine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="guanine and/or adenine"
     gene            228463..228951
                     /locus_tag="BSPH_RS01065"
                     /old_locus_tag="Bsph_0208"
                     /db_xref="GeneID:6022047"
     CDS             228463..228951
                     /locus_tag="BSPH_RS01065"
                     /old_locus_tag="Bsph_0208"
                     /EC_number="4.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="WP_012292008.1"
                     /db_xref="GI:501248990"
                     /db_xref="GeneID:6022047"
                     /translation="MNPKIGVIMGSSSDWETMKHACDILDELQVPYEKKVVSAHRTPD
                     LMFEYAEAARKRGIQVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALNGLDSLLSI
                     VQMPGGVPVATVAIGKAGATNAGLLAAQILSTTDAELADKLDARREATKQQVLESTGD
                     LV"
     gene            228948..230072
                     /locus_tag="BSPH_RS01070"
                     /old_locus_tag="Bsph_0209"
                     /db_xref="GeneID:6022989"
     CDS             228948..230072
                     /locus_tag="BSPH_RS01070"
                     /old_locus_tag="Bsph_0209"
                     /EC_number="4.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="WP_012292009.1"
                     /db_xref="GI:501248991"
                     /db_xref="GeneID:6022989"
                     /translation="MTKIIYPGQTIGIIGGGQLGRMMALAAKESGFKIAVLEPAMDSP
                     CGQVADVRIVAPYDDEAALEELAEVSDVITYEFENIDYEGLKRLSQMAYVPQGAELVR
                     ITQNRITEKDAIVRAGCPVAPYIVAKTYEELVANIDSIGYPCIVKTARGGYDGKGQQL
                     LTSTEDLPLAKELFMHSPCIAEGFVPFVKEVSVIVQRNGSGESYCQPVGENIHVHHIL
                     HETIVPARITESTAQAAEREALKIADYLHLVGTLAVEMFVLEDGGIVINELAPRPHNS
                     GHYSIEACNVSQFHQHIRAVCGWPLRKPELWAPSIMINVLGQHVVPLSNSIAKYPEWS
                     IHLYGKAEAKVNRKMGHVTIMTKNLEETLQQIESSGIWSE"
     gene            230086..231381
                     /locus_tag="BSPH_RS01075"
                     /old_locus_tag="Bsph_0210"
                     /db_xref="GeneID:6022990"
     CDS             230086..231381
                     /locus_tag="BSPH_RS01075"
                     /old_locus_tag="Bsph_0210"
                     /EC_number="4.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173672.1"
                     /note="Catalyzes two discrete reactions in the de novo
                     synthesis of purines: the cleavage of adenylosuccinate and
                     succinylaminoimidazole carboxamide ribotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="WP_012292010.1"
                     /db_xref="GI:501248992"
                     /db_xref="GeneID:6022990"
                     /translation="MIERYTRPEMGAIWTEQNKYQAWLEVEILACEAWAEIGDIPKED
                     VAKIRENASFDVNRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAL
                     SYLIKQANDILRKDIVNFIDIIAVKAKEHKHTVMMGRTHGVHAEPTTFGLKLGLWYEE
                     MKRNLERFEAAAKVIETGKMSGAVGTYANIDPRVEQYVCDQLGLAASPISTQTLQRDR
                     HAQYLGALALIATSIEKFATEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSEN
                     MVGMSRLMRGYMVTAYENVALWHERDISHSSAERVILPDATITLNYMLNRFGNIVKNL
                     TVFPENMKRNMTRTFGLIYSQRILLALIDKGLVREEAYDTVQPLAMQAWDEQVQFRTL
                     VDASEKITSYLTKEELDECFDYNYHLQHVDMIFERLGLN"
     gene            231511..232221
                     /locus_tag="BSPH_RS01080"
                     /old_locus_tag="Bsph_0211"
                     /db_xref="GeneID:6022991"
     CDS             231511..232221
                     /locus_tag="BSPH_RS01080"
                     /old_locus_tag="Bsph_0211"
                     /EC_number="6.3.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HTV1.1"
                     /note="catalyzes the formation of
                     (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
                     carboxamido)succinate from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate and
                     L-aspartate in purine biosynthesis; SAICAR synthase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="WP_012292011.1"
                     /db_xref="GI:501248993"
                     /db_xref="GeneID:6022991"
                     /translation="MTKGQLLYEGKAKKLYTTEEPNVLLVEYKDSATAFNGEKKEEIE
                     GKGILNNRITSLIFEKLQGNGIASHFVKQLSDTQQLVRKVDIIPIEVVVRNIVAGSLA
                     KRIGLEEGTPLKRPIVEFYYKDDELGDPFITTEHIDVLELATSAEVSAIYDKALAINK
                     VLQPIFADVNVTLIDFKLEFGRDADGHVLLADEISPDTCRLWDATTKQKLDKDVFRRD
                     LGNLTEVYTIILSRLGGK"
     gene            232224..232472
                     /locus_tag="BSPH_RS01085"
                     /old_locus_tag="Bsph_0212"
                     /db_xref="GeneID:6022992"
     CDS             232224..232472
                     /locus_tag="BSPH_RS01085"
                     /old_locus_tag="Bsph_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173668.1"
                     /note="With PurL and PurQ catalyzes the conversion of
                     formylglycinamide ribonucleotide, ATP, and glutamine to
                     formylglycinamidine ribonucleotide, ADP, and glutamate in
                     the fourth step of the purine biosynthetic pathway;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_012292012.1"
                     /db_xref="GI:501248994"
                     /db_xref="GeneID:6022992"
                     /translation="MKKVKIYVTLRESILDPQGSAVQGSLAKMGYGEVEDLRIGKYLE
                     LSINDTERDIDTLVKEMCEKVLTNVVIEDYRYEVEEAN"
     gene            232475..233158
                     /locus_tag="BSPH_RS01090"
                     /old_locus_tag="Bsph_0213"
                     /db_xref="GeneID:6022993"
     CDS             232475..233158
                     /locus_tag="BSPH_RS01090"
                     /old_locus_tag="Bsph_0213"
                     /EC_number="6.3.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992382.1"
                     /note="With PurL and PurS catalyzes the conversion of
                     formylglycinamide ribonucleotide, ATP, and glutamine to
                     formylglycinamidine ribonucleotide, ADP, and glutamate in
                     the fourth step of the purine biosynthetic pathway;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_012292013.1"
                     /db_xref="GI:501248995"
                     /db_xref="GeneID:6022993"
                     /translation="MKFAVLVFPGSNCDIDMYHAIKDELGEEVEYVWHTATDLSGFDG
                     VLVPGGFSYGDYLRCGAMANQSNIMAEVKKVADAGKPVLGVCNGFQILTEAGLLPGAL
                     LRNTNLKFMCRTVQLKVENNNTLFTNQYEQGQIIHIPIAHGEGNYYCDEETLQSLKDN
                     NQIVFTYSGDNPNGSLEDIAGIINERGNVLGMMPHPERAVDALVGGADGLAVFKSIVK
                     QWRENHVNN"
     gene            233145..235379
                     /locus_tag="BSPH_RS01095"
                     /old_locus_tag="Bsph_0214"
                     /db_xref="GeneID:6021862"
     CDS             233145..235379
                     /locus_tag="BSPH_RS01095"
                     /old_locus_tag="Bsph_0214"
                     /EC_number="6.3.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_012292014.1"
                     /db_xref="GI:501248996"
                     /db_xref="GeneID:6021862"
                     /translation="MSTTKFEPTAQQIKDEKLYAGMGMSDEEFALVEGILERLPNWTE
                     TGLFSVMWSEHCSYKNSKPVLRKFPTKGPQVLQGPGEGAGIVDIGDEQAVVFKMESHN
                     HPSAIEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELKSARGKYLFEEVVAGIA
                     GYGNCIGIPTVGGEIQFDPCYEGNPLVNAMCVGLIDHKDIQRGIAAGVGNTVMYVGAK
                     TGRDGIHGATFASEELTEESENQRPAVQVGDPFMEKLLLEACLEVVKSDALVGIQDMG
                     AAGLTSSSAEMASKAGSGVEMNLDLVPQRETGMTAYEMMLSESQERMLLVVKKGREDE
                     IKAIFDKYDLDAVAIGRVTDDKMLRLLHNGQIVAEVPADALAEDAPVYHKPSAEPAYY
                     AQFQAIENTEPVVTDYKETLNALLKAPTIASKEWVYDQYDYQVRTSTVVKPGSDAAVI
                     CVRGTNKGLAMTTDCNSRYIYLDPEVGGAIAVAEAARNIVATGGTPLAITDCLNFGNP
                     EKPEIFWQIEKSADGISAACTALNAPVIGGNVSLYNERSGEAVYPTPTIGMVGLIEDL
                     AHVTTQEVKGAGDIVFVIGETTTEFGGSELQKLLNNGVISGKAPAIDLEIEAARQQAL
                     LKAIKAGIVQSAHDVAEGGLAVAIAEKTFSANGLGVEVTLTGSATTALFSESQSRFVV
                     TVKEEHAATFVEIIKDAHKIGVVTNDALVKINGDKGVLVEGTVEEFRSNWKGAIPCLL
                     NSEA"
     gene            235355..236779
                     /locus_tag="BSPH_RS01100"
                     /old_locus_tag="Bsph_0215"
                     /db_xref="GeneID:6021863"
     CDS             235355..236779
                     /locus_tag="BSPH_RS01100"
                     /old_locus_tag="Bsph_0215"
                     /EC_number="2.4.2.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_012292015.1"
                     /db_xref="GI:501248997"
                     /db_xref="GeneID:6021863"
                     /translation="MLAELRGLNEECGVFGIWGNPNPAHLSYYGLHALQHRGQEGAGI
                     VVSDGQHLRAVKGEGLVNDVFNEDKLKAVNGKAAIAHVRYTTAGGGGIENVQPLLFHS
                     STGSLSIAHNGNLVNATHLKQYLERQGSIFHSSSDTEVLAHLIKKSSHSPFRAKVKNA
                     LSLLKGAYSCLIMTKDEMLVARDPHGLRPLSLGKLGEGWIVASETCAFDLIGAEFVRS
                     VEPGELLIINDEGVKSDRFAEMEKRSMCAMEYVYLARPDSDIDGINVHMARKRMGKQL
                     ARECAHIEADVVTGVPDSSISAAIGFAEESGIPYELGLIKNRYVGRTFIQPTQELRER
                     GVKMKLSPVVQVVKGKRVVMVDDSIVRGTTSRRIVKMLKDAGAAEVHVVISSPPMTNP
                     CYYGIDTSTHEELIASSHNVDEIREVIGADSLTFLSVEGMVETIARPYEDENRGLCLA
                     CFTGKYPTEIFPDTILPHEKELLR"
     gene            236873..237928
                     /locus_tag="BSPH_RS01105"
                     /old_locus_tag="Bsph_0216"
                     /db_xref="GeneID:6021864"
     CDS             236873..237928
                     /locus_tag="BSPH_RS01105"
                     /old_locus_tag="Bsph_0216"
                     /EC_number="6.3.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole synthetase"
                     /protein_id="WP_012292016.1"
                     /db_xref="GI:501248998"
                     /db_xref="GeneID:6021864"
                     /translation="MSKAYEQAGVNIEAGYEAVKRMKSHVERTNRLGVMGTFGGFGGM
                     FDLSELNLKEPVLISGTDGVGTKLKLAFMVDKHDTIGVDCVAMCVNDIVAQGAEPLYF
                     LDYVALGKAEPAKIEQIVKGVADGCVQSGAALIGGETAEMPGLYEEDEYDLAGFAVGA
                     CEKSAIVTGERIVEGDVLIGIASSGVHSNGYSLVRKIVFADRQYAVDAIVENYEDLGP
                     IGEALLVPTKLYAKPVLAALKAADVHGCAHVTGGGFYENLPRMMPEGLATEIDLGSWP
                     VLRIFEFLKDKGQLEDKDLYNVFNMGIGFVIAAPAAEADKVMAAVEANGEKAYTIGRV
                     IKGNGVVFNGTHDGSLV"
     gene            237928..238497
                     /locus_tag="BSPH_RS01110"
                     /old_locus_tag="Bsph_0217"
                     /db_xref="GeneID:6021865"
     CDS             237928..238497
                     /locus_tag="BSPH_RS01110"
                     /old_locus_tag="Bsph_0217"
                     /EC_number="2.1.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="WP_012292017.1"
                     /db_xref="GI:501248999"
                     /db_xref="GeneID:6021865"
                     /translation="MTAPTKIAVFASGSGSNFQAIQEAIERKELHAKIELVVTDKPGA
                     YVVTRAEHLGIPVLALNPKDFASKAAYEKVIVDALHECDVKWIVLAGYMRLISDVLLA
                     AFPQRIVNIHPSLLPAFPGKDAIGQALNHGVKITGVTVHFVDEGMDTGPIIAQAAVSV
                     IEGNREATEAAIHKQEHLLYTKALQQLLQ"
     gene            238603..240129
                     /gene="purH"
                     /locus_tag="BSPH_RS01115"
                     /old_locus_tag="Bsph_0218"
                     /db_xref="GeneID:6021866"
     CDS             238603..240129
                     /gene="purH"
                     /locus_tag="BSPH_RS01115"
                     /old_locus_tag="Bsph_0218"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225728.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine biosynthesis protein purH"
                     /protein_id="WP_012292018.1"
                     /db_xref="GI:501249000"
                     /db_xref="GeneID:6021866"
                     /translation="MTKRALISVSNKDGILEFAKELVALGYEILSTGGTKKMLQDNAV
                     AVTAVDEVTKFPEILDGRVKTLNPMIHGGLLGKFDDDSHQAQMNEHGIEPIEIVCVNL
                     YPFVETISKPNVTWDDAIENIDIGGPTMLRSAAKNHQYVTVIVDSNDYATVLEELKAG
                     GATTIETRRKLAAKVFRHTAAYDSYISNYLTEEEFPESLTMTYELKQNLRYGENPHQK
                     AAFYQKRLGSDFSLAYATQLHGKELSYNNIQDGNAALQIVKEFEMPAAVAVKHMNPCG
                     VGTGVTLEEAFDKAYEADPTSIFGGIIALNMEVDAATAEKLSHIFLEIIIAPAFSQEA
                     LDILTKKKNIRLLTIPFEQAKQDQFNVVSVEGGLLVQEPDRYGFANADIKVVTDREPT
                     KQEWEALQLGWSVVKHVKSNAIVVTDSQMTLGVGAGQMNRVGAAKIAFEQAGEKAKGA
                     ALASDAFFPMSDTVEAAAAAGITAIIQPGGSIKDQDSIDKANEYGITMIFTGVRHFKH
                     "
     gene            240203..241462
                     /locus_tag="BSPH_RS01120"
                     /old_locus_tag="Bsph_0219"
                     /db_xref="GeneID:6024414"
     CDS             240203..241462
                     /locus_tag="BSPH_RS01120"
                     /old_locus_tag="Bsph_0219"
                     /EC_number="6.3.4.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292019.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_012292019.1"
                     /db_xref="GI:501249001"
                     /db_xref="GeneID:6024414"
                     /translation="MNVLVIGSGGREHAIARQFNISPSVNQVFVAPGNDGMRGEVEVV
                     SIDTMDFAGLAQFAKENDITLTFVGPEQPLAEGIVDFFTARGLQIFGPTKMAAQLESS
                     KSYAKDVMSKYNIPTAAHKTFTDAEQAIAYIKEQGAPIVIKADGLAAGKGVVVAMTEQ
                     EAIEAVQDMIGNQRFGESSSRVVIEEFLDGEEFSFMSFVHKGQIYPMVIAQDHKRAYD
                     GDRGPNTGGMGAYSPVPQISQEVVDIAYQTIVKPTVKGMEADGASFTGILYAGLILTK
                     KGPKVIEFNARFGDPETQVVLPRMASDFGAFMVALMNEQPFDLQWSEDAMLGVVIAAE
                     GYPGDVEKGKTLPNLAEISKSYAVFHAGTKLVDGQFVGNGGRVLLVGAKAPTLQEAQE
                     KVYAGMTKETWDHFFFRKDIGWRTFKK"
     gene            complement(241576..241998)
                     /locus_tag="BSPH_RS01125"
                     /old_locus_tag="Bsph_0220"
                     /db_xref="GeneID:6024415"
     CDS             complement(241576..241998)
                     /locus_tag="BSPH_RS01125"
                     /old_locus_tag="Bsph_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162509.1"
                     /db_xref="GI:738206596"
                     /db_xref="GeneID:6024415"
                     /translation="MQQANLSEKNAFCRFAMGTSLTAFGIAKVSRNPNCTKGRLMIAL
                     GAMKMAEGIFKYCPAKALMSTNMQNAMNTSMQSMFSGQNSMSSEQIDKLMKDFSSAIA
                     GNSSGSQDTASTQSDTSTSTQNSSTRSNSTSNTAQNPS"
     gene            242202..243923
                     /locus_tag="BSPH_RS01130"
                     /old_locus_tag="Bsph_0221"
                     /db_xref="GeneID:6024416"
     CDS             242202..243923
                     /locus_tag="BSPH_RS01130"
                     /old_locus_tag="Bsph_0221"
                     /EC_number="3.5.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="WP_012292021.1"
                     /db_xref="GI:501249003"
                     /db_xref="GeneID:6024416"
                     /translation="MDPVWKITKIRQQLAVIDGKKAPDIVLKNARYLHSMMKQWIVGN
                     IWILGDRIVYAGDRMPPLIEGTQVVDCTGKTVVPGYIEPHVHPFQLYHPQSFADFCGQ
                     LGTTTFISDNLSFVLNLENKKAFSILDHLKKLPFSFYWWTRFDSQTELEQEEEVFSNT
                     SILEWLERSDVLLGGELTGWPKLLHGDDQMLYRMQMAKGLGKKIEGHFPGASERTLAR
                     MKLLGADGDHEAMTVEEVERRIMQGYAVTLRHSSIRPDLPHLLKGIVEKELPIFDHLM
                     MTTDGSPPSFHEDGVMDKCIQAALDAGVSPIDAYQMASYNVARYYNMSNLHGFIATGR
                     FASLNILQDEYHPVPESVLSKGVWLKRDGDRVHRLAAIDYSAIPAFHLDFSLDAQDFQ
                     FSMPFGIQLVNDVITKPYNSLITREGQLADHDECYLMLINRQGHWHVNTMIKGFATGV
                     QGFASSYSNTGDILLIGKNKEDMIKAFEEMKAMNGGIVLVEKGEVIADIPLSIGGLLY
                     DGDVLTLAEKEKALKQALAERGYHLGDAIYTLLFLQSTHLPYIRITPKGIFDVMKNKL
                     LLPAVMR"
     gene            243982..245037
                     /locus_tag="BSPH_RS01135"
                     /old_locus_tag="Bsph_0222"
                     /db_xref="GeneID:6024417"
     CDS             243982..245037
                     /locus_tag="BSPH_RS01135"
                     /old_locus_tag="Bsph_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160415.1"
                     /db_xref="GI:738204497"
                     /db_xref="GeneID:6024417"
                     /translation="MFKTKKLWMTMAFSALVIGGCSKDTPKVKEDDERVTQEEKVVEE
                     QIQKPAFVAPLTGEAVQEEITQRPIVVTINNHPAARPQSGLAAADIIYEMLAEGNVTR
                     FLAVYQSELPENIGPVRSARSYFIDIAKGFNAFYVAHGYSPEAKTMLDNRVVDNINGM
                     AYDGILFKRSSERVAPHNSYITSEKIRKGAEMVGASMNYSEKVLQAFYEPDERGKIGI
                     ETSQVDIYYGNNEDFHNSYVYDHQSNYYERQSAGVDTKDMLTGEALSLANVLFFEMDH
                     QIVDDIGRQTIDLTSGGNAYVFQNGYLREVKWANVNGIPTAVEQSGEPVKLVPGKSWV
                     HFVPSSPGLQAMVKTQP"
     gene            245053..245373
                     /locus_tag="BSPH_RS01140"
                     /old_locus_tag="Bsph_0223"
                     /db_xref="GeneID:6024418"
     CDS             245053..245373
                     /locus_tag="BSPH_RS01140"
                     /old_locus_tag="Bsph_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004225717.1"
                     /db_xref="GI:490344206"
                     /db_xref="GeneID:6024418"
                     /translation="MQIEKIRGHQTDQLFKAVLELKDIEECYKFFDDLCTISEIQSLA
                     QRFEVAHLLRLKKTYESIKKETGASTATISRVRRCFDYGNDTYDEMLGRLYPDEKPFQ
                     APKE"
     gene            245484..246172
                     /locus_tag="BSPH_RS01145"
                     /old_locus_tag="Bsph_0224"
                     /note="heptaprenylglyceryl phosphate synthase; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6024460"
     gene            246205..248454
                     /locus_tag="BSPH_RS01150"
                     /old_locus_tag="Bsph_0225"
                     /db_xref="GeneID:6024461"
     CDS             246205..248454
                     /locus_tag="BSPH_RS01150"
                     /old_locus_tag="Bsph_0225"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase PcrA"
                     /protein_id="WP_012292024.1"
                     /db_xref="GI:501249006"
                     /db_xref="GeneID:6024461"
                     /translation="MEQLTKNLLAGMNPEQERAVKTTEGPLLIMAGAGSGKTRVLTHR
                     IAYLIIEKEVYPSKVLAITFTNKAAREMRERIDGILGNGTGDSMWVSTFHSMCVRILR
                     RNIDQLGISRNFSILDSTDQLSVIKNVMKDENIDPKRFEPRAILNAISAAKNECITAD
                     DYAGHMNDKNPYEQTVARVYKGYEKRLRRNQSLDFDDLIMTTITLFKRVPEVLEYYQN
                     KFQYIHVDEYQDTNKSQYLLVQLLAKKFKNICVVGDSDQSIYRWRGADIGNILSFEKD
                     YPNAKVIMLEQNYRSTKRILQAANDVIQNNTTRYPKELRTENAEGEKIALYKAYNEQE
                     EAQFVVQTIQQLMEKENRTFDDFAILYRTNAQSRVMEEVLVKSNMVYQIVGGTKFYDR
                     KEIKDLLAYLRLIANNDDDLSLARIINEPKRSIGATSFEKMARYAIEQDRSIFDAMND
                     LIFMGLSGKAANSAEQFYAMIKGFTEMQEYLSVTEIVEQVIDKSGYRTMLQNEKTIEA
                     ESRLENIEEFLSVTKAFEERSDDKSLIAFLTDLALIADIDALDKEDASKGNIILMTMH
                     AAKGLEFPIVFIIGMEENIFPHSRSLDDQDEMEEERRLMYVGVTRAEERLYLTCAQSR
                     TIFGRSSFNNASRFLGEISEDITESISKAGAKTNVPFATSNRSSNYQKRTLGSVQQTQ
                     PATARLQSTGGDQYGWKAGDKAVHKKWGTGMVVSVKGEGDSTELDIAFPQPIGIKRLL
                     AQFAPIEKA"
     gene            248469..250472
                     /gene="ligA"
                     /locus_tag="BSPH_RS01155"
                     /old_locus_tag="Bsph_0226"
                     /db_xref="GeneID:6024462"
     CDS             248469..250472
                     /gene="ligA"
                     /locus_tag="BSPH_RS01155"
                     /old_locus_tag="Bsph_0226"
                     /EC_number="6.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HTW6.1"
                     /note="this protein catalyzes the formation of
                     phosphodiester linkages between 5'-phosphoryl and
                     3'-hydroxyl groups in double-stranded DNA using NAD as a
                     coenzyme and as the energy source for the reaction;
                     essential for DNA replication and repair of damaged DNA;
                     similar to ligase LigB; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_012292025.1"
                     /db_xref="GI:501249007"
                     /db_xref="GeneID:6024462"
                     /translation="MNEIEQRIAELNKLLHEYGYAYYVLDKPVVADSVYDQLLHELIA
                     LEEANPSLIFPDSPTQRVGGTVVEGFKKVTHDYPMLSLSNAFNEADLQEFDRKVRQAI
                     GDHFSYVCELKIDGLAISLKYENGVFVQGATRGDGVVGEEITANLKTIHAIPLRLKEP
                     ITIEVRGEAYMPKKSFEKLNAQRADNGEELFANPRNAAAGSLRQLDPKIAASRQLSTF
                     IYAIGGDGEIYGIDGHAEMLDYLEDLGFPSNKERQRCSTIEEVMAFIEHWTENRPHLA
                     YEIDGIVIKVDRYAQQDELGYTAKSPRWAIAYKFPAEEVVTTLLDIDLTVGRTGVVTP
                     TAILTPVQVAGTTVQRASLHNEDLIRDKDIRLGDTVIIRKAGDIIPQVVGVLIEQRPE
                     NSVPFEMPKNCPVCDSELIRIEGEVALRCVNPACFAQIAESIKYFVSRNAMNIDGLGD
                     KVVEQLLRADLIHDVSDLYHLTIEQLVELERMGEKSATNLVNAIQASKENSMERLLIG
                     LGIRHVGEKAAKIVSEQFGSMEAVMAATEEQLVAIYEIGDKMASSLVEYFSNDDARAV
                     IERLAEVGVNMTFKGKKVEVVVGDNPFAGKTIVLTGKLEQLTRNEAKAKIEELGGTVT
                     GSVSKKTDLVIAGEDAGSKLAKAEQLGIEVWNEDNLIEQLNLI"
     gene            250582..251721
                     /locus_tag="BSPH_RS01160"
                     /old_locus_tag="Bsph_0227"
                     /db_xref="GeneID:6024463"
     CDS             250582..251721
                     /locus_tag="BSPH_RS01160"
                     /old_locus_tag="Bsph_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416797.1"
                     /db_xref="GI:670468069"
                     /db_xref="GeneID:6024463"
                     /translation="MKSFRLIPALVAAAMLVGCVPSNEGGTELTQETQQNEKTETTII
                     PSIQIDDSYYKTLIPYKESASRGLVVSNIFTKYDMKEVEAGLMRLSHNEFDTENYYFQ
                     EGQYLAESTVSSWLARSSQTEDGLNPPTTDTMTPEERATKAPIYLSHIVEQNYLTKTK
                     DNKVKLGGISIGLALNSIYYYQKEQYGEYYEKPISESELVEQGKKMAAEIVSRLRTRD
                     ELKDIPIVVGLFKQQPRNQIIPGAYFSYGVAKAGQNNIADWEGIDENYVLFPTDDSQD
                     VYRDVSKNFKIFKQDVDKYFSNYTSVIGTGFYRNKEIQKLTIEIPIQFFGKAEIIGFT
                     QYLTGILINRFNNIHVEVSITSVNGPEALINKKANDTDPYVHVYE"
     gene            251954..252241
                     /locus_tag="BSPH_RS01165"
                     /old_locus_tag="Bsph_0228"
                     /db_xref="GeneID:6024464"
     CDS             251954..252241
                     /locus_tag="BSPH_RS01165"
                     /old_locus_tag="Bsph_0228"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase subunit C"
                     /protein_id="WP_012292027.1"
                     /db_xref="GI:501249009"
                     /db_xref="GeneID:6024464"
                     /translation="MAKLTKEEVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNE
                     LDTANVEPTTHVLPLVNVMREDVAVKGLDREVMMLNVREQEDGQVKVPAIM"
     gene            252266..253729
                     /gene="gatA"
                     /locus_tag="BSPH_RS01170"
                     /old_locus_tag="Bsph_0229"
                     /db_xref="GeneID:6024219"
     CDS             252266..253729
                     /gene="gatA"
                     /locus_tag="BSPH_RS01170"
                     /old_locus_tag="Bsph_0229"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HTW9.1"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     A"
                     /protein_id="WP_012292028.1"
                     /db_xref="GI:501249010"
                     /db_xref="GeneID:6024219"
                     /translation="MTLFERSAKELQAEIKAGNLSIADLTKEAYERIAKLDGDVQAFL
                     ASNEEKATAQAAEMDKVPFEERGPLFGLPIGVKDNIVTEGLETTCASKILEGFMPIYD
                     ATVVNKLREAGMITVGKLNMDEFAMGSSNENSYYKTTKNPWNLNHVPGGSSGASAASV
                     AAGEVPFSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPITRNV
                     EDNALLLEAIAGLDPNDSTSADVEVPNYAAALTGDVKGLRIAVPKEFLGEGVGEAARQ
                     SVLAALEVLKGLGATVEEVSLPHSKYALAAYYILSSSEASSNLSRFDGIRYGFRAENV
                     TNLMDLYKETRAQGFGDEVKRRIMLGTYSLSAGTYDAYYKKAQQARTLIKADYDKVFE
                     DFDVIIGPTSPTPAFKIGENVDDPMTMYANDILTIPMNLAGVPAISIPCGFDNGLPLG
                     LQIIGKYFDEATIYRVAHAFEQATEFHKQVPQMWEGK"
     gene            253731..255158
                     /locus_tag="BSPH_RS01175"
                     /old_locus_tag="Bsph_0230"
                     /db_xref="GeneID:6024220"
     CDS             253731..255158
                     /locus_tag="BSPH_RS01175"
                     /old_locus_tag="Bsph_0230"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     B"
                     /protein_id="WP_012292029.1"
                     /db_xref="GI:501249011"
                     /db_xref="GeneID:6024220"
                     /translation="MNFETVIGLEVHVELKTNSKIFSPAPAHFGAEPNTNTTVIDLGY
                     PGVLPVLNKNVVDFAMRAALALNMEIEQETKFDRKNYFYPDNPKAYQISQFDKPIGKN
                     GWIDIEVDGYTKRIGITRLHMEEDAGKLSHAGDHSLVDFNRQGTPLVEIVSEPDIRTP
                     NEAYAYLEKLKSIIQYTDVSDCKMEEGSLRCDANISIRPYGQEEFGTKTELKNLNSFN
                     YVRRGLEHEELRQADVLLSGGVIEQETRRFDEKTGKTILMRVKEGTDDYRYFPEPDLV
                     RLSIDDAWLERVKSEIPELPDARKKRYVEELGLTPYDAGVLVISKEISDFFESMIVNG
                     ADAKLSANWLMGDVSAYLNAEQKDLKDTALTPENLAEMVKLITDGTISSKIGKKVFAE
                     LVENGGSAQEIVKAKGLVQISDEGALLAIVTEVLDNNAQSIEDFKNGKDRAIGFLVGQ
                     IMKATKGQANPPMVNKLLQQEIAKR"
     gene            255319..255882
                     /locus_tag="BSPH_RS01180"
                     /old_locus_tag="Bsph_0231"
                     /db_xref="GeneID:6024221"
     CDS             255319..255882
                     /locus_tag="BSPH_RS01180"
                     /old_locus_tag="Bsph_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_012292030.1"
                     /db_xref="GI:501249012"
                     /db_xref="GeneID:6024221"
                     /translation="MKSEQQYFNEAISIQQYMDNMTTLKEESFRIYDSYVVPTNDGFI
                     ELLKDKKPKILTITEDWCGDAMLNNPIVRRVAEAAELDMRTVFRDADTDLIDRYLTNG
                     GRAIPIYLLLDSTGEVIGKWGPRAPELQELVVTKRASLPDKEDPTFEEAQKALYAEIR
                     EENITNPTYWTYVYDDFKKQVSNALQK"
     gene            255955..256869
                     /locus_tag="BSPH_RS01185"
                     /old_locus_tag="Bsph_0232"
                     /db_xref="GeneID:6024222"
     CDS             255955..256869
                     /locus_tag="BSPH_RS01185"
                     /old_locus_tag="Bsph_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225701.1"
                     /note="similar to YegS from E. coli; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid kinase"
                     /protein_id="WP_025115774.1"
                     /db_xref="GI:640691444"
                     /db_xref="GeneID:6024222"
                     /translation="MKRARIIYNPTSGREAFKKHLPEVLEKLEVAGYETSCHATTGEG
                     DATLAAKDAVDRGFDIIIAVGGDGTLNEVVSGVSPFENRPKVGLIPMGTTNDFARAVH
                     IPRNIDEAVDIIIQGDTLPVDVGLLNGERYFINIAAGGRITELTYEVPSKMKTMLGQL
                     AYYLKAVEMIPSIKASHMRIEYDGEVFDGDAMMFLCGLTNSVGGFEKLAPDASINDGY
                     FTLLVLKKVSLPEFIQLAAMALRGEHLNDDRVIYKKASVVKVTTENEVHLNLDGEYGG
                     DAPATFENLKRHIEIFVPLADIREEDRI"
     gene            257320..258666
                     /locus_tag="BSPH_RS01190"
                     /old_locus_tag="Bsph_0234"
                     /db_xref="GeneID:6021256"
     CDS             257320..258666
                     /locus_tag="BSPH_RS01190"
                     /old_locus_tag="Bsph_0234"
                     /EC_number="1.10.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit I"
                     /protein_id="WP_012292031.1"
                     /db_xref="GI:501249013"
                     /db_xref="GeneID:6021256"
                     /translation="MINESAVYWSRALTELTLSFHIIYATIGVGVPLMIMIAQWTGYK
                     KNDEHYILMARRWARGFVITVAVGVVTGTAIGLQLSLLWPNFMQLAGQTIALPLFLET
                     FAFFFEAIFLGIYLYTWDRFDSQKKHMLLLIPVAVGASMSAVFITIVNAFMNAPRGFD
                     IVDGELVNIQPFLAMFNPAMPTKVAHVLVTAYMTSAFVLAAIAGYRMLKGSKHVYHKK
                     SLLLLMKIGLIFSIAAAVIGDFSGKYLAEYQPEKLAAAEWHFETEGKASLVLFGVLDG
                     EEVKYAIKIPYALSVLAHFNPNEEVIGLDQFEEEDLPPLYIHYLFDIMVSIGMFMVLV
                     SLLYVVGKARGWQFIHSRWYRWIIVAGGPLSIIAIEAGWWLAEVGRQPWILYGLMRTP
                     EGATTSDHVDLMLLLFAGVYAVLAVGSIVVLVRMFKKNPIEREIEDRHSEKGGDIL"
     gene            258663..259688
                     /locus_tag="BSPH_RS01195"
                     /old_locus_tag="Bsph_0235"
                     /db_xref="GeneID:6021257"
     CDS             258663..259688
                     /locus_tag="BSPH_RS01195"
                     /old_locus_tag="Bsph_0235"
                     /EC_number="1.10.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016995189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit II"
                     /protein_id="WP_012292032.1"
                     /db_xref="GI:501249014"
                     /db_xref="GeneID:6021257"
                     /translation="MTLEILGISVLWIFLFGYVIVASIDFGAGFFNAYSLLIGKNHIL
                     TNIIKRYLSPVWEVTNVFLVFFFVGIVGFFPQTAFYYGTILLIPVSISLVLLAIRGSY
                     YAFESYGTRGHIGYTLTYGVAGLLIPASLSVVFAIAGGGYVDLVNGQPVLNYWTLYTS
                     PFAWSIVVLSIAAVLYISAVFLTWYAHKANDKEATKLMRKYALLWAAPLMVSALGIMY
                     EMKSINPESYGHMVNLWWMFAISAILFMITVLLLALRKKYGLAVALLIAQFAVAFFAY
                     GIAQYPYLLYPYLTIYDGFTSTQMAIALIIAFILGLCLLLPSLYLLMKLFLFNKNYVT
                     GKEDNHA"
     gene            259935..261299
                     /locus_tag="BSPH_RS01200"
                     /old_locus_tag="Bsph_0237"
                     /db_xref="GeneID:6021259"
     CDS             259935..261299
                     /locus_tag="BSPH_RS01200"
                     /old_locus_tag="Bsph_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_036162511.1"
                     /db_xref="GI:738206598"
                     /db_xref="GeneID:6021259"
                     /translation="MSAPVKKNERLSVYIEDLTHDGNGVAKVDGYPLFIQGALPNETA
                     EIHVMKTLKNYGFAKVVDIIKPSPDRVEAPCDYFKQCGGCQLQHLSYEGQLKWKENMV
                     RNVMQRIGKIDAPVLPVKGMKEPWHYRNKAQIPFSENEAGQAIAGFYKTKTHSIVDME
                     RCLIQTGEADAILVGLKKELVAIGMRPYNELSHEGMLRHVVIRKARATGEVMVVLVTK
                     KKKFPQKEAAIAVIQKLVPNVTSIMQNVNHEKTNVIFGDDTLNLWGKDVIIDTIGDVR
                     FEISARSFYQVNPEQTEVLYKQALDYANLQGDERVIDAYCGIGTISLFLAQKARAVMG
                     VEIVPQAIEDAKRNAVLNGFTNTYFEAGPAEEVIPRWYKEGKEADVLVVDPPRKGCDE
                     ALLTTILEQRPKRVVYVSCNPATLARDLRILENGGYQTQEIQPVDMFPHSTHCEAVAW
                     LELV"
     gene            261416..262384
                     /locus_tag="BSPH_RS01205"
                     /old_locus_tag="Bsph_0238"
                     /db_xref="GeneID:6021260"
     CDS             261416..262384
                     /locus_tag="BSPH_RS01205"
                     /old_locus_tag="Bsph_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase"
                     /protein_id="WP_012292035.1"
                     /db_xref="GI:501249017"
                     /db_xref="GeneID:6021260"
                     /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRQVVSEAGRPDVFFTEF
                     TNSDSYCHPEGQKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSRGMAELGFKGIDIN
                     MGCPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGYKDVEEWEEWLTH
                     IFKQDIANLSIHLRTRKEMSQVDAHWELIPEIKKLRDCIAPNTLLTINGDIPDRQTGL
                     ELAEKYGIDGVMIGRGIFKNPFAFEKEPKEHSSKEYLDLLRLQLDLQDQYEEVLPRSI
                     TGLHRFFKIYVKGFRGASELRSQLMNTKSTDEVRALLDRFEANHVE"
     gene            262580..264223
                     /locus_tag="BSPH_RS01210"
                     /old_locus_tag="Bsph_0239"
                     /db_xref="GeneID:6024234"
     CDS             262580..264223
                     /locus_tag="BSPH_RS01210"
                     /old_locus_tag="Bsph_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_031416806.1"
                     /db_xref="GI:670468078"
                     /db_xref="GeneID:6024234"
                     /translation="MSTASALQRQQTIEELQDREYDLLVIGGGITGCGIALDAIARGL
                     SVALVEMQDFAAGTSSRSTKLVHGGLRYLKQFEIKEVAELGKERAIVYENGPHVTTPV
                     WMLLPFHKGGTFGKYSTNLGLRVYDFLAGVKRAERRYMLSTGQTIEKEPLVKTEGLLG
                     GGMYVEYRTDDARLTIEVAKAAIERGATLLNYIKAENFLYNEQQKIRGIVATDLLTNH
                     PIEIRAKAVVNAAGPWVDDVRTIEGKQAGKHLILSKGVHIVFDESKFPLKQAVYFDTP
                     DGRMVFAIPRQGKTYVGTTDTFYEGDARNMDIYQEDRNYIMKAIHYMFPNVKVEDADI
                     ESSWAGVRPLIHEDGKNPSEISRKDEVWISPSGLVTIAGGKLTGYRKMAETVLNTIAQ
                     ELDQQFGIKSSPCTTKNIPISGGHMGGSNKFYAFLYDHTRLGKKIGLSEEEAKFLSQH
                     YGSNVEIVFNYVKEGHSILPSWLYAQLMYGIHHEMVVHPNDFLVRRTGYMFFQMATVQ
                     QYEEAILDEMAKQLNWTTQQRTQYEEDVKKEIKRATTAL"
     gene            264295..264852
                     /locus_tag="BSPH_RS01215"
                     /old_locus_tag="Bsph_0240"
                     /db_xref="GeneID:6024235"
     CDS             264295..264852
                     /locus_tag="BSPH_RS01215"
                     /old_locus_tag="Bsph_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate responsive antiterminator"
                     /protein_id="WP_012292037.1"
                     /db_xref="GI:501249019"
                     /db_xref="GeneID:6024235"
                     /translation="MHFDNQQVIPAARTVKQFDEIIASPFDYIVLLEVHISLLMSLKR
                     EAYRHGKKLIIHADLIHGLKTDNFAADFLCNDIRPAGIISTRSNMLMKAKARGIMAIQ
                     RVFLIDTIALEKSYSMIETAQPDYIELLPGIIPSMIQEIYERTQIPVITGGLVRTVDN
                     IEEALAGGAIAVTTSNRQLWENFKK"
     gene            265015..265818
                     /locus_tag="BSPH_RS01220"
                     /old_locus_tag="Bsph_0241"
                     /db_xref="GeneID:6024236"
     CDS             265015..265818
                     /locus_tag="BSPH_RS01220"
                     /old_locus_tag="Bsph_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol transporter"
                     /protein_id="WP_012292038.1"
                     /db_xref="GI:501249020"
                     /db_xref="GeneID:6024236"
                     /translation="MSTFTAELVGTMILILFGGGVVAGAVLNKSKGFGGGWIVITFAW
                     GLGVAMAAYAVGGISGAHLNPALTIALATIGNFPWADVPSYIAAQMIGAFLGATLVYF
                     MYLPHWQATADADVKLAPFSTMPAIKHPLSNLLSEMIGTFILVLGILALGTNTITDGL
                     NPFLVGLLIIVIGMALGGPTGYAINPARDLGPRIAHFILPIAGKGDSGWSYAWIPVVG
                     PIIGGTFGALFFQQIFEGKNSLAFWIVAVIVIAIFIGAQLTVKNVQVED"
     gene            265838..267334
                     /gene="glpK"
                     /locus_tag="BSPH_RS01225"
                     /old_locus_tag="Bsph_0242"
                     /db_xref="GeneID:6024237"
     CDS             265838..267334
                     /gene="glpK"
                     /locus_tag="BSPH_RS01225"
                     /old_locus_tag="Bsph_0242"
                     /EC_number="2.7.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173628.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_012292039.1"
                     /db_xref="GI:501249021"
                     /db_xref="GeneID:6024237"
                     /translation="MSEKKYILALDQGTTSSRAILFDETGKIVHTAQQEFQQHFPQAG
                     WVEHHAEEIWSSILSCIATVLSEKGVSSSQIAGIGITNQRETTVVWDKHTGKPVYNAI
                     VWQSRQTNDICERLKESGYNDLFREKTGLLIDAYFSGTKVKWILDHVEGAREKAEAGE
                     LLFGTIDTWLIWKLSGGKVHVTDYSNASRTLMYNIHDLKWDEELLEILTVPASMLPEV
                     RPSSEVYGYTEEALFFGSAVPIAGAAGDQQAALFGQACFEEGMVKNTYGTGCFMLMNT
                     GEKAVKSNNGLLTTLAWGLDGKVTYALEGSIFVAGSAIQWLRDGLRMFRSASESEQYA
                     TRVESTDGVYVVPAFVGLGTPYWDSDVRGAIFGLTRGTAKEHFVRATLESLAYQTKDV
                     LAAMEADANIPLAKLRVDGGAVANDFLMQFQADLLDVPVDRPIINETTALGAAYLAGL
                     AVDYWHSTEEISKYWNLDRQFTPNMSNDHRDKIYGGWKKAVAAAQVFK"
     gene            267796..269157
                     /locus_tag="BSPH_RS01230"
                     /old_locus_tag="Bsph_0244"
                     /db_xref="GeneID:6021204"
     CDS             267796..269157
                     /locus_tag="BSPH_RS01230"
                     /old_locus_tag="Bsph_0244"
                     /EC_number="3.4.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_012292041.1"
                     /db_xref="GI:501249023"
                     /db_xref="GeneID:6021204"
                     /translation="MVVTMRPLKIKYKKLANPFQEFMQISPNNNALTKEVVFLRYIGI
                     PDSVDLYKEDILKMDEYFTKQSVFYLRLHRLEVINNKKDADRLSELWGEWQAAADSIQ
                     LLYETSLCGKLANNQLEWTKKLSFKNILHLFKEQQPHANDTLLKNFAVKFLYWMDYYL
                     PQIFSKENQASPKIVFIGDITQHESLFLYFLSTLGCDICYMNPKGDITNLYPIIAAAS
                     NLQSCSDYYEKEFIIPEMLSMKSIPPQQPTILPTPSSRMVTREECSYEQLASLATSVV
                     MIKTFGVDHKVICFGSGVVLHQEGYILTNLHVVSGGEYYSVLYENDSNEYTTHQFVKY
                     HDIHDLAILKVARTSQPLPVKMDGHLVRGQKIVAIGSPLGLFNSISDGIVAGFRDIRK
                     MSMVQFTAAISNGSSGGALLDMQGRLVGLITAGFDDGQNLNLAVPAHVIYQFAQNFIE
                     LPS"
     gene            269471..270667
                     /locus_tag="BSPH_RS01235"
                     /old_locus_tag="Bsph_0245"
                     /db_xref="GeneID:6021205"
     CDS             269471..270667
                     /locus_tag="BSPH_RS01235"
                     /old_locus_tag="Bsph_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012292042.1"
                     /db_xref="GI:501249024"
                     /db_xref="GeneID:6021205"
                     /translation="MDYRKKTVVASVAGLTLEGMDIMFISFAMTMIIAEFNIDLATGG
                     LISSITNIGMLLGGIIFGVLADKYGRVKVFTYTIILFAIGTALTGVATSIEQVYVYRF
                     IAGLGAGGEYGIGMALVAEAWPKNKQGRASSYVSVGAQYGVILAALLSAVILPTLGWR
                     ALFFIGVLPVIFAFIVRKNLHESPEWLASQKNESNMQKKGKLAQLFVTPRVTMTTLSL
                     ILMATVQIAGYNGLMIWLPSMLQKSQGLSVSSSALWTISTAVGMIIGMLTFGRFMDRF
                     GAKRAFGIFLLASACAVFLYSFATGAVAILMGGAIVGFFSNGMFAGYGALISSFYPVQ
                     IRSTATNTIFNFGRAIGGFSPIFVGYILQSYDMTVVMIYLAALYGISFMVMLTLKGST
                     EALQTA"
     gene            complement(270745..270948)
                     /locus_tag="BSPH_RS01240"
                     /old_locus_tag="Bsph_0246"
                     /db_xref="GeneID:6021206"
     CDS             complement(270745..270948)
                     /locus_tag="BSPH_RS01240"
                     /old_locus_tag="Bsph_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid-soluble spore protein"
                     /protein_id="WP_008173624.1"
                     /db_xref="GI:495448930"
                     /db_xref="GeneID:6021206"
                     /translation="MANNNRSSNKLLVPGVQEAVNQMKYEIAQEFGVQLGPEASSRAN
                     GSVGGEITKRLVEIAEKRSKGLL"
     gene            271136..271631
                     /locus_tag="BSPH_RS01245"
                     /note="cytoplasmic protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319633"
     gene            271779..271973
                     /locus_tag="BSPH_RS01250"
                     /old_locus_tag="Bsph_0249"
                     /db_xref="GeneID:6021208"
     CDS             271779..271973
                     /locus_tag="BSPH_RS01250"
                     /old_locus_tag="Bsph_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292043.1"
                     /db_xref="GI:501249025"
                     /db_xref="GeneID:6021208"
                     /translation="MIYFDILLVAIACVTMPFIVAVMLDIFYAERKKVRFSLRRTSLW
                     YMAMFALSFIPSVLLMTQNV"
     gene            272336..274087
                     /locus_tag="BSPH_RS01255"
                     /old_locus_tag="Bsph_0251"
                     /db_xref="GeneID:6020668"
     CDS             272336..274087
                     /locus_tag="BSPH_RS01255"
                     /old_locus_tag="Bsph_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_036160424.1"
                     /db_xref="GI:738204506"
                     /db_xref="GeneID:6020668"
                     /translation="MKLWKNISLKNKLLLTVSIVVLLLIAVITTQSIKELNNRMTVDL
                     EQELTSVGLLTAMNLDSDEVKDLLSEKGETNAKFTKVQKQLDLIQEQQGIMSWSYIWD
                     VQDEGGVNPIGYTSNLNEVYEAGEIFTDLANEHVETAKLAIQNNSTEVTDIFEDPFGS
                     WRTVFSPIHDDNGQLIALLGIDYSADYINTIIKASVIKQIVIAIIGILILLVLVYIII
                     DRLLKPLQKVVNVANQVANGELINVDLDITKDEIGNLSASIQTMVANLQHIILNIRNT
                     SNHVSSAATQLTVNAGETYNSSTNIANDVKQITQNAEASMTMTEETAAAMEETATGIQ
                     QIADSANTATESSISASQASERGNQVVHQVIAQMELINESVEQIGTTINGLHVNTKKI
                     SDIVSLITAIADQTNLLALNAAIEAARAGEHGKGFAVVADEVRRLAEQSSQSATEIYN
                     LISSIQADSNASLTVMEKGKEDVKVGMTFTNEVGEIFKEILTSSEEVANQIREISAAS
                     QQISASSEEVAASVNNIKQSAELSADFSSNVSKSTQEQLTTMQEVKDASSALGQTAEE
                     LQALVTKFKLENDQDEH"
     gene            274077..274829
                     /locus_tag="BSPH_RS01260"
                     /old_locus_tag="Bsph_0252"
                     /db_xref="GeneID:6020669"
     CDS             274077..274829
                     /locus_tag="BSPH_RS01260"
                     /old_locus_tag="Bsph_0252"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_012292046.1"
                     /db_xref="GI:501249028"
                     /db_xref="GeneID:6020669"
                     /translation="MNIDFTGKNVLITGSSKGIGKAIALGFAQHGANIVINYIGDKPE
                     AEAVRMEAEKFGIKALTFHADVSKSEEVQDMYQYMDKHLGKIDILVNNAGFAQASSIT
                     DLTDEQWDRMIKVHLYGCFYNCREAAKRMKERDTGKIINISSDIGSLGCEEFTHYSAA
                     KGAINAFTKALARELAPTILVNAVAPSGTFTDILKEFGDNYVEEESAKYPLKRLAQPE
                     EIAKSVLFLASQHADFYTGQILTPNGGVVMNG"
     gene            274851..276341
                     /locus_tag="BSPH_RS01265"
                     /old_locus_tag="Bsph_0253"
                     /db_xref="GeneID:6020670"
     CDS             274851..276341
                     /locus_tag="BSPH_RS01265"
                     /old_locus_tag="Bsph_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proline symporter"
                     /protein_id="WP_012292047.1"
                     /db_xref="GI:501249029"
                     /db_xref="GeneID:6020670"
                     /translation="MLNIIIFSLYLVFIYYIGYKGYKRVNTAEDLIVAGWSMPLSVVT
                     GSLVAALLAAPFFFAAVGSGYTSGGFEGSATMGGLGTCMILGALIWTKPLRRLKGWTL
                     ADYYGLRYGSKKLGAYTGVVMAIAFGVFNAAALTVGGTYIIQQLLQIDFIPAALLFVS
                     LTAIYSVIGGLWAVAYTEIVQGALAIAGILGITIFILFYYPDVTFNPEWWNIHTLFDK
                     AGAEFWTLYLVLALGDIPAVDLGQRVAAAKSPKVAQRSMIIAGTIVIAISWIPGMLGE
                     AFKSIYPNSTNPETLMLTFAQGYFPPLLAAIFLTAMAAMGMSTVAACYVATSGIVTKN
                     IYLDFINRNPDPKKLLRFSRSVILSSALLGLVLAISFQKVIDLAYLAWDVIFVTIFWP
                     IVLGPFWKRVSTPAVWASISVGLIYYIVTSLTFVPSLTIQSEGFLGLLNELWQAPVFS
                     GVVITGITIVVVSLLVPPSQHVLEMHKIEKDKTLDDVGSKEELVGR"
     gene            276487..277170
                     /locus_tag="BSPH_RS01270"
                     /old_locus_tag="Bsph_0254"
                     /db_xref="GeneID:6020671"
     CDS             276487..277170
                     /locus_tag="BSPH_RS01270"
                     /old_locus_tag="Bsph_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292048.1"
                     /db_xref="GI:501249030"
                     /db_xref="GeneID:6020671"
                     /translation="MNIIFFILLGIIYFFLANAIEVAIIKQLFFLIGLTLVSIGIIRY
                     IKERYIESQNYAEMKEASEEEMKAIPHTQCLISQDALKGLLLNEHTNMLIFAHREELE
                     EELKIIEIPFSKIYEVAMMEDEMFVLRTKNYLMSGSLLGEEENVAEEEEEVEEDDTVS
                     QLSLKFVVDHLSEPILEYMFMDQGEHPIARDEEEYEEAMELCEKWFQKISVIIKRHEL
                     ERVPIRHWQ"
     gene            complement(277229..278923)
                     /locus_tag="BSPH_RS01275"
                     /old_locus_tag="Bsph_0255"
                     /db_xref="GeneID:6020902"
     CDS             complement(277229..278923)
                     /locus_tag="BSPH_RS01275"
                     /old_locus_tag="Bsph_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_012292049.1"
                     /db_xref="GI:501249031"
                     /db_xref="GeneID:6020902"
                     /translation="MKGIFQFKTLKAKILSAFILLLVLVVSFTAYTYTSNTAMEKQAK
                     ALVKEDLVVLNASNNLALSMSVRLSAALNYVLTGDEKYKETFNEYRQIAEDNNALLDK
                     YDTSEERTKTVELARDWSQIVKTEVFDVYQQGNKELALENLMDTQNLVSSVRNGYEQL
                     ANDREEAITAVGNDVVTTSSTNRTIGIIVSSILTIIGILIAIVTASTISKPIKVVANR
                     MKELADGNLQLDPLTVKTRDEIGTLMSAANDMNDQLKQTIQSIYTVSETVAASSEELA
                     QSSNEVQAGTEQITVTMQELASGTETQASTTGDLAETMTAFKRSIQETTQEGTELKDH
                     SSQVQDLTISGKNLMIQSTQQMAAINEIMLDSVKKVENLNDQSAEISKLVSVIDDISN
                     QTNLLALNAAIEAARAGEHGKGFAVVADEVRKLAEQVQFSVTDISTIVNRIQGETGTV
                     TTALQTGYEEVKRGTAQLDQTSETFEQISSAVEDMIDNITTISNNLNQLADGSETINA
                     SIDEMASISQESAAGVEQTTATVEETAATMDEIARSANLLAGLAEELNGQLKQFKI"
     gene            complement(279188..280183)
                     /locus_tag="BSPH_RS01280"
                     /old_locus_tag="Bsph_0256"
                     /db_xref="GeneID:6020903"
     CDS             complement(279188..280183)
                     /locus_tag="BSPH_RS01280"
                     /old_locus_tag="Bsph_0256"
                     /EC_number="3.4.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_012292050.1"
                     /db_xref="GI:501249032"
                     /db_xref="GeneID:6020903"
                     /translation="MHRHFIFLLTFILLGITLCPADSFAKEEATEEEIVQQRMSYYVQ
                     FDELLIPWHFLAAIDQYERNLQSVRKDIPKRDGYLSIQFSDEYWSGALNPIKEDSKPE
                     TISYFGGMGLDGNNDGIASPKDDEDVIFSMASYLAKYGTTDEDFKLALWEYYGSEEAV
                     NQIFTISTLYRHYKTIELDAHTFPLNISSTYSYKGTWGANRGWGGRRIHEGTDIFANY
                     GTPVLSTSYGVVEVKGWNQFGGWRIGIRDNHNSYHYYAHLGSYHKDIEVGTIVEPGTV
                     LGYVGSSGYGKEGTSGKFPPHLHYGIYKFNGRTEWAFDPYPSLLQWERQAKSKKQ"
     gene            280399..282294
                     /locus_tag="BSPH_RS01285"
                     /old_locus_tag="Bsph_0257"
                     /db_xref="GeneID:6020904"
     CDS             280399..282294
                     /locus_tag="BSPH_RS01285"
                     /old_locus_tag="Bsph_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein prkA"
                     /protein_id="WP_031416834.1"
                     /db_xref="GI:670468109"
                     /db_xref="GeneID:6020904"
                     /translation="MNILDKVKSYREEENRLKWEGTFADYLNIVRERPEVAQTAHSRV
                     YNMIKSAGVEERDGQKMYKFFGHEIFGLETAIERLVEEYFHPAARRLDVRKRILLLMG
                     PVSGGKSTIVTLLKRGLEQYSRTDEGAVYAIKGCPMHEDPLHLIPHHLRNDFFEEYGI
                     RIEGSLSPLNTMRLEKEYDGRIENVMIERISFSEDKRVGIGTFTPSDPKSQDIADLTG
                     SIDFSTIGEFGSESDPRAYRFDGELNKANRGMMEFQEMLKLDEKFLWNLLSLTQEGNF
                     KAGRFALISADELIVAHTNETEYRSFISNKKNEALHSRIIVMPIPYNLKVSQEEHIYE
                     KMIKESDMSHVHIAPHALKAAAIFSVLTRLEVPKKQGVDLIKKMRLYDGENVEGFNSV
                     DLEELKKEFPNEGMNGIDPRYIINRISSAIIRKEVPSINALDVLRALKDGLDQHASIS
                     QEDREKYMNYIAVARKEYDEIAKNEVQKAFVYSYEESAKTLMNNYLDNVEAFCNKNKL
                     FDPLTGEEMNPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHER
                     LREAIQKKLFADLKDVVKITTSSKMPDESQLKKINEVVARLVDEHGYNTTSANELLQY
                     VGSLLNR"
     gene            282471..283628
                     /locus_tag="BSPH_RS01290"
                     /old_locus_tag="Bsph_0258"
                     /db_xref="GeneID:6020905"
     CDS             282471..283628
                     /locus_tag="BSPH_RS01290"
                     /old_locus_tag="Bsph_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress response protein"
                     /protein_id="WP_012292052.1"
                     /db_xref="GI:501249034"
                     /db_xref="GeneID:6020905"
                     /translation="MTEHENKGFVISQENWSLHRKGHQDQQRHMEKVKDAIKNNLPDL
                     VSEESIVMSNGREVIKIPIRSLDEFKIRYNYDNSKHVGQGQGDSNIGDVVARDGSKAN
                     QAQGKGKEAGDKPGQDYYEAEVSIEEIQNVLFRELELPNLQQKEKAEIVTEKIDFNDI
                     RKKGLMGNVDKKRTILNALKRNAMQGKAEITPIHNDDLRFKTWDEVVKPESKAVVLAM
                     MDTSGSMGAFEKYCARSFFFWMTKFLRSKYGTVEIEFIAHHTEAKVVTEEEFFTKGES
                     GGTICSSAYKKALELIEEKYSPSRYNIYPVHFSDGENISMDNEKCLKLVAELMNVSSM
                     FGYGEVNQHNRFSTLMYTYKKIDDPKFRHHILRKKGDVYDALKSFFKKNEE"
     gene            283674..285077
                     /locus_tag="BSPH_RS01295"
                     /old_locus_tag="Bsph_0259"
                     /db_xref="GeneID:6020906"
     CDS             283674..285077
                     /locus_tag="BSPH_RS01295"
                     /old_locus_tag="Bsph_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage V sporulation protein R"
                     /protein_id="WP_012292053.1"
                     /db_xref="GI:501249035"
                     /db_xref="GeneID:6020906"
                     /translation="MDTKELHRAIDEITEIASGFGLDFYPMRYEICPADIIYTFGAYG
                     MPTRFSHWSFGKQFHKMKLQYDLGLSQIYELVINSNPCYAFLLDTNTLTQNKLIIAHV
                     LAHCDFFKNNVRFSNTRRDMVESMTATAERIAGYEREYGKDEVEQFLDAVLAIQEHID
                     PSILRPKLSWSEEDELEEEKAPIKSPYDDLWSLEEKDKVYKPIRRRLKQFPPKPEKDL
                     LLFLEEHSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWASFWHQRIMRELNLTT
                     PETIEYAKLNAGVVQPSKTSINPYYLGIKIFEDIENRYNNPTEEMKRLGVQPNTGREK
                     IFEVREVESDISFIRNYLSKDLAKREDLYLFQKKGNEYRITDKDYEMVRDQLVSMRVN
                     GGFPYILVKNGDYLRNGELYLMHGYEGMELDPHYLENVLPYIYQLWGRPVHLETYVDG
                     KPMLYSYDGTKNYKRNV"
     gene            complement(285131..285547)
                     /locus_tag="BSPH_RS01300"
                     /old_locus_tag="Bsph_0260"
                     /db_xref="GeneID:6023436"
     CDS             complement(285131..285547)
                     /locus_tag="BSPH_RS01300"
                     /old_locus_tag="Bsph_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416835.1"
                     /db_xref="GI:670468110"
                     /db_xref="GeneID:6023436"
                     /translation="MQSFNSRKFNDPEEPENNSTEKHARNHITFNFTFNIGNTDFHFE
                     QRAEGGGQINEDVGTNANQGGQNASDGSHTRNVNSQFADGNGRSGIAGNNNDEAGGQQ
                     GIKVRDSLVIDSDIHSSSNHSESHEEDNDLTEETEE"
     gene            285728..286603
                     /locus_tag="BSPH_RS01305"
                     /old_locus_tag="Bsph_0261"
                     /db_xref="GeneID:6023437"
     CDS             285728..286603
                     /locus_tag="BSPH_RS01305"
                     /old_locus_tag="Bsph_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="WP_031416837.1"
                     /db_xref="GI:670468112"
                     /db_xref="GeneID:6023437"
                     /translation="MKTFKKVYIEITSVCNLACSFCPPTARAKGLIKVEQFNKILDEI
                     RPHTKYIYLHVKGEPLLHPRIDQLLDAAHAKGFKVNITTNGTLIKKNREKILGKPALR
                     QINFSLHSFDGHEGSENREKYLGDILDFVRESREYKTIISYRLWNLQKDHVSDVAARR
                     NRETLEILENEYNLDFRIEEKVEPGKGVKIGPNIYLNQDHEFRWPSLLEPEDEGKGFC
                     HALRSQAAILVDGTVVPCCLDGEGVINLGNVHEKSFAEIVDGERATNIIDGFSRREAV
                     EELCRKCGYRQKFGM"
     gene            complement(286634..287023)
                     /locus_tag="BSPH_RS01310"
                     /old_locus_tag="Bsph_0262"
                     /db_xref="GeneID:6023438"
     CDS             complement(286634..287023)
                     /locus_tag="BSPH_RS01310"
                     /old_locus_tag="Bsph_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_031416838.1"
                     /db_xref="GI:670468113"
                     /db_xref="GeneID:6023438"
                     /translation="MSDFLKLVGEQLRIIRLSKGLSQEEVAERTGKLGFSKGRVSNIE
                     HGQSNITLSTLETLMKALDIPPEELFNFQKLSGVTDIEEKNLMLDIHRSLLRERNLDE
                     VKYVVRITKDFLDTIDSQSKKNSPNGQ"
     gene            287224..287910
                     /locus_tag="BSPH_RS01315"
                     /old_locus_tag="Bsph_0263"
                     /db_xref="GeneID:6023439"
     CDS             287224..287910
                     /locus_tag="BSPH_RS01315"
                     /old_locus_tag="Bsph_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292057.1"
                     /db_xref="GI:501249039"
                     /db_xref="GeneID:6023439"
                     /translation="MEDESKVKYLLEEIAKIKIGKVVTSKKRFAMDGIPYITEEVLRK
                     LSLEDNTSLLPKVDSTLKEPFSFSLVPAQSILLNKMNLKEAYIYQCKTDVCISHDIMA
                     IIPKESILIGDYLFHFMKWYQNNKERCNVYSLMIDLPSIAIQHNVVQLINAVEQLLKN
                     KGSLVTAVNELPKYFDNISRQVKQHSDSLHEGFEQLNDQYIAMLDHIFNGDFLNDFQE
                     YHVFQSICSE"
     gene            complement(287960..289630)
                     /locus_tag="BSPH_RS01320"
                     /old_locus_tag="Bsph_0264"
                     /db_xref="GeneID:6023440"
     CDS             complement(287960..289630)
                     /locus_tag="BSPH_RS01320"
                     /old_locus_tag="Bsph_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease J"
                     /protein_id="WP_012292058.1"
                     /db_xref="GI:501249040"
                     /db_xref="GeneID:6023440"
                     /translation="MSTKKQLLSIFALGGINEIGKNMYVVQYADDMILIDCGAKFPDE
                     TLLGIDLIIPDITYLLENKEKVKALIVTHGHEDHIGGIPYLLKKLNVPVYATRFTLGL
                     IELKLKEHKLLRETDLIEIHADSALHLGEIDVSFFRTNHSIPDCLGIVLATPEGNVVH
                     TGDFKFDLTPVNNQFADIHKMAEIGSKGVLVLISESTNAERPGLTPSEQLVGHHIEEA
                     FFHAERKIIISTFASNVNRIQQIVHATIAANRKLALLGRSMVNVVDVAIERGYLFVPD
                     DLLIDAREVKYLPPEEVVVLCTGSQGEPLAALARLANGNHREVKVLPDDMVILAASPI
                     PGNEKGVSRIVDHLFQLGAKVIYGSSSHTGMHVSGHGYQEDLKLMLTFMKPQFFIPIH
                     GEFRMLHQHRLLAEAVGVQKGHTFIMKNGDVVDIENAVARQTRKVPSGDTYVDGIGIG
                     EVEGIVLRDRKQLSEDGMLVIVLTLSKADGAIISEPDTISRGFVYAKDFEELLNKVNV
                     LTKEIIMELQQESRQIHVLRREIKKAVGQYLFTKTKRKPMILPIIIEI"
     gene            289840..290604
                     /locus_tag="BSPH_RS01325"
                     /old_locus_tag="Bsph_0265"
                     /db_xref="GeneID:6022364"
     CDS             289840..290604
                     /locus_tag="BSPH_RS01325"
                     /old_locus_tag="Bsph_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292059.1"
                     /db_xref="GI:501249041"
                     /db_xref="GeneID:6022364"
                     /translation="MSDFVQHAIFEHRFWLEIMQNHAQFIHDALYPSEQDDIQRANSF
                     IQQFSRLLTYVSSIDATNAVAFTITVDDNVEQFKQFKLHLLRHQLSGDIGIHLTPTFV
                     NHMVNELEEYQNVLSYLRKGEVPPIFHELHHHLIWLLDASGHAGIIQDNLDGVEKRLK
                     QKSHEFAKHFEQFYLKAVELTGYLRTNMHSFPALSRFNKDVELEMTLFKTFLKELEEM
                     ELSAEVLGTFTAPMADHMWREEQYYLMKLVQSRGEG"
     gene            complement(290643..291137)
                     /locus_tag="BSPH_RS01330"
                     /old_locus_tag="Bsph_0266"
                     /db_xref="GeneID:6022365"
     CDS             complement(290643..291137)
                     /locus_tag="BSPH_RS01330"
                     /old_locus_tag="Bsph_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L,D-transpeptidase"
                     /protein_id="WP_012292060.1"
                     /db_xref="GI:501249042"
                     /db_xref="GeneID:6022365"
                     /translation="MIHTVKPGETLIQISRDYRTPVASIIAANPGIQSGTLYVDQPII
                     IPGFPDPETIPYRIEISTENRWLRLYRNSILQKQYPIAVGRMLHETPVGSFIIINKDP
                     NPGGPFGTMWMSLSKEHYGIHGTNDPSSIGHAVSHGCIRMQNPDVEELASIVPIGTEV
                     VIHP"
     gene            291261..291494
                     /locus_tag="BSPH_RS01335"
                     /old_locus_tag="Bsph_0267"
                     /db_xref="GeneID:6022366"
     CDS             291261..291494
                     /locus_tag="BSPH_RS01335"
                     /old_locus_tag="Bsph_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292061.1"
                     /db_xref="GI:501249043"
                     /db_xref="GeneID:6022366"
                     /translation="MKEFKITYFFDEIHYVRRFIFIESQQEAEKLVKSERDQYISFTD
                     SRGIYHELHTRHVRVIQISEYHRIDKSAKRNDT"
     gene            291540..291749
                     /locus_tag="BSPH_RS01340"
                     /old_locus_tag="Bsph_0268"
                     /db_xref="GeneID:6022367"
     CDS             291540..291749
                     /locus_tag="BSPH_RS01340"
                     /old_locus_tag="Bsph_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416844.1"
                     /db_xref="GI:670468119"
                     /db_xref="GeneID:6022367"
                     /translation="MDKEQIPHEKKIFMNLNSKDKPDMVESDTISLFDLHEDMQTVDA
                     IPVEELNKRVEREGDELIELQPDEL"
     gene            291762..291959
                     /locus_tag="BSPH_RS01345"
                     /old_locus_tag="Bsph_0269"
                     /db_xref="GeneID:6022368"
     CDS             291762..291959
                     /locus_tag="BSPH_RS01345"
                     /old_locus_tag="Bsph_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292063.1"
                     /db_xref="GI:501249045"
                     /db_xref="GeneID:6022368"
                     /translation="MNRENGDAQFSVSGTNIDEVKQKNAESGLSYNEVKALLAKQGGH
                     GTAVFSDTNVDEVKQEIHKHQ"
     gene            292320..292904
                     /locus_tag="BSPH_RS01350"
                     /old_locus_tag="Bsph_0270"
                     /db_xref="GeneID:6020683"
     CDS             292320..292904
                     /locus_tag="BSPH_RS01350"
                     /old_locus_tag="Bsph_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292064.1"
                     /db_xref="GI:501249046"
                     /db_xref="GeneID:6020683"
                     /translation="MARPIELSNVTQIYLEEYQRILKKMMQGMTYVTITCSISENFIK
                     QIIPYQIAAIQMSENVLRFTTNIPVQNLALEIIRTHTEMLESIEALQNRCCVVQNSEY
                     ELYEYMCAYKEITEAMFNAMCAPPVSNSININYLREMIVHHQGGIRLAQNVLRFCICQ
                     ELIPILKCMIQTLCEQLEAMEKLLDSLQNCDCEC"
     gene            293043..293282
                     /locus_tag="BSPH_RS01355"
                     /db_xref="GeneID:23319634"
     CDS             293043..293282
                     /locus_tag="BSPH_RS01355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160428.1"
                     /db_xref="GI:738204510"
                     /db_xref="GeneID:23319634"
                     /translation="MVLWHWQKAIRSGTCLYRIRTAIHSLHEIAKKAVWEYYTGRKNE
                     AEKYLQEISEKYFVVIEKLKALNEILLDGKKQYIH"
     gene            complement(293328..293933)
                     /locus_tag="BSPH_RS01360"
                     /old_locus_tag="Bsph_0273"
                     /db_xref="GeneID:6020686"
     CDS             complement(293328..293933)
                     /locus_tag="BSPH_RS01360"
                     /old_locus_tag="Bsph_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_012292067.1"
                     /db_xref="GI:501249049"
                     /db_xref="GeneID:6020686"
                     /translation="MLYALLGDLHSNIEDTKAVLTHIQQTAKEAKIIGLGDLYECTIS
                     KKKAQTMSGLSLQRAAIVESKFEELLTFPSIRGNQEERITQVTGIERFRALPEIMEID
                     GATLMHGHQFKWSVSWQPTFPSFQKPLFFFGHSHESGLYHQQKKLPIRIRYGQPIVLQ
                     DKQYGVNVGSVVDHREWCLYDSEKRTVTFMCVPSVDKGTMS"
     gene            294185..295675
                     /locus_tag="BSPH_RS01365"
                     /old_locus_tag="Bsph_0274"
                     /db_xref="GeneID:6020687"
     CDS             294185..295675
                     /locus_tag="BSPH_RS01365"
                     /old_locus_tag="Bsph_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="WP_036162512.1"
                     /db_xref="GI:738206599"
                     /db_xref="GeneID:6020687"
                     /translation="MYMTDILEKYAVQQPSKIATLYNGNKLSYREFYKHVERFAAYLQ
                     EQNYKKEDVIALYTLNTDLFLIAYLGVQLAGYVAMPINTKLAAPEVEFIFNHSQAKGL
                     IYDERLAETLENVSYSFQHIIGFQDMNHILTNTNLVRAVVPLEAHDTAVVMYTSGTTG
                     KPKGVMLTHQNIVATADIWSSSMNMLNTDKMFICTPLFHCAGLHVFAMPMFYQGGTVL
                     IEEAFSPTKTLEQIAVTEATIFFGVPSMYTIILNTPGFKEHSFNHLRLLCYGAAPMPY
                     ELVKQVKEAFSNVKVQNLYGQTENTPAATSLLDTDALTKIGSVGKPLEQTEVRVVDSE
                     GKLVPAGEVGEICVRGPQVMKGYLRNPEETARTIIDGWLYSGDLGRFDEEGYLYIVDR
                     KKDMIIRGGENIYPIEVEEVLYQLPEILEAAVVGLPHEVYGEVPKAFVVFKEGKYLDE
                     EIILSYCQSRLAKYKVPYEIECLTELPRNASGKVLKHTLRPKVRTI"
     gene            295853..296842
                     /locus_tag="BSPH_RS01370"
                     /old_locus_tag="Bsph_0275"
                     /db_xref="GeneID:6020855"
     CDS             295853..296842
                     /locus_tag="BSPH_RS01370"
                     /old_locus_tag="Bsph_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160430.1"
                     /db_xref="GI:738204512"
                     /db_xref="GeneID:6020855"
                     /translation="MWTGYKRLLLIGMLIIMLLSSCQPFSQQDAENKNQLTVLTVEFN
                     SGAPIANLYITVTDVQNGNVVEEAIGSEEGEAIFSKLKEGREYAIAATTLENSATNDG
                     YTTIENFTYDTTKPYFRLQTHFTRDEQELDVPVVMQNPELPHGCEITSLTAVLNYYGM
                     NVSKLEMADNYLPKEEIRTIGNQRFGPNPNEAFAGNPRDKARGMYVFAAPIVKAAEAA
                     IAEKQADLRVTDMRNASQADILQLVREGVPVVTWVTLDLSKPKKNANRGWIYKGATTS
                     QDAFMNLHAVVLTGHLGDKVVVMDPLKGYVTYNVDQFFKSYHELGEQAVAVHK"
     gene            296900..298132
                     /locus_tag="BSPH_RS01375"
                     /old_locus_tag="Bsph_0276"
                     /db_xref="GeneID:6020856"
     CDS             296900..298132
                     /locus_tag="BSPH_RS01375"
                     /old_locus_tag="Bsph_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292070.1"
                     /db_xref="GI:501249052"
                     /db_xref="GeneID:6020856"
                     /translation="MAIEHAFLPVLLGDEMNAYGMARAFYEAYGVKPLALNHTNMEKI
                     QQSDLLTFREVPRLHIEERFVTALKAIAQEFTEKKLLLLACDEFYVKKIVEHKDELIE
                     DFLVPYVNTSLAHQLLTRESMYELCAQFGFQYPAMHVCTVNDYEDYEMSLDYPIVIKP
                     MNMTKYATCIFPGKKKVYIAHDKEEKDSIFHAIYKESAYRDDLMIQQYIPGEDANMRV
                     VNAYVGQDGKTKLLAVGNPILEEHSPEGIGRYVAIMTAYNPALMENVKLFLEAIQFQG
                     FATFDMKYDERDGHYKLLSIELHNELSNYYVTASGYNLMQYVADDYVRGSKQPLTYVQ
                     NKHLWTIVPNGVLFKYVQNEQLIIEAKSLIRQGMATDSIFNYKDMNAKRWLNVTVDNL
                     NFYRKYKKYFNNKGLSNS"
     gene            298129..298830
                     /locus_tag="BSPH_RS01380"
                     /old_locus_tag="Bsph_0277"
                     /db_xref="GeneID:6020857"
     CDS             298129..298830
                     /locus_tag="BSPH_RS01380"
                     /old_locus_tag="Bsph_0277"
                     /EC_number="5.1.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate racemase"
                     /protein_id="WP_012292071.1"
                     /db_xref="GI:501249053"
                     /db_xref="GeneID:6020857"
                     /translation="MKKQTLGIIGGVGPLATMFIGEMIVRRTKAQKDQEHLHTIIDND
                     TNIPDRTAFILDNTKENPVPVIMEDAKKLASVGADMIAIPCNTAHTFYDEIQAGSPIP
                     VLHMIRETAKRASELGAERVGILATTGTLTSRMYQEALEEYGITPVVPDNEMRAHVMT
                     IIYDFVKAGKDVTQDDWQPIEDAMLALNCDRIVLGCTELSIVNRDLKLSNVYIDSLIV
                     LAECAILACGYELID"
     gene            299049..300197
                     /locus_tag="BSPH_RS01385"
                     /old_locus_tag="Bsph_0278"
                     /db_xref="GeneID:6020858"
     CDS             299049..300197
                     /locus_tag="BSPH_RS01385"
                     /old_locus_tag="Bsph_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="WP_012292072.1"
                     /db_xref="GI:501249054"
                     /db_xref="GeneID:6020858"
                     /translation="MSVISLLKEELQAKWNFEATMKIQEEMIPAMLEGKDIVAESPTG
                     SGKTLAYVLPLLNKVNGAKKQTQGLIVAPSQELAMQIVEVIREWTAGTDITVQQLIGG
                     ANSARQIEKLKKKPTIVVGTPGRLNELARAGKLKLKEIETVVLDECDQLLSREYRVVI
                     KSFIEGSAFGRQVVVVSATITEEIELVASRMMFEPVRFKIKPEDMLKVGKVTHSFVKV
                     EERDKTEFLRRLSHTEGLRALAFVNNIDQLLMKETKLQYRSAPIVTLHSDMKKEERKK
                     ALDAFRKGDARILIATDIAARGLDIAGLTHVIHVDVPRTIEQYLHRSGRTGRAGADGE
                     VLTLLSYRDEKTYKKWTREIPGKPVQKIWHDGKLKEGNSKTIGQKGGK"
     gene            300199..301428
                     /locus_tag="BSPH_RS01390"
                     /old_locus_tag="Bsph_0279"
                     /db_xref="GeneID:6020859"
     CDS             300199..301428
                     /locus_tag="BSPH_RS01390"
                     /old_locus_tag="Bsph_0279"
                     /EC_number="3.4.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M29"
                     /protein_id="WP_012292073.1"
                     /db_xref="GI:501249055"
                     /db_xref="GeneID:6020859"
                     /translation="MTFEEKLQAYAELAVKVGVNIQPGQYLLVNTSVEALDFARLVVK
                     EAYKAGAGRVHVNFSDDEMDRAYFEHASDEEFNRFPEWVVQMRDELIERKGALLWIDA
                     ADPDKLTGISADRLATHQKVSGAALKNYRNAVMKDLIAWSIIAVPSPKWAAKVFPQLT
                     ADEQVPALWEAIFKTVHIGEGNAVENWHQHVTNLESRAELLNNKKYAKLHYTAPGTDL
                     TIALAPQHKWVTGGSKTPEGHVFIANMPTEEVYTLPMKQGVDGYVSNSKPLVYQGNII
                     DGFKLTFKEGKIIKAEAEVGQDLLQELIQVDEGSSYLGEVALVPHESPISASGILYFN
                     TLFDENASNHLAIGEAYPTCLEGGRDLENGQLEALGANISVTHEDFMVGNGEMDIDGI
                     LPDGTIEPIFRKGSWAF"
     gene            301461..302372
                     /locus_tag="BSPH_RS01395"
                     /old_locus_tag="Bsph_0280"
                     /db_xref="GeneID:6020591"
     CDS             301461..302372
                     /locus_tag="BSPH_RS01395"
                     /old_locus_tag="Bsph_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="WP_036160442.1"
                     /db_xref="GI:738204524"
                     /db_xref="GeneID:6020591"
                     /translation="MKHIGSLIGMIILLLTGWSSSAFAQTENYIAIGDSLAAGQTPFQ
                     QIDAGYSDLIAMRLQSMNQLKFYTKELAFPGYTTAHVLEKIKTEEARDLLANATLVTV
                     SAGANDLLSLIRLNPMAGTLTFSQLQTDYALNTVRKNIIAILNELAERAPKAQVYVVG
                     YYFAYPAVHLTQKEGTNAQLVKLNKILQQQAELAGAGYVNVYDSFGLNATNYLPNYTD
                     VHPNMEGYRQMANAFLKAYSGSDALSIAPSQLPKPNPVSFEEILQERASAQPKQQKVT
                     SSQSVRSVRSIQGFHGYTAFMEKLEKR"
     gene            302482..303639
                     /locus_tag="BSPH_RS01400"
                     /old_locus_tag="Bsph_0281"
                     /db_xref="GeneID:6020592"
     CDS             302482..303639
                     /locus_tag="BSPH_RS01400"
                     /old_locus_tag="Bsph_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair exonuclease"
                     /protein_id="WP_012292075.1"
                     /db_xref="GI:501249057"
                     /db_xref="GeneID:6020592"
                     /translation="MKIFHTADWHLGKLVQGVYMTEDQQYILQQFIQAIDEEKPDVII
                     IAGDLYDRSMPPIEAVNLLNDTLAKIVLEKKIPILAVAGNHDSAGRLNFGSRLMRDSG
                     LYIKGQFTKDHAPIIINDQYGEVHFHLVPFADPASIRSIFEEEAIRSHQDAMQKIIEH
                     ITAGMDTSKRNIFVGHAFVTKYGEEEANTSDSERPLSIGGSDCVNAALFKPFHYTALG
                     HLHKAHFVLNETIRYAGSPLKYSLSEHLHEKGFLIIDLDEHGNSTVTKRKLMPRRDLR
                     VVEGELEELLMLPPSDDYVFVRLTDATSVSSPMERIRTVFPHALHVERKILRQEKPSE
                     LQVVEAEKLEDIDLFRSFFTDIIGIQPDEDTERLFTEMLQELLDKERETVK"
     gene            303636..306716
                     /locus_tag="BSPH_RS01405"
                     /old_locus_tag="Bsph_0282"
                     /db_xref="GeneID:6020593"
     CDS             303636..306716
                     /locus_tag="BSPH_RS01405"
                     /old_locus_tag="Bsph_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease"
                     /protein_id="WP_012292076.1"
                     /db_xref="GI:501249058"
                     /db_xref="GeneID:6020593"
                     /translation="MKPLKLTITAFGPYKNTEIIDFQQLGEHRLFAISGKTGAGKTTI
                     FDAICYALYGAGSGEDRQDTALLRSGFADDDVYTAVELIFEMHGRVYQILRQPGHIKG
                     KNKTATGKKVELAEVREGMLDYNIVEKQQTLEVDKKIQEIIGLTKDQFSQIVMLPQGE
                     FRKLLTSDSTNKEVILRKIFKTDRFGAMTKLLDAKRKEAESDLERAKQLKEHLLGQIV
                     GALPQRSSPLFKQIADNTENMFQLKQALEEELTYYKKCFEDIQRQYEEAYNHHQKEQE
                     FYRLAKTLNEQFEEQSKRQERLQMLLDEQDKYHAKEREIALAEQAERLLLLEQQCMDL
                     RAEQNLKEQAYQQAQSSQLQTKELLQRAQEKYEAEEAKESERQLLLQQEMQLQALLPK
                     FEAYDSHVQQLQIAEQYVKTAKQGAADNIVLIEKESAQLEQLSQSIEHYEKQMEPYEG
                     YLEKLPKLQEQVTLLMQMENYTKTVEIAKQDVIATKARYQDSRLELQQLEQRWLTSQA
                     SVLAQQLKEGQPCPVCGSTAHQQTHNEKLEIVELAQVETLRVKVSSDERLYLEKEAML
                     RSAQQLQQETLKQLDAHSIKQQDQAQIIASLEKMEKEITSLRVINQQLAQTRKNQKEQ
                     RLTIEQLQNKQLKLEEYLSEQMKSWTRLQAIVEEQHKQMPTNIPTLPQLKQTLTDVSQ
                     QKMDFQKLWQESQHHLHAMKEADSNAKLAVEIAKQNFEELKLKMNDKREQFSTSMQEA
                     GFVSYEDYAAAKRSATQLEELRRACSDYTLQVHTLKIQISEGEKHLQGKEEQDLALME
                     ATVKSLRIAYEDAFKQLQQIDGFVKSCQSFMNKVEETERELRLLESEAGRVKELYGLL
                     NGQNSKKLSFERYIQINYLDQITEAANIRLNHLSNGQFELRRSDRLEKHAKQSGLGLD
                     VYDAYTDQLRDVKTLSGGEKFNASLSLALGMADVIQSFQGNIHIETMFIDEGFGSLDE
                     ESLNKAIDTLIDLQDSGRMIGVISHVPELKSAMPAVLHVEKTLNGHSQTHFEIK"
     gene            complement(306936..307259)
                     /locus_tag="BSPH_RS01410"
                     /db_xref="GeneID:23319635"
     CDS             complement(306936..307259)
                     /locus_tag="BSPH_RS01410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416856.1"
                     /db_xref="GI:670468131"
                     /db_xref="GeneID:23319635"
                     /translation="MENQKILSAFSYLSIFFAPFIVPLIVYFVSKDADIKRHSIRALV
                     SHLIPFVFGILFFIVFVFSTFSLDPTSSNSTVMIVWFISFAIYGIVSLGIVIWNIIQA
                     VRVIR"
     gene            307629..308189
                     /locus_tag="BSPH_RS01415"
                     /old_locus_tag="Bsph_0285"
                     /db_xref="GeneID:6020733"
     CDS             307629..308189
                     /locus_tag="BSPH_RS01415"
                     /old_locus_tag="Bsph_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine transporter ThiT"
                     /protein_id="WP_012292079.1"
                     /db_xref="GI:501249061"
                     /db_xref="GeneID:6020733"
                     /translation="MDKKRLLMLVEIAIFAAIGLVLDQVSFKVWAQGGSVSLVMVPIM
                     LIAIRWGLVAGLTTGLLVGVMQTMFGAYIVHWLQGLLDYGVAFTVVGLAAIVRRPLLE
                     AASQLNKTKMALYIILGTVFAGFLRYVAHTTAGAVFFAEYAGDQNAWIYSIIYNGTYM
                     LPAKVLTAIVGVLLFTAAPQLMQRKA"
     gene            308361..309116
                     /locus_tag="BSPH_RS01420"
                     /old_locus_tag="Bsph_0286"
                     /db_xref="GeneID:6020734"
     CDS             308361..309116
                     /locus_tag="BSPH_RS01420"
                     /old_locus_tag="Bsph_0286"
                     /EC_number="3.4.11.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292080.1"
                     /note="catalyzes the removal of N-terminal amino acids
                     from peptides and arylamides; generally Co(II) however
                     activity has been shown for some methionine
                     aminopeptidases with Zn, Fe, or Mnin Bacillus subtilis the
                     protein in this cluster is considered non-essential;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_012292080.1"
                     /db_xref="GI:501249062"
                     /db_xref="GeneID:6020734"
                     /translation="MIVKTQEEIEAFKKIGRICAEIRETMKSATKPGVTTLELDEIAG
                     RMFAEAGAISGPKGEYDFPGYTCISVNEEVAHGIPGKRVIQEGDIVNIDVSGSLDGYF
                     ADTGISFVVGDGYEDKEKLCRVAKDAFDRAMTKVKAGSKLNQIGKAVEREANANGLTV
                     IMNLTGHGLGRSLHDEPNHILNYYDAWDSTIMKEGMVLAVEPFISAKAEHIVEAGDGW
                     TFITPDKSLVAQIEHSVIVTKDKPIILTSLDED"
     gene            complement(309145..309858)
                     /locus_tag="BSPH_RS01425"
                     /old_locus_tag="Bsph_0287"
                     /db_xref="GeneID:6020735"
     CDS             complement(309145..309858)
                     /locus_tag="BSPH_RS01425"
                     /old_locus_tag="Bsph_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016995359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416860.1"
                     /db_xref="GI:670468135"
                     /db_xref="GeneID:6020735"
                     /translation="MPRFLLMTISYIVSLILTFSSFFMKLNGQSSLEISNRFSVVFAP
                     VDGSHLIWIVIYLFIGYWLVMNIKKTSMKQSALFSCINILQALMIYVWHHELFIVSLG
                     ITLLLVLYLFMLYNTYPLHDKSLSGRIPFAIYLAWMTFIFITNISFTLTAYGWNGFGL
                     STPLWAVILLTLGGVIALHIRFHHFDIMYPSVFIWAYIGIALHNGFDELLVTTAALFL
                     CGVLFVGILFIKKNPAYQK"
     gene            310058..310867
                     /locus_tag="BSPH_RS01430"
                     /old_locus_tag="Bsph_0288"
                     /db_xref="GeneID:6020736"
     CDS             310058..310867
                     /locus_tag="BSPH_RS01430"
                     /old_locus_tag="Bsph_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_012292082.1"
                     /db_xref="GI:501249064"
                     /db_xref="GeneID:6020736"
                     /translation="MTQNLKNLDLSIELDKKMYKKKLKVLQYEMLNAQQFLLKNKIGL
                     ILVFEGMDAAGKGGAIKRLIERVDPRGYVVHPISAPQPHELRYNYLQRFWRKLPQHGQ
                     IAVFDRSWYGRVLVERIEGFATKEEWSRAYEEINNFEKILTEGDYIIIKFWLHVSDEE
                     QLKRFKEREQNPYKSWKLTEEDWRNREKSPQYIEAANEMFDKTDKKNAPWILVAGNDK
                     KYARVQVLQETLAHIEREALKRGLHLTNVLDNPLLEDADSSSLNTLNEKKK"
     gene            311088..311630
                     /locus_tag="BSPH_RS01435"
                     /old_locus_tag="Bsph_0289"
                     /db_xref="GeneID:6020737"
     CDS             311088..311630
                     /locus_tag="BSPH_RS01435"
                     /old_locus_tag="Bsph_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_031416862.1"
                     /db_xref="GI:670468137"
                     /db_xref="GeneID:6020737"
                     /translation="MVTIKGEKCYIRTFQENDARSLTGLVSRNKYFWSTYEPLQRPEY
                     YTIDAQYKKIQESLYLMDSKREFTFGIFEHGTNNLIGHIALYAVKRLPYSSAFVGYAM
                     DEIYVGKGIVTEAVNMVVRFAFDQIGLHRVEAYVSTQNNPSMRVLEKAGFQQEGLLRK
                     LLYINGHWVDHYMYARLEDE"
     gene            complement(311701..312264)
                     /locus_tag="BSPH_RS01440"
                     /old_locus_tag="Bsph_0290"
                     /db_xref="GeneID:6024658"
     CDS             complement(311701..312264)
                     /locus_tag="BSPH_RS01440"
                     /old_locus_tag="Bsph_0290"
                     /EC_number="4.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_012292084.1"
                     /db_xref="GI:501249066"
                     /db_xref="GeneID:6024658"
                     /translation="MTMLQDILGFNKEFVQEKKYEPFITTKYPDKRIVVLSCMDTRLV
                     ELLPKAMNLRNGDVKIVKSAGALVSHPFGAVMRSLLVAVYGLQADEVYVVGHYDCGMS
                     AVDPDAMLSEMVKRGINPETIKMLEYSGFDLKEFLRGFGDVATSVKKSVDTIRNHPLM
                     VKDVPVHGLIIDPNTGHLDLIEDGNHQ"
     gene            complement(312714..313955)
                     /locus_tag="BSPH_RS01445"
                     /old_locus_tag="Bsph_0293"
                     /db_xref="GeneID:6024661"
     CDS             complement(312714..313955)
                     /locus_tag="BSPH_RS01445"
                     /old_locus_tag="Bsph_0293"
                     /EC_number="3.4.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M29"
                     /protein_id="WP_012292086.1"
                     /db_xref="GI:501249068"
                     /db_xref="GeneID:6024661"
                     /translation="MNLLLSFNTKLLKYAELAIKVGVNIQKDQYLYISCSTDNLKLAQ
                     IITKLAYKNGAKQVFVDLSDDELVRARYEGAPKDSFDFFPPWKVQEREWLAENGAAFL
                     SISSQNPDLLKGIERDRIMAFQKASGQALANYYQLLQSDKFSWSVIAAPSKAWAAKVF
                     PDLPEDQQMDALWEAIFAATRIDLEHSVEAWLAHDKELHDKAEYLNSKQYKSLHYTAP
                     GTDLTIELPAHHIWTGGSSVNEQGQTFMANIPTEEIFTAPLKTGINGFVSSTKPLSYG
                     GNIINNFTLTFKDGRIIDVKAEEGQEILASLIETDEGAHYLGEIALVPHHSPISQSNL
                     LFYNTLFDENASNHLAIGSAYAFCIEGGKDMSSDELAAHGINQSLTHVDFMIGSNKMN
                     IDGITHDNQKEPIFRDGNWAF"
     gene            314146..314949
                     /locus_tag="BSPH_RS01450"
                     /old_locus_tag="Bsph_0294"
                     /db_xref="GeneID:6024662"
     CDS             314146..314949
                     /locus_tag="BSPH_RS01450"
                     /old_locus_tag="Bsph_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004225583.1"
                     /note="With Mot B forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_031416865.1"
                     /db_xref="GI:670468140"
                     /db_xref="GeneID:6024662"
                     /translation="MDKSSIIGLIIAFIALLTGMVMKGVSLTAFYNPAAILIIIFGTI
                     SAVTIAFPMQELKRVPKLFKILFKETKLANDIEIIKMFSQWADLARREGLLALESKAS
                     EIEDPFLKNGLTLAIDGQNADYIRDVLTEEVEAMEERHASGSAIFTQAGTYAPTLGVL
                     GAVVGLIAALADMNDIEKLGHAISAAFMATLLGIFTGYVLWHPFANKLKRKSALEVKQ
                     KRMMIEGILSVLEGEAPRVIEQKLSSYLTMEERRQISGESGAGGLGKES"
     gene            314933..315697
                     /locus_tag="BSPH_RS01455"
                     /old_locus_tag="Bsph_0295"
                     /db_xref="GeneID:6020728"
     CDS             314933..315697
                     /locus_tag="BSPH_RS01455"
                     /old_locus_tag="Bsph_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_025115820.1"
                     /db_xref="GI:640691490"
                     /db_xref="GeneID:6020728"
                     /translation="MAKKAKKKKHDEHIDESWLVPYADILTLLLAVFIILFASSSVDQ
                     EKLERMSAVFSQVFDGGTSFLEQPAPVPSPNADSDQTPQQNSAYLKDQQELAEIKDSV
                     DNFIAVNEMEGQFATEMTDEGLLVTIRDSILFDPGQATIKPEYIPIAKELADVLVSNP
                     PRNIVITGHTDNVPAGPNFSSNLELSLMRASNFYMVLLDSNSQLKSENFSAKGYGENR
                     AIAPNDTAEGRAKNRRVEVLIQPLVTEDGSEAKNTQ"
     gene            complement(315753..315974)
                     /locus_tag="BSPH_RS01460"
                     /old_locus_tag="Bsph_0296"
                     /db_xref="GeneID:6020729"
     CDS             complement(315753..315974)
                     /locus_tag="BSPH_RS01460"
                     /old_locus_tag="Bsph_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016995366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041658728.1"
                     /db_xref="GI:753951638"
                     /db_xref="GeneID:6020729"
                     /translation="MDLSVPSKENVIYMIDQMKDKLRMVNVDAMKSEHFDEANYENLT
                     YLYEMVMKRESFSPSEMQAIVAELGALRK"
     gene            316153..316479
                     /locus_tag="BSPH_RS01465"
                     /old_locus_tag="Bsph_0297"
                     /db_xref="GeneID:6020730"
     CDS             316153..316479
                     /locus_tag="BSPH_RS01465"
                     /old_locus_tag="Bsph_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292090.1"
                     /db_xref="GI:501249072"
                     /db_xref="GeneID:6020730"
                     /translation="MGQSKLLVSIVAGAAIGAALSMLDRTTREKTIDTTKKMKEAVTY
                     YATNREELQVLVEEKVLAAKVLCENVSDNVNTIAEKVEEFKELPTTIQSMIDDTKSAF
                     TLPHKE"
     gene            316502..317419
                     /locus_tag="BSPH_RS01470"
                     /old_locus_tag="Bsph_0298"
                     /db_xref="GeneID:6020731"
     CDS             316502..317419
                     /locus_tag="BSPH_RS01470"
                     /old_locus_tag="Bsph_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease yfkH"
                     /protein_id="WP_012292091.1"
                     /db_xref="GI:501249073"
                     /db_xref="GeneID:6020731"
                     /translation="MEKKKATMQNAFGFVKSFVSPEGEVIDVMTSKGFVQDLIGRVKR
                     VEISALSAQLAYFFLLSFFPLLIFLVTLLPYLNLETTQVYSFLVNVLPDEVYKLIENT
                     LNEILTNRNSSLLSIGVLGTIWSASKGINALIRALNKAYDTEGRAGILDRGLSLVFTV
                     ALVVVMAVALLLPVFGQQIGHFLFSIVGIEEQFESVWHNLRWSIPPILIFIVLMGIYW
                     FVPNTSPRLKILGVWPGAMFATLAWLVVTYAFSFYINNFANYSATYGSIGGVIILMLW
                     LYFTGIILIFGGVLNATMQKRALQKEINR"
     gene            complement(317482..319386)
                     /locus_tag="BSPH_RS01475"
                     /old_locus_tag="Bsph_0299"
                     /db_xref="GeneID:6020732"
     CDS             complement(317482..319386)
                     /locus_tag="BSPH_RS01475"
                     /old_locus_tag="Bsph_0299"
                     /EC_number="3.6.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_012292092.1"
                     /db_xref="GI:501249074"
                     /db_xref="GeneID:6020732"
                     /translation="MEHSNRENINLIEKIKEHAELIAALMAGVFILLAWRLDISGQTT
                     ASVLLYVIAFCVGGFAKAKEGIEETIEERKLNVELLMVLAAIGSAAIGYWTEGAILIF
                     IFAVSGALETYAMNKSHREISALMNLQPEEAWLVRGSFEPMKVSVSTLQIGDHLLIKP
                     GERIPADGIIFKGQSSIDESAISGEPLPVLKREGDEIFAGTVNLNGAITMEMTKANSE
                     TLFQKIIQLVQSAQSEKSPSQQFIEKFEGTYVKFVLLGVAIMMFLPHFVLGWDWTTTF
                     YRAMVLLVVASPCALVAAIMPATLAAISNGAKNGVLFKGGLHLEHLSVLGALAVDKTG
                     TLTQGKPVVTDFIVRDGFDRNMALAILAGIETQSNHPLAQAITSYAKAEGITALPSAT
                     IEDIPGWGIKGTVHNKEYQVGKPDFVNAQHANDFANGAAAKLAAQGKTVIFIRDQNGI
                     VALTALKDTVRNEAKKAVSLLKELGIQVVMLTGDNEKTAKVIAKEAGVTEYVAECLPE
                     TKVTEMKRLLSQYQFVGMVGDGINDAPALATATTGIAMGEGTDVALETADVVLMKNDL
                     SKIAYAVRLSRKMQRIVKQNIIFSIGVIILLIASNFLQVVDLPLGVIGHEGSTILVIL
                     NGLRMLNKNV"
     gene            complement(319646..321184)
                     /locus_tag="BSPH_RS01480"
                     /old_locus_tag="Bsph_0300"
                     /db_xref="GeneID:6025300"
     CDS             complement(319646..321184)
                     /locus_tag="BSPH_RS01480"
                     /old_locus_tag="Bsph_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="WP_031416868.1"
                     /db_xref="GI:670468143"
                     /db_xref="GeneID:6025300"
                     /translation="MNLQTLEKSLYDLITETSTNLPKDVRRAIKKAKEAENAGTRAAM
                     SLDTISNNIIMAEDNVSPICQDTGLPTFKIYTPVGVNQLEIKAAIKKAINDTTADAKL
                     RPNAVDSLTGANSGNNLGDGLPVMKFEQWENDYITIKLILKGGGCENKNIQYSLPCEI
                     DGLGRAGRDLDGIRKCILHSVYQAQGQGCSAGFIGVGIGGDRSSGYDLAKEQLFRHVE
                     DTNPNPDLAKLEEYVVKTSNTFGIGTMGFGGEATLLGCKIGVMHRIPASFYVSVAYNC
                     WAYRRMAVDIDPQTGEIIKWHYQEGEKITFKEDEVAATTEDNTTNVVELTAPITEEQI
                     RSLKVGDVVSITGRMYTGRDAIHHHLMSHDAPVDLNGQVIYHCGPVMAKDEEGNWTVK
                     AAGPTTSIREEPYQGDIMKKFGIRAVIGKGGMGPKTLKALNEHGGVYLNAIGGAAQYY
                     ADCIKGVDGVDLMEFGIPEAMWHLNVEKFTAVVTMDSHGNSLHADVDKSSLEKLALHA
                     ERVF"
     gene            321375..322175
                     /locus_tag="BSPH_RS01485"
                     /old_locus_tag="Bsph_0301"
                     /db_xref="GeneID:6025301"
     CDS             321375..322175
                     /locus_tag="BSPH_RS01485"
                     /old_locus_tag="Bsph_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160445.1"
                     /db_xref="GI:738204527"
                     /db_xref="GeneID:6025301"
                     /translation="MSAKTLLELPEEFDQYRPLIEETMKPVVLIDAYAGKTTLFQSKF
                     AGDPYFPLAMEYPKNASGQPLKLLAQVNFAELPKHLPHFPEEGIVQFYIDGYDDVLGM
                     DFDNGKNQEGFRVIFHDTVIHDEAQLIQDFSFVEKEDEEMYFPVEREMTLSFKTGFEP
                     LTIDDYRANEIYSSILKAIEDNETVEDAFYDALTGDGLKIGGYPFFTQEDPRAYGNYT
                     DSSILLLQIDSVGDDILWGDCGVGNFFITEEELKNKDFSNVLYNWDCH"
     gene            complement(322218..322403)
                     /locus_tag="BSPH_RS01490"
                     /old_locus_tag="Bsph_0302"
                     /db_xref="GeneID:6025302"
     CDS             complement(322218..322403)
                     /locus_tag="BSPH_RS01490"
                     /old_locus_tag="Bsph_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008173529.1"
                     /db_xref="GI:495448835"
                     /db_xref="GeneID:6025302"
                     /translation="MSKPITDKKQQVTYLRERLEMFLEVLDALDPETAELDDIDRLIQ
                     MMDDLEDKMEQFNAREQ"
     gene            322766..323950
                     /locus_tag="BSPH_RS01495"
                     /old_locus_tag="Bsph_0303"
                     /db_xref="GeneID:6025303"
     CDS             322766..323950
                     /locus_tag="BSPH_RS01495"
                     /old_locus_tag="Bsph_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009371551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_036160447.1"
                     /db_xref="GI:738204529"
                     /db_xref="GeneID:6025303"
                     /translation="MTYFSDYSKKRFTILVIIVSISGFSQGMLLPLISIIFERDGVSS
                     ALNGLNATGLYIGTLLISPFIEQPLRKWGYKPIILMGGAFVFISLLAFPLWKSVTFWF
                     VLRLLIGVGDHALHYATQTWITSTADHKSLGKGMAIYGLSFSIGFAVGPLMVKLIEIA
                     EALPFIVSSIMCLIAWSFVFFLQNEKPERLTGDLHARGWKRYKMAILFGWIAFLGPFV
                     YGFLESSLNALFPVYALRKGFEVGMIPIILSVFTFGGILTQVPLGALGDKVGRRNILM
                     VGSFGGAIIFAIASFLEQSQMAVAIAFFLTGTLVGSMFSLGITFMADLTPKELLPTGN
                     LLCGIALSIGSLTGPFLGGVYLEYVKNYSFLLLVAILLLIVAFILLIFGRLKNKQTLM
                     AK"
     gene            324187..324822
                     /locus_tag="BSPH_RS01500"
                     /old_locus_tag="Bsph_0304"
                     /db_xref="GeneID:6025304"
     CDS             324187..324822
                     /locus_tag="BSPH_RS01500"
                     /old_locus_tag="Bsph_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292096.1"
                     /db_xref="GI:501249078"
                     /db_xref="GeneID:6025304"
                     /translation="MTEMKKLSIHRALTELKMLQQRIEGATNEVSSVVANRKSNQKIN
                     GIEIVEYEKQMQASYDKVMGLISYRNNIKALVVQSNASTKVIVGKEEMTVAEAIERKQ
                     SIQYEKNLLEVMQHQYRSAIHTVAKENDALPAKLETYLINILGNKDKQSPEEVKLHTE
                     TFMKRNEFEIIDPLNVRQRIETLSSRIEEFESEVDAVLSESNATTFIEVQA"
     gene            complement(325153..326532)
                     /locus_tag="BSPH_RS01505"
                     /old_locus_tag="Bsph_0305"
                     /db_xref="GeneID:6024763"
     CDS             complement(325153..326532)
                     /locus_tag="BSPH_RS01505"
                     /old_locus_tag="Bsph_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_036162515.1"
                     /db_xref="GI:738206602"
                     /db_xref="GeneID:6024763"
                     /translation="MTQQTTMTVGQKFPLIIRRLGINGEGVGFYKRNVIFVKGAIPGE
                     EITAQVTKTQRNFAEAEILSIHKASKHRQEAPCPVYNECGGCQLQHMTYEKQLLEKRD
                     IVIQALERYAKPLAETVEVRKTLGMDNPWHYRNKSQFQVRKEGKRVYAGLFAEGSNKL
                     LNINDCLVQHPVTSKITVATRKILQKLNITIYDGRTLDGLVRTIVVRTGIRTGETQVV
                     LVTTRKEIPHLAELITRIKKIDPSIVSIAQNINREKTSLIFGDETIVLDGKETIHEEL
                     GELAFDLSARAFFQLNPTQTVHLYDEIKKAAALTGKESVVDAYCGVGTVGLWLADQAA
                     EVRGMDVIPESIQDARKNARNHGFKHTKYAVGTAESVLSKWRKEGFTPDVITVDPPRT
                     GLASEFIQTVLKLRPKRFVYTSCNPSTLAKDLQQLSKHYHVEYIQPVDMFSQTAQVEC
                     VAKLVLKNK"
     gene            complement(326570..327394)
                     /locus_tag="BSPH_RS01510"
                     /old_locus_tag="Bsph_0306"
                     /db_xref="GeneID:6024764"
     CDS             complement(326570..327394)
                     /locus_tag="BSPH_RS01510"
                     /old_locus_tag="Bsph_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016995377.1"
                     /note="Hypothetical 30.6 kDa protein in fumA 3'region
                     precursor; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_012292098.1"
                     /db_xref="GI:501249080"
                     /db_xref="GeneID:6024764"
                     /translation="MWKQHIVGAVIATFIIAAGISINPYFAAGSDEHHWGFKRAKNGE
                     QAEAGAQLDQLLDKYGAIYKGKADKKIAYLTFDNGYENGFTESILDTLKKEDVPATFF
                     LTGHYLDSASDLVKRMVKDGHTIGNHSYGHPNMARLTPEGMRAEWRKFDGKLREMTGI
                     DRTTYARPPEGTFNAKLLEVGNAEGYRHIFWSVAFKDWMKDERRGADYAYNALMEQLH
                     PGAVILMHTVAQDNAEALPMFIAEAKKQGYTFLSLDDLVLEYEDFPVALQSSAPSL"
     gene            complement(327451..328359)
                     /locus_tag="BSPH_RS01515"
                     /old_locus_tag="Bsph_0307"
                     /db_xref="GeneID:6024765"
     CDS             complement(327451..328359)
                     /locus_tag="BSPH_RS01515"
                     /old_locus_tag="Bsph_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug MFS transporter"
                     /protein_id="WP_036160449.1"
                     /db_xref="GI:738204531"
                     /db_xref="GeneID:6024765"
                     /translation="MKIVIAGGTGFVGKAFIKLAQENGHSIFVLTRSPSSEKNGIQYV
                     QWLQDESLPIEALEGADAFVNLAGVSLNNGRWTKKQKKDIYWSRMHATLEIVRIIEKL
                     RKKPKVLVNASAVGFYPHSTEVIYNENFSDAATNFLGSTVDDWERHAKRAEHLGIRVA
                     LARFGVILGRKSGALPPMLLPYQMHIGGTIGSGKQWLSWVHIEDVARALYFAILHEEI
                     HGPFNVTAPHATRMKEFGQTIAMVMNRRHWMPVPSFAIRFALGEQSTLVLEGQHVQPA
                     LLEKHHFTFKFPHLTEALEDLLIAQN"
     gene            328510..329319
                     /locus_tag="BSPH_RS01520"
                     /old_locus_tag="Bsph_0308"
                     /db_xref="GeneID:6024766"
     CDS             328510..329319
                     /locus_tag="BSPH_RS01520"
                     /old_locus_tag="Bsph_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_036160451.1"
                     /db_xref="GI:738204533"
                     /db_xref="GeneID:6024766"
                     /translation="MAMRMITKIARQKNNPERYNIYLNEEYAFPVDEAILLQFSLTKG
                     KVLDEFEIQEIAYEDEIRKAFNKGLNFLSYQMRSEHEVKKKLLTLEFGEAVVLEAIQK
                     LKSYGFINDENYSKALLDTKKATMKKGPRAIRQDLMKKGINKNLQDEVLATYSFEEQI
                     KLALQLAEKIIRSEKRKTPAQVKAKIQDYLLRKGYAFPIVEEVLNQIELEQDEDNWQP
                     LLDAQGEKVWKKYVSKYTGYELKMKVKQTLYQKGFPIEVIDRFIEEKENEE"
     gene            329316..329645
                     /locus_tag="BSPH_RS01525"
                     /old_locus_tag="Bsph_0309"
                     /db_xref="GeneID:6024767"
     CDS             329316..329645
                     /locus_tag="BSPH_RS01525"
                     /old_locus_tag="Bsph_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292101.1"
                     /db_xref="GI:501249083"
                     /db_xref="GeneID:6024767"
                     /translation="MNEKNYAAMSEHELREEIAFLKEKARKAEQLGIINEFAVYERKA
                     LMAAAYLVDLNTIVPGEMYRIDRSDNEFFQVDYLKGRFAWGHRLGGDKYQEALPVSML
                     SPVKVGK"
     gene            329646..329915
                     /locus_tag="BSPH_RS01530"
                     /old_locus_tag="Bsph_0310"
                     /db_xref="GeneID:6021984"
     CDS             329646..329915
                     /locus_tag="BSPH_RS01530"
                     /old_locus_tag="Bsph_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292102.1"
                     /db_xref="GI:501249084"
                     /db_xref="GeneID:6021984"
                     /translation="MEEKIEKLTAELLAKNPQMSVGRARVWVELLWSDFESTSAKAGH
                     DYRGPDYTENLVRQLITSYGDKLHAFAGRNPKYAHLLDASDDMIQ"
     gene            complement(329951..330937)
                     /locus_tag="BSPH_RS01535"
                     /old_locus_tag="Bsph_0311"
                     /db_xref="GeneID:6021985"
     CDS             complement(329951..330937)
                     /locus_tag="BSPH_RS01535"
                     /old_locus_tag="Bsph_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_036160453.1"
                     /db_xref="GI:738204535"
                     /db_xref="GeneID:6021985"
                     /translation="MDSGTHFVMGIAIGGLALADPIVANHSMTFTAVMAGTIIGSQAP
                     DVDTVLKLRNNAIYIRHHRGITHSLPAVAIWPILITAVISLILQDVNVFHLWLWTFLA
                     VALHVFVDIFNAYGTQAIRPFSRKWVALGVINTFDPIIFSLHCLGIVLWAFGANPVWT
                     FSIMYIIIVIYYLLRFAVQKAVKNAVHSTIQDEEYVIVAPTMRFFHWRIAAKSKTHYY
                     VGRAYGRTVNIYDKFEIKPLPNTALIHAAMKDPNLAAFVSFSPMYRWEISELENGLLE
                     VRLIDLRYRSDNRYPFVAVAHLNDDNEIVTSYTGWIFTEDKLQKKLQIGASN"
     gene            331138..332181
                     /locus_tag="BSPH_RS01540"
                     /old_locus_tag="Bsph_0312"
                     /db_xref="GeneID:6021986"
     CDS             331138..332181
                     /locus_tag="BSPH_RS01540"
                     /old_locus_tag="Bsph_0312"
                     /EC_number="3.2.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA glycosylase"
                     /protein_id="WP_012292104.1"
                     /db_xref="GI:501249086"
                     /db_xref="GeneID:6021986"
                     /translation="MNYPYVTEFRHSLVEWFNAEKRDLPWRHTTDPYKIWVSEVMLQQ
                     TRVDTVIPYYNRFMESFPTLDLLAEAPQDYLLKHWEGLGYYSRVRNLQAGAREVLENY
                     GGVVPDNRHEISKLKGVGPYTAGAILSIAYNKPEHAVDGNVMRVLSRVLNINEDIAVP
                     KTKKIFEAAVEELIDPTNASSFNQGLMELGALICTPTSPKCLLCPVREYCTAFNEGEP
                     EKLPVKSKKMKMKHLSYNILVCQDEQGRFLMEQRPEEGLLAKLWQFPMIDTTSQITEE
                     SFLKECFINVQARHELLSFKHVFSHLTWHINSYYMKCKSSSTGDWFTQEQIEQLPMPV
                     PMLKIWEEVKNNK"
     gene            332727..333275
                     /locus_tag="BSPH_RS01545"
                     /old_locus_tag="Bsph_0314"
                     /db_xref="GeneID:6021988"
     CDS             332727..333275
                     /locus_tag="BSPH_RS01545"
                     /old_locus_tag="Bsph_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_025115837.1"
                     /db_xref="GI:640691507"
                     /db_xref="GeneID:6021988"
                     /translation="MALPVEGETIQIHSYKHNGRIHRVWQETMVLKGTKNIVIGANER
                     TLVTESDGRTWLTREPSICYFHAEHWFNIICMLREDGVYYYCNLSSPFVFDNNAIKYI
                     DYDLDIKVFPDMSYTLLDEDEYELHRKEMSYPDVIDKILKRNVDKLISWIQQKRGPFA
                     PDFIDVWTNRYKFQLDMQSDDC"
     gene            333459..335204
                     /locus_tag="BSPH_RS01550"
                     /old_locus_tag="Bsph_0315"
                     /db_xref="GeneID:6024181"
     CDS             333459..335204
                     /locus_tag="BSPH_RS01550"
                     /old_locus_tag="Bsph_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_031416883.1"
                     /db_xref="GI:670468158"
                     /db_xref="GeneID:6024181"
                     /translation="MGSIKRYMRFVKPYSWEIVLTIVIGIVKFAIPLFIPLLIKIVLD
                     DIIAADDLTDGEKTKELLYWLGGTIIVFFIIRPPIEYYRQYFAQHVSNKVLFDIRKEI
                     YAHLQRLSLKYYANTRAGDVISRVINDVEQTKNFVMTGLMNVWLDLATIVIAVIIMLT
                     MDIKLTLVALLAFPFYALSVKYFFGKLRDLTRKRSQALAGVQSYLHERVAGMSIVKSF
                     TLEKHEQTLFDQANGEFLEKALDQTKWNAKSFAVVNTITDVAPLLVIAYAGYQVINGT
                     LSVGTMVAFIAYIERLYGPLRRLVSSSTTLTQSIASMDRMFDLMDEPYEVKNKVGARE
                     LPAATGEVRFDNVSFQYEKDGVSILKNINFTINPGETVAFVGMSGGGKSTIISLIPRF
                     YDATDGFVTIDGQDVRDVTLHSLRSQIGIVLQDNILFSDSVKENILMGKPDATDEQVI
                     EAAKAANAHDFIMTLPNGYDTKVGERGVKLSGGQKQRVAIARVFLKNPPILILDEATS
                     ALDLESEALIQESLEELAHERTTIIIAHRLSTITHADKIFVIDHGQLIESGTHEQLMM
                     EQGTYYDLFQVQHLE"
     gene            335504..336517
                     /locus_tag="BSPH_RS01555"
                     /old_locus_tag="Bsph_0316"
                     /db_xref="GeneID:6024182"
     CDS             335504..336517
                     /locus_tag="BSPH_RS01555"
                     /old_locus_tag="Bsph_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_012292107.1"
                     /db_xref="GI:501249089"
                     /db_xref="GeneID:6024182"
                     /translation="MRKKLLEIKGLKTTFFTDNGQIPAVDDIDFSVQEGEILGIVGES
                     GSGKSVTSLSIMGLIPSPPGKITGGEILLDGKNLVNYTEKQMQKIRGKDIAMIFQEPM
                     TSLNPLFTIGDQLKEAILIHNPKWSRKKAFARAVEIVKLVGLPRAEELLKDYPHQLSG
                     GMRQRVMIAMALVCDPQVLIADEPTTALDVTIQAQILQLMKDLNKRLNTAVLLITHDL
                     GVVAETCERVIVMYAGQVVEEAPIQEIFANPKHPYTQGLIQSVPDMRFKKENLYSIPG
                     SVPKPGSIQVGCRFAARCEYAMERCLQETPPLFEAAEQHKSRCFLLEKQEVEQRVESV
                     IKG"
     gene            336492..337471
                     /locus_tag="BSPH_RS01560"
                     /old_locus_tag="Bsph_0317"
                     /note="peptide ABC transporter ATPase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6024183"
     gene            337503..339119
                     /locus_tag="BSPH_RS01565"
                     /old_locus_tag="Bsph_0318"
                     /db_xref="GeneID:6024184"
     CDS             337503..339119
                     /locus_tag="BSPH_RS01565"
                     /old_locus_tag="Bsph_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012292109.1"
                     /db_xref="GI:501249091"
                     /db_xref="GeneID:6024184"
                     /translation="MKKKKLWTLGVMLLLILSTILAACGGSDTKDTGSKDTSTGGDTA
                     SSGEPKILVYGRGGDSVALDPAVVTDGESFTVTANIYETLVNFGEQDVTIQPGLAKSW
                     EASEDGLTYTFQLQEGVKFHDGTDFNAEAVVKNIERWKSGADKHPYFSSQFLVGDKQV
                     IESVNAEGDYTVVFKLSQPQAPFLKNLAMSPFAIASPTAFEADEEGLSANPVGTGPFK
                     FVSWVRNDSITIEKNPDYYIDGYPKLDKVIYRSIPENSARLNDLLAGNIDVADGISPS
                     DKGTIEGDANLQLIERPSMNVGYLGLTVTRPPFDNVKVRQAVNYAIDKQALVDAFYEG
                     LAEPAKNPMPPVISGYNDEVAGYTYDPEKAKALLAEAGYDGKEIELWAMPVPRPYMPD
                     GQKVAEAIQKNLEDVGIKSKIVSFEWATYLEKAQNGEADAFLLGWTGDNGDADNFLYT
                     LLDGDNIGSNNYTFYDNQELHKLLTAAQTEVDEDKRNELYKQAQVIISEDAPWVPLAH
                     STPILAANKKVTNYIAHPTGSDRLGAVDIQ"
     gene            339345..340349
                     /locus_tag="BSPH_RS01570"
                     /old_locus_tag="Bsph_0319"
                     /db_xref="GeneID:6024185"
     CDS             339345..340349
                     /locus_tag="BSPH_RS01570"
                     /old_locus_tag="Bsph_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292110.1"
                     /note="transports peptides consisting of two or three
                     amino acids; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_031416888.1"
                     /db_xref="GI:670468163"
                     /db_xref="GeneID:6024185"
                     /translation="MLHYMGRRLFQLIPVLLGMTFIVFMLIRAIPGNPAQVILGQQAT
                     KEAVEALNASLGLDKPWYTQYFSYLAGIFQGDLGVSLRTKLPVSDEIFPYLAATAELA
                     FFAMIIAIVIGVNAGIISAWFQNSWFDYTAMIVALIGVSVPVFWLGLMEQWTFSSKLG
                     WLPTSGREDVRNPITAITHFYLLDTLIQGRFDQFVEVLKRLILPGVALATIPMAIIAR
                     ITRSSMLEVMRSDYVRTARAKGQKMFIVVYKHALKNAVIPVLTVIGLQTGLLLGGAIL
                     TETIFSWPGIGRYIYDAIGFRDYPVIQSGILIVAFIFIMINLIVDLLYTVVDPRIKYK
                     "
     gene            340362..341258
                     /locus_tag="BSPH_RS01575"
                     /old_locus_tag="Bsph_0320"
                     /db_xref="GeneID:6020596"
     CDS             340362..341258
                     /locus_tag="BSPH_RS01575"
                     /old_locus_tag="Bsph_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012292111.1"
                     /db_xref="GI:501249093"
                     /db_xref="GeneID:6020596"
                     /translation="MMTGAIDIKKEAAPVRERAVGPWLEGWRSFKKSKVSLVGAGIVI
                     FFVLLAVIGPFIAPQGINEQDLTKRLLAPSADHWFGTDDFGRDIFSRIIHGARISLWV
                     GFFSVILSVIIGSLLGIIAGYYGKWIDTIISRIFDIMLAFPSMLLAIAVVSVLGPSLQ
                     NALIAIAIINIPNFGRLIRSKVLSVKEEEYIVAAKAIGMRDSRILFSHILPNSITPII
                     VQGTLAIATAIIEAAALGFLGLGAQAPAPEWGKMLADARKFLLNAPWTMIFPGLAIML
                     TVLGFNLMGDGLRDALDPKMKN"
     gene            341523..342140
                     /locus_tag="BSPH_RS01580"
                     /old_locus_tag="Bsph_0321"
                     /db_xref="GeneID:6020597"
     CDS             341523..342140
                     /locus_tag="BSPH_RS01580"
                     /old_locus_tag="Bsph_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="WP_012292112.1"
                     /db_xref="GI:501249094"
                     /db_xref="GeneID:6020597"
                     /translation="MAINLQKGQRVDLTKGNAGLNKIKVGLGWDPVGQEKSGGFLGGL
                     FSSRNSGSGRSVDCDASVLMLQDDKVLAGDDVIYFGKLTSNCGSVRHSGDNLTGDGDG
                     DDEVITIELSSVPTQFNKLVFVVNIYDAAGRNQHFGMIRNAYIRVYDDRTGSELIRYN
                     LSDDYSNLTTLICGEIYRHQTEWKFAAVGSGTNDLKLGDVVRRYQ"
     gene            342173..342754
                     /locus_tag="BSPH_RS01585"
                     /old_locus_tag="Bsph_0322"
                     /db_xref="GeneID:6020598"
     CDS             342173..342754
                     /locus_tag="BSPH_RS01585"
                     /old_locus_tag="Bsph_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemical-damaging agent resistance protein C"
                     /protein_id="WP_012292113.1"
                     /db_xref="GI:501249095"
                     /db_xref="GeneID:6020598"
                     /translation="MGISLQKGQKVDLTKTNPGLTNVIVGLGWDTNKYDGGNDFDLDS
                     SVFLLADTGKVADQNDFIFYNNTTGGNGSVEHSGDNLTGIGEGDDEVVKVALAQVPAH
                     VQRLAFTVTIHDAESRNQNFGMVSNAYIRIVNAASNQELIRYDLGEDFSIETAIVVGE
                     LYRHNGEWKFNAVGAGYQGGLAALCNDYGLNVN"
     gene            342788..343363
                     /locus_tag="BSPH_RS01590"
                     /old_locus_tag="Bsph_0323"
                     /db_xref="GeneID:6020599"
     CDS             342788..343363
                     /locus_tag="BSPH_RS01590"
                     /old_locus_tag="Bsph_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016994007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemical-damaging agent resistance protein C"
                     /protein_id="WP_012292114.1"
                     /db_xref="GI:501249096"
                     /db_xref="GeneID:6020599"
                     /translation="MAIQLSKGQRIDLTKQDPGLNNIGIGLGWDVKQFDGGQDFDLDA
                     SVFLLDASGKCRNEQDFIFYNNLASPDQSVVHAGDNRTGEGDGDDEKILVNLKQVSPQ
                     IDKIVVTVTIYDAEGRHQNFGQVLNAYVRLTNEESGAEVLRYDLGEDFSIETAVVFCE
                     LYRHNGEWKFAAIGSGYQGGLAALINAYGLQ"
     gene            343476..343658
                     /locus_tag="BSPH_RS01595"
                     /old_locus_tag="Bsph_0324"
                     /db_xref="GeneID:6020600"
     CDS             343476..343658
                     /locus_tag="BSPH_RS01595"
                     /old_locus_tag="Bsph_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160456.1"
                     /db_xref="GI:738204538"
                     /db_xref="GeneID:6020600"
                     /translation="MHTIALVFLCLIERVSELETSAYILIPTIVWNMFAHIFGFHLLH
                     EAFFIILIAAFLLSSY"
     gene            343781..344974
                     /locus_tag="BSPH_RS01600"
                     /old_locus_tag="Bsph_0325"
                     /db_xref="GeneID:6022526"
     CDS             343781..344974
                     /locus_tag="BSPH_RS01600"
                     /old_locus_tag="Bsph_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016994008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase subunit beta"
                     /protein_id="WP_012292116.1"
                     /db_xref="GI:501249098"
                     /db_xref="GeneID:6022526"
                     /translation="MQHFATEAETIFYKKPQPFTKWATPDILSYALGATLYMPASMPN
                     IVGLIQSQKYKELTSLVIDLEDAVGDSELGDCEAKLLEDISELYKLYHQKQLLLQDIP
                     LLFIRVRHVEQFNYLTSSLKEKQEVLTGYVFPKFTATQGAQYFELLEKTILENNLTLY
                     GMPILESREVLYKESRMEALLAIKSVLQQYQSRVLNIRIGATDFCGIYGIRRRMDSTI
                     YDISLIRDCIADIVNVLGREEDGFVISGPVWEYFSNQRVLKPALRMTPFSEKGALETR
                     KALLDDCLDGLIKEVLMDKQNGIVGKTVIHPSHIRVVHALYAISYEEYLDALSIVEHN
                     DGSKGVMKSHYANKMNEIKPHMRWAQRILKQAHVYGVYHETVDFASLLLNSELGGHMY
                     ATTNE"
     gene            344955..346313
                     /locus_tag="BSPH_RS01605"
                     /old_locus_tag="Bsph_0326"
                     /db_xref="GeneID:6022527"
     CDS             344955..346313
                     /locus_tag="BSPH_RS01605"
                     /old_locus_tag="Bsph_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292117.1"
                     /db_xref="GI:501249099"
                     /db_xref="GeneID:6022527"
                     /translation="MQQQMSKLTILPNYSIDIEITHNPHDFALTDLFQMAARINKKRQ
                     FLFISTVLGKHLAVRPQIPLLTGALLAMMYDQQGNNQKVNTITPVVQALKEGINLEEL
                     QNSMKGSVELAHKTLFIGFAETATALGHAVFNAFQSNAMYIHTTREVIPHIEPFVTFE
                     EEHSHATSHRIYTEEPNVLQQAKRIVLIDDEITTGNTVINIIETLKKKFPDVKQYVVL
                     SILDWRSEQQRIVFQQLEEQWEISIKFISIMCGTFNCTGVPSLTSVQPKVTTIATRDI
                     TLLPIKDSIDRLFYYSVAENGKINNQPYLKATGRFMLTSKQHFEQMNMLQAIAKQLKE
                     LRTDGPALVIGTGEFMYVPMQIASYLGEGVYFQSSTRSPIYCTDDVDYTITEKIVFES
                     PENNGVENYLYNVQSQLYTELFLIIERISNKEVVDRMVAALQSVSGAKVYVICMHELE
                     GV"
     gene            346313..347413
                     /locus_tag="BSPH_RS01610"
                     /old_locus_tag="Bsph_0327"
                     /db_xref="GeneID:6022528"
     CDS             346313..347413
                     /locus_tag="BSPH_RS01610"
                     /old_locus_tag="Bsph_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160459.1"
                     /db_xref="GI:738204541"
                     /db_xref="GeneID:6022528"
                     /translation="MTSTLQPDNMGSYAREDVIFLLRDIGNVFLEMGNEKREQLIQAG
                     THYSEMLPMEYQPSKTYMKLFYKTLDAFADRIAIAVGVVAERIVKSRGLENLILVSLA
                     RAGTPIGILIKRYISMNYKVDVPHYSISILRGRGFDEAAIRYILSEHPQGCLQFIDGW
                     TGKGAITKELIQSCQTFNEQYQTQLKADLAVLADPGHCATIFGTREDFLIPSACLNST
                     VSGLVSRTVLNLQFMDKDDFHGAKYYKELEDMDVSNLYINRIVACFKQVRNEITSQLQ
                     DEATSLITWAGMKSVQNIQLDFDMENINLIKPGVGETTRVLLRRIPWKILINPQYKDE
                     LEHILLLAHEKNVVLEEYSHMSYACCGLIKEL"
     gene            347425..348237
                     /locus_tag="BSPH_RS01615"
                     /old_locus_tag="Bsph_0328"
                     /db_xref="GeneID:6022529"
     CDS             347425..348237
                     /locus_tag="BSPH_RS01615"
                     /old_locus_tag="Bsph_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160461.1"
                     /db_xref="GI:738204543"
                     /db_xref="GeneID:6022529"
                     /translation="MILFTSDLDRTLIYSKRMMEMFPPISDKVVVEHKANEKMSMMTK
                     ETAILLQQVHQQTLFVPVTTRALHQYKRIHFINDLNPSFAITSNGGTILEKGQPCDKW
                     TKTLGRRIEDSSIPREDMLQIFHTIKSDTWLQRSFYIDDLFYVHHVNLDVLQQDDLRA
                     MTQEFDTHGWYVFLQGKKLYFMPKVLTKEAAIQYMMEFCTYDVHIAAGDSMMDYGMLK
                     MADVAFTPNHGDLKDKQPETLLNTTYSPYEGEAFTKHLLQAVLQHTTQQTVV"
     gene            348597..350228
                     /locus_tag="BSPH_RS01620"
                     /old_locus_tag="Bsph_0329"
                     /db_xref="GeneID:6022530"
     CDS             348597..350228
                     /locus_tag="BSPH_RS01620"
                     /old_locus_tag="Bsph_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292120.1"
                     /db_xref="GI:501249102"
                     /db_xref="GeneID:6022530"
                     /translation="MQTITIKTIVERNQDDWLQAFQDSPKNRAFYEETPQQICFSRMA
                     LRVLGVPIEEDEYFNSLYTLSQNQNIHILSEELNKHIEQKDFQAIQNILSQHQQTPKG
                     LTINRLVAMMYGYQLIPKHDDSIMNRHLQLTTIKVIELFQHQQSLGLLSNEFRRFLID
                     LVKWLKNHWIQWAKALKPTDDFPKVVWYGEATVSQRYFLLLLMELGCDVLIFHPAKVD
                     EFAEVDPNDDFSISYSYTSQTSLQPFPDKLRDRQATVGYRSSQHFEQLMHDQQSGVYR
                     PWQFKDFMPRSLTLRMTYDDIFIYAKEKALVRPQFDVNGNEVVIPVIFAKISGVSSQR
                     EEYWHFMHQLLINPQTIFVQEFPFTKTSKANFHFHYKHCLVNGELSAERIIQSDWWQY
                     GELSLELQQAIAYTIKTSCEQPMLKQQPNETLYDLQLFVFKQLTMIPQEILRLLQSFD
                     YSQEIPKIIMYQAPQQPALSREDIALLAFLNRFGMDIIFYNPTGQLDLEKHLLEDTYD
                     VHRLEHMLFDLPYEEPSQQKAAPDKIIKKLFNRFF"
     gene            350251..351285
                     /locus_tag="BSPH_RS01625"
                     /old_locus_tag="Bsph_0330"
                     /db_xref="GeneID:6020828"
     CDS             350251..351285
                     /locus_tag="BSPH_RS01625"
                     /old_locus_tag="Bsph_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="WP_031416897.1"
                     /db_xref="GI:670468172"
                     /db_xref="GeneID:6020828"
                     /translation="MSNIPMTLEQLTLETADAVKQQLREHEEVQQIAHQIDIKNQLEL
                     IELGKEPATKLSKFADQVLAIVTQSATFESNELFKQLESLMLTFDKKDFAEQKGFFKK
                     LFTRKSKNEEDVYAKYNVLGRDIEKIHYQFVLMEEELAKDNRLLARLYKEDLMFYLDI
                     EKYIVATDMKLHEVQTTLIPLYEEQGEAGNQVAKMELNRLQTIAEMLQQKIDELEKSR
                     MVAILTAPQIEMLRHGNNELIEQIHGAFVKTIPVFKMGLMNAVNERRQQLQNQSASAF
                     ENRVKQFGEASNEAVHLSTALAQQTDKTQTLEEMWDTIVTGIANYQHLRSEQTSKRKL
                     AEQQLLALRP"
     gene            complement(351377..352465)
                     /locus_tag="BSPH_RS01630"
                     /old_locus_tag="Bsph_0331"
                     /db_xref="GeneID:6020829"
     CDS             complement(351377..352465)
                     /locus_tag="BSPH_RS01630"
                     /old_locus_tag="Bsph_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_008173466.1"
                     /db_xref="GI:495448772"
                     /db_xref="GeneID:6020829"
                     /translation="MKLGARVFKTGVAIVFALFIAELLKLPSPVFAGIAAIFAIQPSI
                     YRSYQTIVEQVQANIIGATIAVFFGLLFGHHVVAIGIAVIIAIGLMLKFKLEKSLSLA
                     LVSVVAIMEFQGEDFLTFGLIRFVTILVGVLAAFVVNLVFLPPKYEIKLFRKIYILQD
                     DIIRWTRLAVRQASEHTSTKGALSKFKSRMLRVDTLYDLYKEERNYFKNKKYVKARKL
                     VVYRQMILTSKKSLELLQRLHNHENELAKLPTQFHLMIQERLDSLLTYHEQLLLKYTG
                     KLKPEHSEWSKSIDYVQRNELMEIFIKQVNFAREEGDTEFSSYHLLYILSRILDYEEN
                     LEHLDTLIVSYQSYHGHEINVEFEEEFI"
     gene            complement(352598..353887)
                     /locus_tag="BSPH_RS01635"
                     /old_locus_tag="Bsph_0332"
                     /db_xref="GeneID:6020830"
     CDS             complement(352598..353887)
                     /locus_tag="BSPH_RS01635"
                     /old_locus_tag="Bsph_0332"
                     /EC_number="5.4.3.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HUT1.1"
                     /note="Converts (S)-4-amino-5-oxopentanoate to
                     5-aminolevulinate during the porphyrin biosynthesis
                     pathway; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde aminotransferase"
                     /protein_id="WP_012292122.1"
                     /db_xref="GI:501249104"
                     /db_xref="GeneID:6020830"
                     /translation="MNHAKSEAVHAEALQHIVGGVNSPSRSYKAVGGGSPVAMVRGKG
                     AYFWDVDGNRYIDYLAAYGPIVTGHGHPHIAKAITHAAENGTLFGTPTEYEVTFANML
                     KEAIPSMDKVRFNNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHFDLVLVAAGSGP
                     ATLGTPDSAGVTTSTAEEVITVPFNNPEAFTEAMNTWGDEIAAILIEPIVGNFGIVEP
                     NPGFLELVHATAKEKGALTIYDEVITAFRFHYGGAQNLLGLTPDLTALGKVIGGGLPI
                     GAYGGRKEIMDTVAPLGPAYQAGTMAGNPASMQAGIACLEVLQTPGIYDEMDRLGGIL
                     EEGILAAAKEHGVTITLNRLKGALTIYFTDVKVENYEQAENSNGEIFGRFFKLMLEQG
                     VNLAPSKYEAWFLTTEHTEADILETIKAVNYAFSQLS"
     gene            354017..354493
                     /locus_tag="BSPH_RS01640"
                     /old_locus_tag="Bsph_0333"
                     /db_xref="GeneID:6020831"
     CDS             354017..354493
                     /locus_tag="BSPH_RS01640"
                     /old_locus_tag="Bsph_0333"
                     /EC_number="1.11.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_012292123.1"
                     /db_xref="GI:501249105"
                     /db_xref="GeneID:6020831"
                     /translation="MTLQEGQKVPDFSLMNEKGETVQLTDFKGQNVILYFYPKDMTPG
                     CTTEACDFRDRFEDFSHLNAVVLGVSPDDANKHTKFIDKHGLPFSLLVDEDHAVAEAY
                     GVWVLKKMYGREFMGIERSTFLIDSEGKLMKAWRKVRVKNHIEEVYAYLAEQEATT"
     gene            354490..355434
                     /locus_tag="BSPH_RS01645"
                     /old_locus_tag="Bsph_0334"
                     /db_xref="GeneID:6020832"
     CDS             354490..355434
                     /locus_tag="BSPH_RS01645"
                     /old_locus_tag="Bsph_0334"
                     /EC_number="1.1.1.95"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_012292124.1"
                     /db_xref="GI:501249106"
                     /db_xref="GeneID:6020832"
                     /translation="MRIYFTFEPRPDLREPLLAEFPQVDFIFESGITNEELQKADVLV
                     TYGENLTTESIQQATKLKWIFVASAGIEKMPAQAIMERGILVSNVRGIHKTPMAESML
                     AHILAIKRALPWMYEQQKKGEWSKKAKQTELRDSTALILGPGAIGSEVGRLLQAFGVT
                     TIGCNRSGNEASNMDKMISFEQLIEVLPSADIVISVLPKTQETTHLLNEEHFIAMKSS
                     AIFMNFGRGNLVDEKVLIQALEDGEIGYAVLDVFEEEPLSSDNPLWALPNVIVSPHVS
                     SHSSRYVERSLEIFKTSLTKWLRGDRDLENVMELSRGY"
     gene            355553..355996
                     /locus_tag="BSPH_RS01650"
                     /old_locus_tag="Bsph_0335"
                     /db_xref="GeneID:6020833"
     CDS             355553..355996
                     /locus_tag="BSPH_RS01650"
                     /old_locus_tag="Bsph_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_031416903.1"
                     /db_xref="GI:670468178"
                     /db_xref="GeneID:6020833"
                     /translation="MSTTHLQDALDTLKTTGVRITPQRHAILEYLIQSMAHPTADEIY
                     KALEGKFPNMSVATVYNNLRVFREVGLVKELTYGDASSRFDFVTNDHYHMICECCGKI
                     VDFHYPGLDEIEHFASQVTDFDVHSHRLEIYGTCPSCKGVTAKVQ"
     gene            complement(356018..356371)
                     /locus_tag="BSPH_RS01655"
                     /old_locus_tag="Bsph_0336"
                     /db_xref="GeneID:6020834"
     CDS             complement(356018..356371)
                     /locus_tag="BSPH_RS01655"
                     /old_locus_tag="Bsph_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HUT5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008173457.1"
                     /db_xref="GI:495448763"
                     /db_xref="GeneID:6020834"
                     /translation="MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMT
                     LGVLCIIGSTVVYAWIGLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLE
                     GKEFDQSYNHKTKKS"
     gene            356518..357405
                     /locus_tag="BSPH_RS01660"
                     /old_locus_tag="Bsph_0337"
                     /db_xref="GeneID:6020835"
     CDS             356518..357405
                     /locus_tag="BSPH_RS01660"
                     /old_locus_tag="Bsph_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031416904.1"
                     /db_xref="GI:670468179"
                     /db_xref="GeneID:6020835"
                     /translation="MEQVLRPIYQERASQSNTLGVILVEKREEQSNVTDTFDTVLLII
                     VKEAEQPVFSKHYLYEGNKVALHTVTEKLIRKWLLIGSNKKVVDWIFFGRVLFDRNEF
                     LHKLKIELQEFPYSGRKIKTGIQFSKLIRRYLEGKEYFDKGSYLDAYNHVVDSLHHLG
                     RLSIIDSGLYPEVTVWGQVKKIEPAIYKLYEELVTSNEPIEKRLELLFLASEFLIHSR
                     TRDGAQHILEVMQTKETWSIQELHDHHELMNYSVDLEVFVEYLVDKGYIHIEPVTAKN
                     EMIFHRHYKVDKEALEIGQ"
     gene            357751..359307
                     /locus_tag="BSPH_RS01665"
                     /old_locus_tag="Bsph_rRNA0616S"
                     /db_xref="GeneID:6020836"
     rRNA            357751..359307
                     /locus_tag="BSPH_RS01665"
                     /old_locus_tag="Bsph_rRNA0616S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6020836"
     gene            359611..362545
                     /locus_tag="BSPH_RS01670"
                     /old_locus_tag="Bsph_rRNA0623S"
                     /db_xref="GeneID:6020837"
     rRNA            359611..362545
                     /locus_tag="BSPH_RS01670"
                     /old_locus_tag="Bsph_rRNA0623S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6020837"
     gene            362656..362771
                     /locus_tag="BSPH_RS01675"
                     /old_locus_tag="Bsph_rRNA065S"
                     /db_xref="GeneID:6020762"
     rRNA            362656..362771
                     /locus_tag="BSPH_RS01675"
                     /old_locus_tag="Bsph_rRNA065S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6020762"
     gene            362788..362864
                     /locus_tag="BSPH_RS01680"
                     /old_locus_tag="Bsph_tRNA10"
                     /db_xref="GeneID:6020763"
     tRNA            362788..362864
                     /locus_tag="BSPH_RS01680"
                     /old_locus_tag="Bsph_tRNA10"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:362822..362824,aa:Asn,seq:gtt)
                     /db_xref="GeneID:6020763"
     gene            362870..362961
                     /locus_tag="BSPH_RS01685"
                     /old_locus_tag="Bsph_tRNA11"
                     /db_xref="GeneID:6020764"
     tRNA            362870..362961
                     /locus_tag="BSPH_RS01685"
                     /old_locus_tag="Bsph_tRNA11"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:362904..362906,aa:Ser,seq:gga)
                     /db_xref="GeneID:6020764"
     gene            362986..363060
                     /locus_tag="BSPH_RS01690"
                     /old_locus_tag="Bsph_tRNA12"
                     /db_xref="GeneID:6020765"
     tRNA            362986..363060
                     /locus_tag="BSPH_RS01690"
                     /old_locus_tag="Bsph_tRNA12"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363019..363021,aa:Glu,seq:ttc)
                     /db_xref="GeneID:6020765"
     gene            363080..363155
                     /locus_tag="BSPH_RS01695"
                     /old_locus_tag="Bsph_tRNA13"
                     /db_xref="GeneID:6020766"
     tRNA            363080..363155
                     /locus_tag="BSPH_RS01695"
                     /old_locus_tag="Bsph_tRNA13"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363113..363115,aa:Val,seq:tac)
                     /db_xref="GeneID:6020766"
     gene            363181..363255
                     /locus_tag="BSPH_RS01700"
                     /old_locus_tag="Bsph_tRNA14"
                     /db_xref="GeneID:6021059"
     tRNA            363181..363255
                     /locus_tag="BSPH_RS01700"
                     /old_locus_tag="Bsph_tRNA14"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363213..363215,aa:Met,seq:cat)
                     /db_xref="GeneID:6021059"
     gene            363259..363334
                     /locus_tag="BSPH_RS01705"
                     /old_locus_tag="Bsph_tRNA15"
                     /db_xref="GeneID:6021060"
     tRNA            363259..363334
                     /locus_tag="BSPH_RS01705"
                     /old_locus_tag="Bsph_tRNA15"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363292..363294,aa:Asp,seq:gtc)
                     /db_xref="GeneID:6021060"
     gene            363351..363426
                     /locus_tag="BSPH_RS01710"
                     /old_locus_tag="Bsph_tRNA16"
                     /db_xref="GeneID:6021061"
     tRNA            363351..363426
                     /locus_tag="BSPH_RS01710"
                     /old_locus_tag="Bsph_tRNA16"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363384..363386,aa:Phe,seq:gaa)
                     /db_xref="GeneID:6021061"
     gene            363434..363509
                     /locus_tag="BSPH_RS01715"
                     /old_locus_tag="Bsph_tRNA17"
                     /db_xref="GeneID:6024151"
     tRNA            363434..363509
                     /locus_tag="BSPH_RS01715"
                     /old_locus_tag="Bsph_tRNA17"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363467..363469,aa:Thr,seq:tgt)
                     /db_xref="GeneID:6024151"
     gene            363519..363602
                     /locus_tag="BSPH_RS01720"
                     /old_locus_tag="Bsph_tRNA18"
                     /db_xref="GeneID:6024152"
     tRNA            363519..363602
                     /locus_tag="BSPH_RS01720"
                     /old_locus_tag="Bsph_tRNA18"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363553..363555,aa:Tyr,seq:gta)
                     /db_xref="GeneID:6024152"
     gene            363626..363699
                     /locus_tag="BSPH_RS01725"
                     /old_locus_tag="Bsph_tRNA19"
                     /db_xref="GeneID:6024029"
     tRNA            363626..363699
                     /locus_tag="BSPH_RS01725"
                     /old_locus_tag="Bsph_tRNA19"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363658..363660,aa:Trp,seq:cca)
                     /db_xref="GeneID:6024029"
     gene            363712..363787
                     /locus_tag="BSPH_RS01730"
                     /old_locus_tag="Bsph_tRNA20"
                     /db_xref="GeneID:6024030"
     tRNA            363712..363787
                     /locus_tag="BSPH_RS01730"
                     /old_locus_tag="Bsph_tRNA20"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363745..363747,aa:His,seq:gtg)
                     /db_xref="GeneID:6024030"
     gene            363832..363907
                     /locus_tag="BSPH_RS01735"
                     /old_locus_tag="Bsph_tRNA21"
                     /db_xref="GeneID:6024031"
     tRNA            363832..363907
                     /locus_tag="BSPH_RS01735"
                     /old_locus_tag="Bsph_tRNA21"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363865..363867,aa:His,seq:gtg)
                     /db_xref="GeneID:6024031"
     gene            363912..363986
                     /locus_tag="BSPH_RS01740"
                     /old_locus_tag="Bsph_tRNA22"
                     /db_xref="GeneID:6024442"
     tRNA            363912..363986
                     /locus_tag="BSPH_RS01740"
                     /old_locus_tag="Bsph_tRNA22"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:363944..363946,aa:Gln,seq:ttg)
                     /db_xref="GeneID:6024442"
     gene            363993..364067
                     /locus_tag="BSPH_RS01745"
                     /old_locus_tag="Bsph_tRNA23"
                     /db_xref="GeneID:6024443"
     tRNA            363993..364067
                     /locus_tag="BSPH_RS01745"
                     /old_locus_tag="Bsph_tRNA23"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:364025..364027,aa:Gly,seq:gcc)
                     /db_xref="GeneID:6024443"
     gene            364076..364149
                     /locus_tag="BSPH_RS01750"
                     /old_locus_tag="Bsph_tRNA24"
                     /db_xref="GeneID:6023236"
     tRNA            364076..364149
                     /locus_tag="BSPH_RS01750"
                     /old_locus_tag="Bsph_tRNA24"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:364108..364110,aa:Cys,seq:gca)
                     /db_xref="GeneID:6023236"
     gene            364197..364280
                     /locus_tag="BSPH_RS01755"
                     /old_locus_tag="Bsph_tRNA25"
                     /db_xref="GeneID:6023237"
     tRNA            364197..364280
                     /locus_tag="BSPH_RS01755"
                     /old_locus_tag="Bsph_tRNA25"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:364231..364233,aa:Leu,seq:caa)
                     /db_xref="GeneID:6023237"
     gene            complement(364865..366160)
                     /locus_tag="BSPH_RS01760"
                     /old_locus_tag="Bsph_0341"
                     /db_xref="GeneID:6024804"
     CDS             complement(364865..366160)
                     /locus_tag="BSPH_RS01760"
                     /old_locus_tag="Bsph_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_012292128.1"
                     /db_xref="GI:501249110"
                     /db_xref="GeneID:6024804"
                     /translation="MKKMKSTLLSLLIAGSVINPVYATAMDSEDSLGNDGGQEKFRVY
                     VEANKKTEKSTLKTQYSARWELTENGFSTDMNEKQFEALQKNKNFTVTKVPIVTLDTI
                     GLEDDSMVENETLDLVTSLRASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNI
                     SHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDA
                     DLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNY
                     AYSKGVLIVAAAGNSGYAQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYIS
                     TAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLS
                     NTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARVQ"
     gene            366290..367516
                     /locus_tag="BSPH_RS01765"
                     /old_locus_tag="Bsph_0342"
                     /db_xref="GeneID:6024805"
     CDS             366290..367516
                     /locus_tag="BSPH_RS01765"
                     /old_locus_tag="Bsph_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator"
                     /protein_id="WP_012292129.1"
                     /db_xref="GI:501249111"
                     /db_xref="GeneID:6024805"
                     /translation="MKMKIGSLIKYYRTKLGMTQNSVAMGICSIPHLSKIENNNKEAN
                     SETIRLLLERLNISIHDVENNEQNIICLLNDLQKHINYLEIDKVKETMSRLKEYEEII
                     GFTESIYLYELYKLRYYVFVKEHKLADNQLKWLNAHRPNFSQHERYLHSYYYALVLIT
                     KGKYEEAAKELTQILQIHPELGSLEGEFYYHFALIKGRLEEPSQAIIYGKKALQFYKD
                     QFNFKRIVYTLMSLALNYSRGKVFHEAIEIYEHLVRNVELLQQQQLLPAIYHNLGDLY
                     QMRWEYENALIYFEKSASLMSKNCDHYLLCLYNLGVTQFRLEQTEKSIKTFTILKEEA
                     KNKKKLSFNLFATFYLYLLGEEKKKAMDFLEGRLIPFIADNEELKEMHQQFSNLLGEY
                     YRQEKQFEKAMQFIEI"
     gene            367951..368982
                     /locus_tag="BSPH_RS01770"
                     /old_locus_tag="Bsph_0343"
                     /db_xref="GeneID:6024806"
     CDS             367951..368982
                     /locus_tag="BSPH_RS01770"
                     /old_locus_tag="Bsph_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012292130.1"
                     /db_xref="GI:501249112"
                     /db_xref="GeneID:6024806"
                     /translation="MNLAWKEMKKNKVRFLILGSIIFLVSFLTFIISGLANGLSQDNA
                     ALIKDLPQGQFYMTEDADGTFNLSRISNNLQQEVMSEEKEAVAFSIQMGFLSDEDDKQ
                     QSVAFVTSTESSLFRNVRQGEVLLDSSLQEKGIKVGDILANNQYSGEFKVKGFVEQKK
                     YSHAPVAYISKEAYQEMYRIQDMQLIFVPHNAAKDFEGLQSYSNKEFLNAIPSYSAEQ
                     MSLNMIIWFLVVISGMLFAIFFYMMNVQKIGLYGILKAIGLKTGRLFNMIWTQMVIIT
                     AISLVLSVSLSQLFNIVAPKGMPFTLNFGTTMQLSLVFLVIGFVGATLSGLQIKKIQP
                     LQAIHQGEA"
     gene            368985..369680
                     /locus_tag="BSPH_RS01775"
                     /old_locus_tag="Bsph_0344"
                     /db_xref="GeneID:6024807"
     CDS             368985..369680
                     /locus_tag="BSPH_RS01775"
                     /old_locus_tag="Bsph_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012292131.1"
                     /db_xref="GI:501249113"
                     /db_xref="GeneID:6024807"
                     /translation="MTLFTIDEVRKTFKNGDVEEEILKGINLSLKEGEITALVGASGS
                     GKSTLLTIAAGLQPATDGQILFEGQNLTTMNEEQVRKLRASKFGFVFQFAHLVPFLTV
                     EEQLLLMLDVAGSPLKKHEQKHEVNRLLQLVGLAHRQDAYPSSLSGGEKQRVAIARAI
                     IHQPKVLFADEPTASLDSQRSKEIMMLLRTLTKTLSITTLLVTHDEEMLAYTDRIIKM
                     SDGVVLQNKQGSH"
     gene            complement(369700..370509)
                     /locus_tag="BSPH_RS01780"
                     /old_locus_tag="Bsph_0345"
                     /db_xref="GeneID:6025017"
     CDS             complement(369700..370509)
                     /locus_tag="BSPH_RS01780"
                     /old_locus_tag="Bsph_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_012292132.1"
                     /db_xref="GI:501249114"
                     /db_xref="GeneID:6025017"
                     /translation="MKKIAVVTGGVSGIGKAICQELITRHIFVIIADIQEQEGRMLEA
                     QLNKDAVHAKFVPLNVTDYNSVASVIHGVIEEYHRIDYLFNNAGIAMYGELGETTIED
                     WKEIMAINLWGVIYGTQLGYSLMKKQGFGHIINTSSAAGLGPSPFSSAYATTKHAVIG
                     LTTSLHYEAEEFGIKVSALCPTFVDTPIFDNAKAIHMDKSIITKQLQQQKMISPQRIA
                     KIAIEGVHQNKPIICPMPMRKTMDVIFTIFPFLHKALMRMVCKVSRNARLT"
     gene            complement(370513..371214)
                     /locus_tag="BSPH_RS01785"
                     /old_locus_tag="Bsph_0346"
                     /db_xref="GeneID:6025018"
     CDS             complement(370513..371214)
                     /locus_tag="BSPH_RS01785"
                     /old_locus_tag="Bsph_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292133.1"
                     /db_xref="GI:501249115"
                     /db_xref="GeneID:6025018"
                     /translation="MKVGLIGDSLTEGRPGVSFYNLLKLQYPHISFDNLGNPGETIKS
                     LFTRLEKTPLQSSYDLLFLWVGVNDVYSKLLKVQAQPVTKDHIEFEEYCLKVLEKAHT
                     ASKNVVLVSPALVGEDLQNHSNNEVKELTSVMESIALKSGNVYFVNMQNLFKEHLEHL
                     DCSSFINTSVMRVLLDVLFYKNPLRIDKLSQKRGLHVTMDGVHLNSKGADIVAQQYSS
                     IIEHYANEGDKIGRS"
     gene            complement(371215..371811)
                     /locus_tag="BSPH_RS01790"
                     /old_locus_tag="Bsph_0347"
                     /db_xref="GeneID:6025019"
     CDS             complement(371215..371811)
                     /locus_tag="BSPH_RS01790"
                     /old_locus_tag="Bsph_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_012292134.1"
                     /db_xref="GI:501249116"
                     /db_xref="GeneID:6025019"
                     /translation="MNKRRYDSDKAKLEIIKHATQLFSQHGYNQTSVGDISKVSGYSK
                     GHIYYHFENKEKLFVLLAQQSMKNWHDKWLQKESSYTTSTEKLYGMALHVLYEYQTPL
                     LKSGQELASNPKSTPESIQQLFNLAITPMNAYRVILQEGIDQNEFVHGDVDTWTVLLG
                     TWLGGLCQLTNTQHLKSLEPLFQQAITIFLKEIKKGGI"
     gene            371974..372333
                     /locus_tag="BSPH_RS01795"
                     /old_locus_tag="Bsph_0348"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6025020"
     gene            372416..373501
                     /locus_tag="BSPH_RS01800"
                     /old_locus_tag="Bsph_0349"
                     /db_xref="GeneID:6025021"
     CDS             372416..373501
                     /locus_tag="BSPH_RS01800"
                     /old_locus_tag="Bsph_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="WP_036160467.1"
                     /db_xref="GI:738204549"
                     /db_xref="GeneID:6025021"
                     /translation="MRNILKLVCLILIAIGIIPREVQAASFKDLTDDTLMTEIHYLVE
                     QDIVKGYSNQLFKPNDYVTKAQVAVMLTRALGLNTINIQNPNYQDVTPANKYYKEIAA
                     VQKKGIFDAAHKFNPDAPLTRAEMAIVLNRAFKLKGSDPYYFTDVTEQTYGYKEILTL
                     AHNHLVRGYENGEFKPNAPVTRAHFSAFLARALTLSKPSLLKDPAFVYTYGYYSLSDH
                     KRYTLSYQYKQHDGKNDVWTVKNISTGQTLSDELLYGHDRVYGQAIASDANTHYDLYM
                     ELPLRIGVILHEDDPGVTAGERVTVKSTNGTVQAGEVQYTGVIIVEKRSVYSDVVKTY
                     YFVDDIGLVKELHNDKVVFELFNRTMK"
     gene            complement(373542..374288)
                     /locus_tag="BSPH_RS01805"
                     /old_locus_tag="Bsph_0350"
                     /db_xref="GeneID:6021648"
     CDS             complement(373542..374288)
                     /locus_tag="BSPH_RS01805"
                     /old_locus_tag="Bsph_0350"
                     /EC_number="2.3.1.118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-hydroxyarylamine O-acetyltransferase"
                     /protein_id="WP_012292137.1"
                     /db_xref="GI:501249119"
                     /db_xref="GeneID:6021648"
                     /translation="MNAQIQQYLQHIQFQGTLEPTVQLLGQLQTKHLLTIPYENLDVA
                     LNLGISFSIPDLFQKIIIERRGGNCFELNILFSWLLRELGFSVTNRYAQFWRNVEEHS
                     PPEDIPMHQLLLVKDAKQSYISDVGVGALAPCKPVPLIAGYQHREGRELYKVEYDEEN
                     GWMLFELTKQQWRLLYCFHDDANDAKFAPRLSKQKNKIAMIRTTRGRHTMMNNEFRIY
                     EGQSLTTYTTNTEKEWLQALQRFFHISLQQ"
     gene            374475..375188
                     /locus_tag="BSPH_RS01810"
                     /old_locus_tag="Bsph_0351"
                     /db_xref="GeneID:6021649"
     CDS             374475..375188
                     /locus_tag="BSPH_RS01810"
                     /old_locus_tag="Bsph_0351"
                     /EC_number="3.5.99.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HUU8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="WP_012292138.1"
                     /db_xref="GI:501249120"
                     /db_xref="GeneID:6021649"
                     /translation="MKWIEVNTYDEMSEVAANIFLKQIQKKPNSVLGLATGGSPVGMY
                     KELVARYQAGQLTFKDVQTFNLDEYVGLKRSSPASYWTFMHNNLFNGVNIKQENIHLP
                     NGEAEDLAAECKAYDARIDAAGGIDLQLLGIGVNGHIGFNEPGTPFDSMTNIVELTES
                     TRTENAIYFDDAADVPIHAITMGIQSIMKAKEIVLIAFGEKKMEAIQKLKSGHITEDF
                     PASQLLKHPNVTIIYGGTN"
     gene            375479..376387
                     /locus_tag="BSPH_RS01815"
                     /old_locus_tag="Bsph_0352"
                     /db_xref="GeneID:6021650"
     CDS             375479..376387
                     /locus_tag="BSPH_RS01815"
                     /old_locus_tag="Bsph_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S66"
                     /protein_id="WP_012292139.1"
                     /db_xref="GI:501249121"
                     /db_xref="GeneID:6021650"
                     /translation="MNVKNTVPRLQKGDLVGVVALSSVVNHEKLGDALSFLDELGLHY
                     IVGDTIHATHDYLAGSDEVRLADFHEMVKNPEVKAIFCVKGGYGSARIAEKIDYTLLE
                     ENPKIFWGFSDITYLHCAINEYANLVTFHGPMLMAANKMDELSKKMFVQLFSPIEIQY
                     TESISPLTTIAGGVARGELIGGNLYRLVSTLGTKFEIQTEGKILLIEELAESIPNIDS
                     MLQQLKQARKIEQLAGVVIGSFTQTEANETALHNLMKEYFGDLGIPVVAGFKIGHEST
                     NVGIPLGVDAYLDAEEKVLKILPGVY"
     gene            376410..376811
                     /locus_tag="BSPH_RS01820"
                     /old_locus_tag="Bsph_0353"
                     /db_xref="GeneID:6021651"
     CDS             376410..376811
                     /locus_tag="BSPH_RS01820"
                     /old_locus_tag="Bsph_0353"
                     /EC_number="3.5.4.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292140.1"
                     /note="Reclaims exogenous and endogenous cytidine and
                     2'-deoxycytidine molecules for UMP synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_031418233.1"
                     /db_xref="GI:670469595"
                     /db_xref="GeneID:6021651"
                     /translation="MDIEKKLYEAAVQLVEKRYPSGWGGAAALYSEDGHILTSVAPEV
                     INAATELCMETGAILEAHKLNTKVTHSICVARENEKSKFVVLTPCGVCQERLFYWGEN
                     VKAAVTNTDDTLLFKTLKEIQPYHWYKAYEQ"
     gene            complement(376859..378445)
                     /locus_tag="BSPH_RS01825"
                     /old_locus_tag="Bsph_0354"
                     /db_xref="GeneID:6021652"
     CDS             complement(376859..378445)
                     /locus_tag="BSPH_RS01825"
                     /old_locus_tag="Bsph_0354"
                     /EC_number="1.11.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_012292141.1"
                     /db_xref="GI:501249123"
                     /db_xref="GeneID:6021652"
                     /translation="MTQKNDSTHDQDTTLTNRQGHPITNNQNLRTVSNRGPATLENYD
                     FLEKISHFDRERVPERVVHARGAGAHGYFETYGVVGNEPISKYTRAKVFQDKGKKTPV
                     FVRFSTVIHGGHSPETLRDPRGFAVKFYTEDGNWDLVGNNLKIFFIRDAMKFPDMIHA
                     FKPDPITNIQNVERFFDFCASSPESFHMVTFVYSPWGIPANYRMMQGSGVNTYKWVNQ
                     EGKGVLVKYHWEPLQGIKNLTQKEAEEIQQKNFNHATQDLYDAIEREEFPEWELHVQI
                     MEDGPHPELDFDPLDDTKLWPNDQFPWYPVGKMVLNKNPEDYFAEVEQATFGTGVLVD
                     GLDFSDDKMLQGRTFSYSDTQRHRVGANYLQLPINAPKKRVATNQSGGQMMYKRDLAP
                     GQNPHINYEPSMLNGLKEATQDGKEYTPYVEGNLVRESIDRQSNTKQAGETYRNFEQW
                     ERDELLANLIRDLSVCHMEIQNAMIALAEEADEEYGRLLKEGLHKARKESSTSKPLGN
                     IDGDQAPQNAIDKGHNAEPY"
     gene            complement(378744..379253)
                     /locus_tag="BSPH_RS01830"
                     /old_locus_tag="Bsph_0355"
                     /db_xref="GeneID:6021102"
     CDS             complement(378744..379253)
                     /locus_tag="BSPH_RS01830"
                     /old_locus_tag="Bsph_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292142.1"
                     /db_xref="GI:501249124"
                     /db_xref="GeneID:6021102"
                     /translation="MINLAEAVKLKSILGKKTQELISELHRSAFVTVEKGQTPKTSNR
                     ALPLIETELAQVRLDTLTLDRLVYEANIQNTVEFKDQKLALVEAIELATQLRAEAELC
                     KEFSMREKESVRFGYGDGAMLYEIALYEPDDYRERAMKLEKEAHKLSNLINSKNYSIQ
                     INFDDSRYF"
     gene            complement(379269..379958)
                     /locus_tag="BSPH_RS01835"
                     /old_locus_tag="Bsph_0356"
                     /db_xref="GeneID:6021103"
     CDS             complement(379269..379958)
                     /locus_tag="BSPH_RS01835"
                     /old_locus_tag="Bsph_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA synthetase subunit beta"
                     /protein_id="WP_012292143.1"
                     /db_xref="GI:501249125"
                     /db_xref="GeneID:6021103"
                     /translation="MEISINESLLTQHPELKIGIIHYTKIVVAESPQMIKGRMQLYQE
                     NLFLDMQDFPVNQREGIAEWRVFWKKLGSDPNRYRHSAESLMRRISKQNYVTPFHSAV
                     DLNNFFSLQYEIPVGLYDIAFMKGYVEIALGHEDIGYEGLNGRFNTFNKILYSRDEKG
                     AFGSPFVDSKRTAVTEDTTEALQIFYLRPSLTHEAANDLLASAGKMFNQIHGGDYQIA
                     LLSNNAPSTSL"
     gene            380018..381151
                     /locus_tag="BSPH_RS01840"
                     /old_locus_tag="Bsph_0357"
                     /db_xref="GeneID:6021104"
     CDS             380018..381151
                     /locus_tag="BSPH_RS01840"
                     /old_locus_tag="Bsph_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster-binding protein"
                     /protein_id="WP_012292144.1"
                     /db_xref="GI:501249126"
                     /db_xref="GeneID:6021104"
                     /translation="MNIHDLQRDFVAYARAIGVDKIGFTTAAPFTELKNRLRRQQELG
                     YQSGFEESDIEKRTEPLQLLNEAESIVSIAVAYPSRMQNAPIGKKGARRGIFCRASWG
                     VDYHTAIRERLKLLSAWLEERVEGVRIESMVDTGALVDRAVAERAGIGWSGKNCSIIT
                     PEFGSYVYLGELITNVPFSPDKPMEDECGECRLCLDVCPTGALIQGGQLDAQRCIAFL
                     TQTKGTLPDEFRNHIGNRLYGCDTCQTVCPKNKGKINWIHDEFIPDPELAKPLLTPLL
                     TISNREFKAKFGHVSGSWRGKKPIQRNAILALAHFKEEAAIPDLINLLKNDDRPVIRG
                     TSAWALGKIGGEQAKSALYDAEANEQDEEVLNEIHKGLQFFHE"
     gene            381219..381692
                     /locus_tag="BSPH_RS01845"
                     /old_locus_tag="Bsph_0358"
                     /db_xref="GeneID:6021105"
     CDS             381219..381692
                     /locus_tag="BSPH_RS01845"
                     /old_locus_tag="Bsph_0358"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_012292145.1"
                     /db_xref="GI:501249127"
                     /db_xref="GeneID:6021105"
                     /translation="MPLHIVLYQPEIPANTGNIARTCAGTNTSLHLIRPLGFSTDDKM
                     LKRAGLDYWHSVNIVYHNSLDDFIEYSRDGDVYLIETYSDEPFTTHDFSNKERDIYFM
                     FGKETTGLPKDFAYERRNMCLRIPQSDHVRSLNLSNTAAIVIYEALRQQGYPGLH"
     gene            complement(381728..382573)
                     /locus_tag="BSPH_RS01850"
                     /old_locus_tag="Bsph_0359"
                     /db_xref="GeneID:6021106"
     CDS             complement(381728..382573)
                     /locus_tag="BSPH_RS01850"
                     /old_locus_tag="Bsph_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_031418236.1"
                     /db_xref="GI:670469598"
                     /db_xref="GeneID:6021106"
                     /translation="MHFHEKPNTYVTNVEIKVSDLQRSLTFYQEVIGFNVLHQESHKA
                     TLTADGHTALLTIVQPDTVEEKLSMTTGLYHFALLLPTRRDLANIITHFHEKGVYLGA
                     SDHAVSEALYLNDPDHNGIEVYADRPENVWDWHQDQVNMVTEPLNIRSILEEGDGNWD
                     GLPSGTVMGHIHLSVSNLAEAEQFYTKGLGYDIVARYGSQALFISTGRYHHHIGLNTW
                     HSENAPKLGENQVGLKTFSLRLDNEEQASMMKANLRTIGARVIDIDGGFQTEDPAGNV
                     VLLKF"
     gene            383224..384054
                     /locus_tag="BSPH_RS01855"
                     /old_locus_tag="Bsph_0361"
                     /db_xref="GeneID:6021912"
     CDS             383224..384054
                     /locus_tag="BSPH_RS01855"
                     /old_locus_tag="Bsph_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxal reductase"
                     /protein_id="WP_012292148.1"
                     /db_xref="GI:501249130"
                     /db_xref="GeneID:6021912"
                     /translation="MYLQSSKTLSNGVEMPRFGLGVYKMTDHEETLQSIDTALKFGYR
                     AIDTASLYGNEAEVGEAIRYSGIPREHIFVTTKVWNNDQGYDETLRAFEVSLKKLKMD
                     YVDLYLTHWAVPETFEETYRAIERLYDEKLIRATGVSNHHEHHLEKILAKANIAPMVN
                     QVEMHPYLQQQALSAYCHEHQIAVTAWSPLGRGGVLDDSTILEISKEIGKTTAQVVLR
                     WHLQNDTLIIPKSVTPSRIEENAQIFDFELTQTQMEKIASLNRNQRFGQDPDHFKFDF
                     "
     gene            complement(384079..384942)
                     /locus_tag="BSPH_RS01860"
                     /old_locus_tag="Bsph_0362"
                     /db_xref="GeneID:6021913"
     CDS             complement(384079..384942)
                     /locus_tag="BSPH_RS01860"
                     /old_locus_tag="Bsph_0362"
                     /EC_number="5.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase"
                     /protein_id="WP_012292149.1"
                     /db_xref="GI:501249131"
                     /db_xref="GeneID:6021913"
                     /translation="MFLYAFNEDNLTIEELLRNHWRLGKKLVHELRMAKAITLENDEL
                     VQWNTPLQVGTIVKFTFPIPASSYKRTPVCAIDIVYEDDHCLIVSKPKGMATHPNDDR
                     DTHTCMNHVMAHIQEQGGIYAEHVHRLDKGTQGLLLVAKHPLAKSIFDRMIEEKSIIR
                     TYAAEVQGNIRSSSGTISESIGKDRHHASRRVVSQTGQHAVTHYEVVSRYKNSCVVHL
                     ILETGRTHQIRVHLAYIGHPIIGDTMYGARETASGDYELHAIQLEFDHPFLNKRITVK
                     DEQSSKNPASQ"
     gene            complement(384997..385422)
                     /locus_tag="BSPH_RS01865"
                     /old_locus_tag="Bsph_0363"
                     /db_xref="GeneID:6021914"
     CDS             complement(384997..385422)
                     /locus_tag="BSPH_RS01865"
                     /old_locus_tag="Bsph_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="WP_012292150.1"
                     /db_xref="GI:501249132"
                     /db_xref="GeneID:6021914"
                     /translation="MSKKEENGLLFIWIVSAVATLGSLYFSEIRHYEPCKLCWIQRIF
                     MYPIVIMATVAFIQKNARIAVTTAVFSVIGGCISLYHYGIQKLSFLADSAPSCGAVSC
                     TGQYINWLGFITIPFLALTAFILIAGASFYLIKATKAVK"
     gene            385606..386721
                     /locus_tag="BSPH_RS01870"
                     /old_locus_tag="Bsph_0364"
                     /db_xref="GeneID:6021915"
     CDS             385606..386721
                     /locus_tag="BSPH_RS01870"
                     /old_locus_tag="Bsph_0364"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012292151.1"
                     /db_xref="GI:501249133"
                     /db_xref="GeneID:6021915"
                     /translation="MKENEHSNISILKEIAELLNEETEIVTMLKGALIKFLNGTNFET
                     GWIFFIDAKGRSELVVHENLPEALEFKNCHYLNKGGCWCVSRYRNEELKKASNIIECQ
                     RIESAIAANVGDHEGITHHATVPLQSGQERFGVLNVASKDTVRFSEEELALLESVAFQ
                     MGSAIKRILLTKQEQEMALVKERNRLARDLHDSVNQLLFSVTLTARAGIEMTQDSDVK
                     ETFKEIQHLTQDALTEMRALIWQLRPKGLENGLLEAIKVYAEMLGLKLHVTVSGVLQF
                     PSRIEETLFRVAQEALNNVRRHAGVLEAALYITVTSTDILLVIRDEGRGFVIDNNTKL
                     LSMGLQSIKDRAKSVGGTADWVSEMGKGTELLIRLPY"
     gene            386734..387381
                     /locus_tag="BSPH_RS01875"
                     /old_locus_tag="Bsph_0365"
                     /db_xref="GeneID:6023139"
     CDS             386734..387381
                     /locus_tag="BSPH_RS01875"
                     /old_locus_tag="Bsph_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_008173403.1"
                     /db_xref="GI:495448709"
                     /db_xref="GeneID:6023139"
                     /translation="MIRVLIADDHHVVRRGLLFFLKTQKDIEVVGEAKNGHEAVSLAE
                     SIQPDIILMDLVMPELDGIQATKRIKAKFPKIEILMLTSFSDRDHVVPAMEAGAAGYQ
                     LKDIEPDELVLSIRRIMRGENTLHPEATTTLEMDRQEAQNAPHSLNPLTPREQDVLAE
                     LTKGKSNREIASSLFVTEKTVKTHISNIFTKLQVQDRTQAALYAVKHGLTEGSGS"
     gene            complement(387435..388556)
                     /locus_tag="BSPH_RS01880"
                     /old_locus_tag="Bsph_0366"
                     /db_xref="GeneID:6023140"
     CDS             complement(387435..388556)
                     /locus_tag="BSPH_RS01880"
                     /old_locus_tag="Bsph_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292152.1"
                     /db_xref="GI:501249134"
                     /db_xref="GeneID:6023140"
                     /translation="MIRAVLIDNEPLALHYFQNKLQVFQQIQVIQTFTSVEVFLNELP
                     SIEFEVLFLEVKLKELSGLEVADMIKTERPHVSVVFITSYHEFALQAYEIGGLDYLLK
                     PISHARLEKTVTRIEHEFSIQQMLQQATQTLLNVQCFDQFAVYSNKSLVAFKTEKTKE
                     LFAYFILHPNIPIHRDYLIEILWPDLDYVRAKSNLHTALSYLRKTLNTIGYENCIVFS
                     NKYYIFEKPSLVCDLYDFQKLHEDFSRLEFPSISLIHQCLAIYKNGLFVFDDYEWAKA
                     YKDRLTKSYIELLEKGFQTTVFSDTDKAIEFLHALLEYDPYNEQKLEHYLYTLIQAGL
                     HEQAHKIFLTYKQKLKEDLALPPSSTLLEISKKLFVESK"
     gene            389128..390054
                     /locus_tag="BSPH_RS01885"
                     /old_locus_tag="Bsph_0367"
                     /db_xref="GeneID:6023141"
     CDS             389128..390054
                     /locus_tag="BSPH_RS01885"
                     /old_locus_tag="Bsph_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292153.1"
                     /db_xref="GI:501249135"
                     /db_xref="GeneID:6023141"
                     /translation="MKLERLLTMIMILINRKKVTAQELAELFNVSVRTIYRDIETLSC
                     AGIPVISQQGVHGGISLIDGYRVDKQVLTKEELASLTIAIKSALTTYEDSHALAVLEK
                     LTSIADDHVTQTIDHLFVDLSPWGPNILFKEHITSLKSAIENRHCVSFTYTTAHGELT
                     KRVVEPHTIVQKGKTWYLYGYCTLRMDFRLFKLARIKNLMQEDLHFERKEINLSELPW
                     GKEWYQPQNVVDLVISFDTAITTLVEESFGVAYVDHGQDKIYISIPEDEWLYGFLLSF
                     GNRIKVLEPPHIRDILQKRAHEIAQLYNPDNS"
     gene            390118..390861
                     /locus_tag="BSPH_RS01890"
                     /old_locus_tag="Bsph_0368"
                     /db_xref="GeneID:6023142"
     CDS             390118..390861
                     /locus_tag="BSPH_RS01890"
                     /old_locus_tag="Bsph_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_036160471.1"
                     /db_xref="GI:738204553"
                     /db_xref="GeneID:6023142"
                     /translation="MMQSYCQSCGMPLTDEALLGTEKEGHKNQDYCTYCYEEGSFKQP
                     NLTVEEMIDICVPHLKGDGMPANEARTMLTSFLPSLKRWRKQEWSEPKIIKREAFQII
                     GISTKTSNANELTAQAKIPQLWQDFYEKNIVDQLSKLDNQNVYGLYSDYETDVNGNYA
                     ITIGVEASKMNDASPEWVIKTIPAAKYLVFTSHKGKMPEIVIQTWQEIWAWFANSKVE
                     RTYTGDFELYDERCANPQEAQVEVYIAIK"
     gene            complement(390880..391788)
                     /locus_tag="BSPH_RS01895"
                     /old_locus_tag="Bsph_0369"
                     /db_xref="GeneID:6023143"
     CDS             complement(390880..391788)
                     /locus_tag="BSPH_RS01895"
                     /old_locus_tag="Bsph_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012292155.1"
                     /db_xref="GI:501249137"
                     /db_xref="GeneID:6023143"
                     /translation="MELYTNLRQGEKGAWLSIGTYLILSSIKLTIGYIGTSEALKADG
                     LNNTTDIIASIAVLIGLRIAQRPPDSNHQYGHLRAETIASLVASFIMLVVGLQVLINS
                     LKSLWAPSGTTPSLLTAFVAIGSGAVMYIVYRYNLALSKKIKSSAVKAAAFDNRSDAF
                     VSIGTAIGIFGAIFGFPIIDSLTALIVAVLIIKTAVEIFGEAVQSLTDAFDIDEVETL
                     SVLIRNVDGVIELLDFKGRAHGNMYFIDITVTVDPYLNVFDSHRITEEIERTILRENR
                     FCQVLVHIEPHIEIIPPQNDEKSPTS"
     gene            complement(391982..393334)
                     /locus_tag="BSPH_RS01900"
                     /old_locus_tag="Bsph_0370"
                     /db_xref="GeneID:6020981"
     CDS             complement(391982..393334)
                     /locus_tag="BSPH_RS01900"
                     /old_locus_tag="Bsph_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009373411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_036160473.1"
                     /db_xref="GI:738204555"
                     /db_xref="GeneID:6020981"
                     /translation="MDGDILEITIRLAAFALLIIMTGFFVATEFAIVKVRTTRIDQLL
                     AEGHKKAKNAKRVVSDLDEYLSACQLGITITALGLGWLGEPTFEIILHPVFEFLNLNG
                     SITSILSFILAFSIVTFMHVVIGELAPKTLAIQKAEFVTLNFSGALILFHNITYPVIK
                     LLNGSARGLTGLFGLKMMSESEVAHTEEELRMILSDSLKGGEINNAEYEYVNSIFEFS
                     DRLAKEIMVPRTEIVGIEKELTIKEVFDLMGVEQYTRYPIIDGDKDHIIGLVNMKHLL
                     TAYIKDSKNGDKPVIDYMQPIIRVMETTQINDLLLKIQRERIHMAILMDEYGGTSGLV
                     TIEDIIEEIVGDIQDEFDEDEIPEVQEIADNHFILDAKMLLENVNDMLGTDIEDDDID
                     TIGGWFMTKRFDAVEGDSIQEQGYEFIAKELDGHHILYLEVLKLPETDLSNEFDAVTE
                     "
     gene            complement(393766..394182)
                     /locus_tag="BSPH_RS01905"
                     /old_locus_tag="Bsph_0372"
                     /db_xref="GeneID:6020983"
     CDS             complement(393766..394182)
                     /locus_tag="BSPH_RS01905"
                     /old_locus_tag="Bsph_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160476.1"
                     /db_xref="GI:738204558"
                     /db_xref="GeneID:6020983"
                     /translation="MSKVTLSDDLNSYHSKALIRVKVKEFFSEFSAKIFELADEAGNL
                     DIKKFEAISGINGDFYNEYCSQLKGFFDSSASTFGKKSIKTMYFTYNGKNYMLTQQGI
                     TEKAPVSIAPFTGDLPLKESFHDVEKACLKLRFQQE"
     gene            complement(394354..394557)
                     /locus_tag="BSPH_RS01910"
                     /old_locus_tag="Bsph_0373"
                     /db_xref="GeneID:6020984"
     CDS             complement(394354..394557)
                     /locus_tag="BSPH_RS01910"
                     /old_locus_tag="Bsph_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418249.1"
                     /db_xref="GI:670469611"
                     /db_xref="GeneID:6020984"
                     /translation="MIQHFSFKPLFENTQLPGWTIAFFYQRERYSAEYLKDGTIQWTG
                     PTPPNEEDVKKMIHELMLFHVYD"
     gene            394746..395888
                     /locus_tag="BSPH_RS01915"
                     /old_locus_tag="Bsph_0374"
                     /db_xref="GeneID:6020985"
     CDS             394746..395888
                     /locus_tag="BSPH_RS01915"
                     /old_locus_tag="Bsph_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HVI2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292160.1"
                     /db_xref="GI:501249142"
                     /db_xref="GeneID:6020985"
                     /translation="MDNFIVTLLFMAIIGAAIGGVTNHLAIKMLFRPHNAIYIKNWRV
                     PFTPGLIPKRRDELAKQLGLTVVNYLLTPETFRKKFFSKDIQEKVEQFVQTKVEETIF
                     TNDKTIQDWLNIAGFSHMPATIEQKVEAIVEGQFASVKNTLSTKSIRTLLSSDMQDTL
                     DAKIPVAVSHILEKGEDYFLSPEGEMTIKAMIDDFLSSKGSFGGMINMFLGDSSSLVG
                     KVQRELVKFLQAPGTSTLLTKIFTQEWEKLKDRPAMDFLQDMQFDPILSKLQMYVKEQ
                     LAVAERLNQPISYYWPEGNEWMKNSVIPQAIDKAFVKAEEKLEDVLKRLNLQEVVREQ
                     VDSFPVEKLEELVLGISKREFKMITVLGAVLGGLIGIVQGLIVNFI"
     gene            395905..396252
                     /locus_tag="BSPH_RS01920"
                     /old_locus_tag="Bsph_0375"
                     /db_xref="GeneID:6021453"
     CDS             395905..396252
                     /locus_tag="BSPH_RS01920"
                     /old_locus_tag="Bsph_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292161.1"
                     /db_xref="GI:501249143"
                     /db_xref="GeneID:6021453"
                     /translation="MVNIYNDINALEATFRKTPEFEALQAAVEVVKSDEEALNVFKNF
                     RKIQIELQKKQLAGEELLEDELVYAQKASQLVQQNEKISAMLEAEMKLSKVIEEVNRI
                     LIKPIQGLYEDIQ"
     gene            396383..397045
                     /locus_tag="BSPH_RS01925"
                     /old_locus_tag="Bsph_0376"
                     /db_xref="GeneID:6021454"
     CDS             396383..397045
                     /locus_tag="BSPH_RS01925"
                     /old_locus_tag="Bsph_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292162.1"
                     /db_xref="GI:501249144"
                     /db_xref="GeneID:6021454"
                     /translation="MYVFIEWTYKTPKGATTVLRSEEMPAAQALLLAEDMEKTGRVKS
                     IHCLDRQDTSWTIKELKTYLKEIDTEPHNIIVYFDGGFDRGTRQAGLGCAIYYEQNGK
                     PYRLRRNAFSSELTSNNEAEYAALYLGVVELELLNVHHLPVQIKGDSQVVINQLRGEW
                     AALEKDLVGWADKIDAKLAQLTIQPDYQLITRKDNSEADSLATQALNGIDITGLSELV
                     KE"
     gene            397164..398072
                     /locus_tag="BSPH_RS01930"
                     /old_locus_tag="Bsph_0377"
                     /db_xref="GeneID:6021455"
     CDS             397164..398072
                     /locus_tag="BSPH_RS01930"
                     /old_locus_tag="Bsph_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper amine oxidase"
                     /protein_id="WP_012292163.1"
                     /db_xref="GI:501249145"
                     /db_xref="GeneID:6021455"
                     /translation="MYMKKLAPVALSALLMGSVMIPVASANEQKDEVEIPQIQIDPVH
                     IFNQTHGTVEDVRVGKDITYYTVKDGEQTNILEITKDTLVYDNTGKKVELKEGDQVVA
                     YTFANKPQKYIYPPQFNPEIIIVDSKEVGFVEVDYFFDDLTNTYDILKLNIGKETELV
                     NAKGKKVTSKDLVEKHLAVFYTASTKSIPAQTTPSKVIVLDDNSEISLSPIDEEINTI
                     IATDYYMVAETTMVPLRSIAEKLGFQVESKGKAVILTKGNESYTITRGEKAFGYNKSL
                     RTLSVAPSLKDTKTYVPVEFIEEYLK"
     gene            complement(398119..398499)
                     /locus_tag="BSPH_RS01935"
                     /old_locus_tag="Bsph_0378"
                     /db_xref="GeneID:6021456"
     CDS             complement(398119..398499)
                     /locus_tag="BSPH_RS01935"
                     /old_locus_tag="Bsph_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292164.1"
                     /db_xref="GI:501249146"
                     /db_xref="GeneID:6021456"
                     /translation="MFLLKNNKRPFISSFIHQVEVAFHHFDLARCDEKTLYVTVLFKY
                     GTHNVICDFIYIIDQQDMYGAISINKHYEKARAFVKQHFQQLLLYSDEMILANNFMNT
                     VSFKYCLQQFVKRYPTFNSSKIVS"
     gene            398674..400179
                     /locus_tag="BSPH_RS01940"
                     /old_locus_tag="Bsph_0379"
                     /db_xref="GeneID:6021457"
     CDS             398674..400179
                     /locus_tag="BSPH_RS01940"
                     /old_locus_tag="Bsph_0379"
                     /EC_number="1.3.99.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292165.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_012292165.1"
                     /db_xref="GI:501249147"
                     /db_xref="GeneID:6021457"
                     /translation="MKMIHIDQKYPEDWIRVLNHIANLFFEDSKLRVEPEEADMSVSF
                     TYDVEENFTISTKAILTVDGQQYTNNYSIQYESAATGRELNIRMKRALSHVFLDVLEQ
                     HTGVHQQWGILTGVRPTKLYHKFRKEGKGEQEIAELLIRDFRLSEEKVALLKDIVERQ
                     LVTIPDIDQIGQEISVYIGIPFCPTKCAYCTFPAYAIGSNRKQGRVNTFLDGLHIELR
                     EMGKWLKNNNMKITSIYWGGGTPTSIEADEMDALYQTMYESFPNPETIREITVEAGRP
                     DTITPEKLEVLKKWGIDRISVNPQSYTDETLKAIGRHHTVQETIDKFWLARESGMNNI
                     NMDLIIGLPNEGIEEFQHSLVESAKMQPESLTVHTLSFKRASEMTRNKDKYKVADRDT
                     VAEMMQMAQDWTKENDYVPYYLYRQKNILGNLENVGYSKAGEESIYNIVIMEEVQTIL
                     GVGCGASSKFVHPETGKITQFHNPKDPAAYIMTFEEAIGKKIEFLDELYKI"
     gene            complement(400217..401296)
                     /locus_tag="BSPH_RS01945"
                     /old_locus_tag="Bsph_0380"
                     /db_xref="GeneID:6023701"
     CDS             complement(400217..401296)
                     /locus_tag="BSPH_RS01945"
                     /old_locus_tag="Bsph_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012292166.1"
                     /db_xref="GI:501249148"
                     /db_xref="GeneID:6023701"
                     /translation="MLTKKLADEIVHQTMLRLRHNINVISPTGVILASGDKMRVEDIH
                     EGAVYVAQTKKTLIINEDNIELYPNTKPGINMPILYQDEVVGVIGITGDSEEMLEIAN
                     LVQLTTEIMTHQALVESKSEWQRKNNDYIFEALVHGSKLDATLNKRIQKLPFSLIAPF
                     QVILVSLHETSYLENRMPFFFEDLFYRQPILAGHSQLQEYYILLTYRQEQNYQSIIKA
                     LRKKKQKLPSLQIGIGPVVQQLSQLPYSYQGARTALEFATIHNEITFFEDVELFSLFK
                     HRESEEVQAFHHRILKNINAKQLETLQSFFDCNLQLKLCAQQLNIHRHTLTYRLNKIR
                     ELTGYDPQYFEDAVILQMACTLRTL"
     gene            401462..402601
                     /locus_tag="BSPH_RS01950"
                     /old_locus_tag="Bsph_0381"
                     /db_xref="GeneID:6023702"
     CDS             401462..402601
                     /locus_tag="BSPH_RS01950"
                     /old_locus_tag="Bsph_0381"
                     /EC_number="2.7.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="WP_012292167.1"
                     /db_xref="GI:501249149"
                     /db_xref="GeneID:6023702"
                     /translation="MKIIISPDSFKGTLSAVEVAKSMQQGILDVNPSIETIILPVADG
                     GEGTLDSLIASTGGQYFSTEVLDPIGRDIQAQYGVLGDKETCVIEMAQASGIMLLQDH
                     EKNPEFATTYGTGQLIKAALDRGFRKFIIGIGGSATNDAGIGMLKALGVRFIKEDGSD
                     LEDGISSLMELTAIDISGLDERLIGAIFTIACDVDNPFIGERGATAIFGPQKGVQDYQ
                     ITHFDNCLKHFADIIEQQFAIRLHDYQGAGAAGGLGGALIAFLNGTFHAGIDIVIDAV
                     QLQDHLAAAQLVITGEGKSDLQTLHGKAPLGVAKAAALAHVEAVLLSGDIDSMAKPAL
                     QNYFSVVETLVDEEITTEQAMREPAYFIRLKTKQIFELYIQKGDD"
     gene            402602..403948
                     /locus_tag="BSPH_RS01955"
                     /old_locus_tag="Bsph_0382"
                     /db_xref="GeneID:6023703"
     CDS             402602..403948
                     /locus_tag="BSPH_RS01955"
                     /old_locus_tag="Bsph_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate transporter"
                     /protein_id="WP_012292168.1"
                     /db_xref="GI:501249150"
                     /db_xref="GeneID:6023703"
                     /translation="MLFIIILLGVLFVVWGTAKLKLHPFLALLISAFFVGIASGMPLL
                     TVVESINTGFGGLMTSIGLVIIAGTIIGLILEKSGAAYRMAEVVLRIVGPKRPQLAMS
                     LIGYIVSIPVFCDSGFIILSSLQKSLAKRANVTIASMAVALATGLFATHVLVPPTPGP
                     IAAAGNIGAANYLGTVIVIGLLVAIPATFVGYMWSVKVATKIRVPQDEVEALDYEEVI
                     KSFGKMPSTFKAFLPIVLPIVLIGLGSIASLAGDPESTFNTIFKFLGSPTVALFLGVA
                     AAFLLLPEISETTLTGWIGESLKEAAPILLITGAGGSFGTVIKNAGVGEILQEMDLGM
                     FASGTLFLLVPFIVAAALKTAQGSSTTALVITSTLVAPMLVTLGIEGAVPLALVVMAI
                     GAGAMTVSHVNDSFFWVITQYSGMEVTQAYKAQTVATLLQGIVTIMITMVLWWIFV"
     gene            404021..405199
                     /locus_tag="BSPH_RS01960"
                     /old_locus_tag="Bsph_0383"
                     /db_xref="GeneID:6023704"
     CDS             404021..405199
                     /locus_tag="BSPH_RS01960"
                     /old_locus_tag="Bsph_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein"
                     /protein_id="WP_012292169.1"
                     /db_xref="GI:501249151"
                     /db_xref="GeneID:6023704"
                     /translation="MRKLIVVLLCIFLLAGCTEAIKTERVPVTAGDEMRVHFMDVGQG
                     DSILIESPNGKTMLIDAGVKGAGQQVVSYLKELGVNKLDKVVATHPDADHIGGLIPVL
                     HAIPIEQFYDSGKVHTSQTFEEMLMAIDEKNIPYYVPKTGDFIEFDKDVTVKVLNANE
                     HATDNNDASIVLKVVYGNVSFLLTGDAGIALEKEMMSNDVTATVLKAGHHGSNTSSSE
                     DFIRAVKPEVTILSYGEDNKYGHPHAEVVNRLQAIGSNIYATADLGTITVATNGVNYT
                     VNGKRAVTQKKPSTVEPTTAVEIVSKDLVTEIVGIKNNGQQAVSLNDWQLISLEGNQV
                     FNFPNLSLQPGKIIYVTSGANAREGDNYLKWTTKQIWLNDGDAAQLRNEKGELVSELD
                     "
     gene            405186..405434
                     /locus_tag="BSPH_RS01965"
                     /old_locus_tag="Bsph_0384"
                     /db_xref="GeneID:6023705"
     CDS             405186..405434
                     /locus_tag="BSPH_RS01965"
                     /old_locus_tag="Bsph_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292170.1"
                     /db_xref="GI:501249152"
                     /db_xref="GeneID:6023705"
                     /translation="MSSTKYTLDRIEDGYAVFLKYPEEEEQIIILQSALNKPVLVGDR
                     VQIEEIDGMYHIEILREETEQKRADIQNLMDRLRHKNK"
     gene            405627..406415
                     /locus_tag="BSPH_RS01970"
                     /old_locus_tag="Bsph_0385"
                     /db_xref="GeneID:6022543"
     CDS             405627..406415
                     /locus_tag="BSPH_RS01970"
                     /old_locus_tag="Bsph_0385"
                     /EC_number="3.1.3.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_012292171.1"
                     /db_xref="GI:501249153"
                     /db_xref="GeneID:6022543"
                     /translation="MSINTIIFDLDDTLLWDKKSVKTAFEKTCDYAATIHNVNSAELE
                     EAVRQEARALYEGYETYDYTVLIGINPFEGLWGTFDDPTESFQAMKRLVPGYRAAAWT
                     KGLSALGIEDAKFGAELGERFVAERKASPFLYEDTFTVLDELKGKYQLVLLTNGAPSL
                     QNLKLEITPEIAPYFDHIIISGDFGKGKPDASIFEHVMERTGITADDAIMVGDNLNTD
                     ILGSSRVGMRNVWINRDNNMANGAVTPTYEISSLTDLVKLVKQL"
     gene            complement(406572..408179)
                     /locus_tag="BSPH_RS01975"
                     /old_locus_tag="Bsph_0386"
                     /db_xref="GeneID:6022544"
     CDS             complement(406572..408179)
                     /locus_tag="BSPH_RS01975"
                     /old_locus_tag="Bsph_0386"
                     /EC_number="1.1.1.95"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292172.1"
                     /note="catalyzes the formation of 3-phosphonooxypyruvate
                     from 3-phospho-D-glycerate in serine biosynthesis; can
                     also reduce alpha ketoglutarate to form
                     2-hydroxyglutarate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_012292172.1"
                     /db_xref="GI:501249154"
                     /db_xref="GeneID:6022544"
                     /translation="MITATKTINVFIADPLSEDGIFPLRQEQDLDLNIIVDTGLAPEE
                     LMTKIADVDVLLVRSQTTVTREVIEAAKSLKLIGRAGVGVDNIDLTAATEHGIIVVNA
                     PDGNTNSAAEHTIAMMTSLARHIPQAFNTLKNGKWDRKSYVGVELKNKTLGVVGFGRI
                     GVEVAYRAKGQRMNVMAYDPFLTDERAKELGVTKASVEEICEAADFITVHTPLLPETR
                     NLINKEKFAMMKDGVRIINCARGGIINEDDLYDAIVAGKVAGAALDVFVSEPATDHKL
                     LTLPQVIATPHLGASTIEAQESVAVDVSNDIIKFYKTGTVTNPVNMPSIPKELLAQVE
                     PFFELAEKLGSFLSQVTTEPVKEINLSYAGEVANYDVRPLTSNALKGLLAKNHGNHVN
                     DVNARYLSERIGMKIIEHKTTTAKGFTSLITIEIITANETHTVAGTLLNGLGARIVKV
                     EDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKDINIATMQVGRAQVGGTAVMMLT
                     IDNVVTNEDLAFVAQLENIDEVKAINL"
     misc_feature    complement(408338..408578)
                     /note="T-box leader; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            408982..410631
                     /locus_tag="BSPH_RS01980"
                     /old_locus_tag="Bsph_0387"
                     /db_xref="GeneID:6022545"
     CDS             408982..410631
                     /locus_tag="BSPH_RS01980"
                     /old_locus_tag="Bsph_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292173.1"
                     /note="proposed role in polysaccahride synthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="WP_012292173.1"
                     /db_xref="GI:501249155"
                     /db_xref="GeneID:6022545"
                     /translation="MKYDVAIVGAGLAGLVAACELVDAKKKILLVDQEPENSMGGQAF
                     WSFGGIFLVNSPEQRRLGIKDSKELAWQDWLGTAGFDRLEDEDSWAYKWARAYVDFAA
                     GEKYHWLKSKGIKFFPVVGWAERGGSHAGGHGNSVPRFHIVWGTGPGIVKPFVDKVKK
                     AIKDGYIEFKPRHRVDEFIQQDEKIMGISGTVLAETFISRGEKSSRLGVGEFSYEAAA
                     VIVASGGIGANFDLVRKNWPERLGTPPKNMVCGVPAYVDGRMLEITEHAGGRIVNRDR
                     MWHYTEGLKNWDPIWPNHGIRILPGPSSLWFDAEGNRFHAPNFPGFDTLSTLETIQKT
                     GYDYSWFILTEKIIEKEFALSGSEQNPDLTNKSIGDVLKRIMPGPPAPIQAFKNHGED
                     FVIANDLRELVNGMNKLAGNDLLDFMKIKEQILARDREMDNKFTKDIQVNAIHGARNY
                     IGDKLIRVAKPHKILDTKNWPLIAVRLNILTRKTLGGLQTNLNGAVLGMDGQPIPGLF
                     AAGEVSGFGGGGVHGYRALEGTFVGGCLFSGRQVGRFLAEV"
     gene            complement(410698..411669)
                     /locus_tag="BSPH_RS01985"
                     /old_locus_tag="Bsph_0388"
                     /db_xref="GeneID:6022546"
     CDS             complement(410698..411669)
                     /locus_tag="BSPH_RS01985"
                     /old_locus_tag="Bsph_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_012292174.1"
                     /db_xref="GI:501249156"
                     /db_xref="GeneID:6022546"
                     /translation="MTQKDYRILLYYKYVTIEDPIAFAEEHLAVCQELGLLGRILVGH
                     EGINGTVSGTIEQTDAYMNHMKADPRFSDIMWKIDEAEGHAFKKMHVRPRREIVHLGL
                     ENDINPLEITGDYLSPKEFMEQMQEENTIIIDARNDYEYDLGHFRGAVRPDIENFRDL
                     PAWMETHKEEFTDKKILTYCTGGIRCEKFSGWLKREGYGKSVGQLHGGIATYAKDSEV
                     KGQLWDGQMFVFDRRRSVPINQVEHIVIGKDYFTGEPSERYTNCANPECHKLMLCEEK
                     HEAFYMRSCSDECRRAKRNFFVEEHGWTVHQIEEQIARIAVVQNAKS"
     gene            411809..412591
                     /locus_tag="BSPH_RS01990"
                     /old_locus_tag="Bsph_0389"
                     /db_xref="GeneID:6022547"
     CDS             411809..412591
                     /locus_tag="BSPH_RS01990"
                     /old_locus_tag="Bsph_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_036160480.1"
                     /db_xref="GI:738204562"
                     /db_xref="GeneID:6022547"
                     /translation="MEFSTITVEKLDRRATLTLNRPQAMNAMDDVMMRELAECFEALQ
                     QEKDIQVLVIRGEGKVFSAGGDIKTMLDSTKPLNIDEAMGYLTRIVKAYYQLPMIVIA
                     AVHGASAGLGFSLTLGADIVVACENSKLAMNFIGIGLIPDGGGHFFMKERVGTVKAKQ
                     MIWEGKVLTANEALDAGLIDYMAPDGTVFAMADQLVGKMLASPISSMITTKNILHAQN
                     LPQLENILALEAEGQSTMRKTTDHIEGIHAFVEKRTPVFVGK"
     gene            complement(412638..412823)
                     /locus_tag="BSPH_RS01995"
                     /old_locus_tag="Bsph_0390"
                     /db_xref="GeneID:6022787"
     CDS             complement(412638..412823)
                     /locus_tag="BSPH_RS01995"
                     /old_locus_tag="Bsph_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008173354.1"
                     /db_xref="GI:495448660"
                     /db_xref="GeneID:6022787"
                     /translation="MENYRFTAFEKTGETLFDETWTFENDEAAKLNGQQQIEEKGVAN
                     KTHRLVNASGKLILFHV"
     gene            413092..414306
                     /locus_tag="BSPH_RS02000"
                     /old_locus_tag="Bsph_0391"
                     /db_xref="GeneID:6022788"
     CDS             413092..414306
                     /locus_tag="BSPH_RS02000"
                     /old_locus_tag="Bsph_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292176.1"
                     /db_xref="GI:501249158"
                     /db_xref="GeneID:6022788"
                     /translation="MSEIRFFHMADLHLDSPFKGLFGLPEHILKEIRSSTFDAFDKII
                     QKAIQEQPDFLLIVGDIYDGENRSLQAQRKFQDAMEKLFQHNIPVIISYGNHDHLKGT
                     WTRFSLPSNVYELPAETSVVQLKIRGQQVCIYGFSYSERHLKESVIDTFPIAQDSHAI
                     HIGMLHGSEASDTSHALYAPFTKQQLLEKNYHYWALGHIHKRQLLHENPPIVYPGNIQ
                     SRHRKEQGIKGCYDVTLSQTACELDFIPTSAIVYTTIEVDCTNIVHANELLKRCEEAI
                     AVNRTSWGAAVVELYLKNIDEQTEALFEHATVDTWLDTIREAEEGIEPMCWVQKMVLQ
                     KPSIHGEYSAATQSVVSLMEQWDSNDWKDILKDLYQYAGGARLIEPLSEKDIKNLTHN
                     AQSLLAEEIQRA"
     gene            414312..417200
                     /locus_tag="BSPH_RS02005"
                     /old_locus_tag="Bsph_0392"
                     /db_xref="GeneID:6022789"
     CDS             414312..417200
                     /locus_tag="BSPH_RS02005"
                     /old_locus_tag="Bsph_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160485.1"
                     /db_xref="GI:738204567"
                     /db_xref="GeneID:6022789"
                     /translation="MLTIKKLQIYGFGKHENVTIPLNEGVTIFYGLNEAGKTTIQQFV
                     LQMLFGFPTRQQTQRKYEPKASTKFGGQLTLLHPIYGSCIIERVKGKAAGDVTVYLED
                     GTTGQEELLAKLLYGYSRASFESIFSFSLHELQGIEKMSEEELTHLLLSSGTTGIQHL
                     SALEKKMDKEANELFKKTGKVPVINQKIEQLKQLERMIRHEQGKIQTFENKLQQLQLL
                     EQNLEKLYATQKKQQQQWQYLTVQKQALPLIKQQQMLQQALGNDPHVQFPAEGVRRYE
                     QVKDRLLHESQQLLQLKEQYQLLQDKVLATVNEQTVNEMGRLMQKEATWHQLIVKEKN
                     LRDDLFMLEQEIDAQFRLLGVQEKEAQNILLGETVSLQQEQQFQQQLKRLEEAEDELK
                     FHLHSLEQVHQALDAITQQKQRLKQESLTKEEEHILAQWPQQKRRLEQLRAAKSQRTK
                     QRQPNYFSLMILLIGLLSFVYGIFQKNVAVAIIGAILTIITIWLIKFVRPATETSDKE
                     NSHLLRQLEQDEMTVQTILLKKQRLEDRWLHVHEQQSEKEQQYAQLEYKIQQAELESE
                     ETTQSLQQFLKRYRLQGTIARTLMPELFMRIRSVQELAVKREGSISLLQEVQDEKNSL
                     YEQLQLVLNENYNEHEIYMYLRTAYLDAQQQQQQVQQAQAQLADIKIKLQSGQTRIDR
                     YTADMMQLLNEAEVQNEQAFYERYEQFEHQRKIMTELQTVQAQIASLDLSENVGLKED
                     SVIEDMRVLEQEQASLQMDIDRCLEHRAALQIEKEQLLNDEKYGQLLQEFEQEKSELQ
                     QMIEHWATKKAVATAIHETLFRLREEKLPHVLSKVNAIFQLLTGGRYVQLTIHDEGYF
                     MAQDVAGIRYQMVELSQATKEQAYIALRLALAQTLITSAPFPIIMDDPFVHFDRNRTD
                     KMVQLMKEVGYERQILYFTCHDEMLKHWPKEQIIDVGALANERGVAST"
     gene            417197..418135
                     /locus_tag="BSPH_RS02010"
                     /old_locus_tag="Bsph_0393"
                     /db_xref="GeneID:6022790"
     CDS             417197..418135
                     /locus_tag="BSPH_RS02010"
                     /old_locus_tag="Bsph_0393"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292178.1"
                     /note="catalyzes the exonucleic cleavage of mRNA yielding
                     nucleioside 5'-phosphates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exoribonuclease"
                     /protein_id="WP_012292178.1"
                     /db_xref="GI:501249160"
                     /db_xref="GeneID:6022790"
                     /translation="MKGITTLQVGESVDQYLLIKQATKGVTTVGKPFMSLILQDKSGD
                     IEAKLWDTNEDHEKMYHAEAIVRVGGEIHDYRGKNQLRIKAIRVAKPEEGVAIHDLVP
                     SSATPKEQLFEELNQFFFDIKNPNISRITRAAIKKHQDAILVFPAATKNHHDYASGLL
                     DHMVSMLKLGKAIADLYPTLNRDLLYAGIILHDIGKVVELSGPVATTYTVEGNLLGHI
                     TIMVNEIAKIANELEIEGEEVMLLQHMVLSHHGKEEWGSPKKPMVQEAEILHYIDNID
                     AKMNMLTRALGKTAPGEFTERLFPLDNRSFYKPTID"
     gene            complement(418480..418797)
                     /locus_tag="BSPH_RS02015"
                     /db_xref="GeneID:23319636"
     CDS             complement(418480..418797)
                     /locus_tag="BSPH_RS02015"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160488.1"
                     /db_xref="GI:738204570"
                     /db_xref="GeneID:23319636"
                     /translation="MKKGKLFASILATTTFLFSGAIMPSAEASQVKITPSTSTVENTI
                     TPYSSTYTLRLKMEWAGRYPSPSYINHNSSLGSGILYLQTSYYDANTNMTIAWYEGLV
                     TKP"
     gene            complement(419502..420461)
                     /locus_tag="BSPH_RS02020"
                     /old_locus_tag="Bsph_0395"
                     /db_xref="GeneID:6023219"
     CDS             complement(419502..420461)
                     /locus_tag="BSPH_RS02020"
                     /old_locus_tag="Bsph_0395"
                     /EC_number="5.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_012292180.1"
                     /db_xref="GI:501249162"
                     /db_xref="GeneID:6023219"
                     /translation="MKKTVLSLTLAASVLALGACSGGDSKAIVTSKVGDISVADFNEK
                     AKSLTGPYVLQQMVTEKVLSDKYEVTDKEFKEAYDVTASQFGDSFSQALAESGLTEEG
                     FKDSLRVQLLQEKALKDQAIKEEDVKKYYEQMKTELNGRHILVADEKTAKEVIAKIKG
                     GAKFADVAKEYSTDTGSAEKGGELGWFSVGSMVDEFNDAAYALELNTLSEPVQTSFGY
                     HVIEITDKRDVKDVGSFKDEEENIRTAMLGKLKQTGEDQVILKDIIAKMAKDANVRTP
                     DKNLKQSLEFFTTTSEEQAKATEEAAKKAESEDKAEDTDKESN"
     gene            complement(420888..421073)
                     /locus_tag="BSPH_RS02025"
                     /db_xref="GeneID:23319637"
     CDS             complement(420888..421073)
                     /locus_tag="BSPH_RS02025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008173337.1"
                     /db_xref="GI:495448643"
                     /db_xref="GeneID:23319637"
                     /translation="MLLMIVVLFSVFYLFQINRMTYALCMRREIPEENQPKIFRTINI
                     LITILLVSFYIEILYAV"
     gene            complement(421144..421689)
                     /locus_tag="BSPH_RS02030"
                     /old_locus_tag="Bsph_0397"
                     /db_xref="GeneID:6023221"
     CDS             complement(421144..421689)
                     /locus_tag="BSPH_RS02030"
                     /old_locus_tag="Bsph_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292182.1"
                     /db_xref="GI:501249164"
                     /db_xref="GeneID:6023221"
                     /translation="MHCWKILNLEHHYGTTRIIIMGVITFLSVFSVSYVTFNLFNEEH
                     YTDHLFWLFVIAVLTLYPVHKFLHFLALYDLRQHLKLRVRTQFYLIPVVHMRIHEPLS
                     KNRYILALLTPFIVLNTSIIIGTWLLPAYTHYGTLLLAYHCSLCLIDILYVKYLLNSP
                     KNSQIEETPKGYEILVPPTVH"
     gene            complement(421865..422425)
                     /locus_tag="BSPH_RS02035"
                     /old_locus_tag="Bsph_0398"
                     /db_xref="GeneID:6023222"
     CDS             complement(421865..422425)
                     /locus_tag="BSPH_RS02035"
                     /old_locus_tag="Bsph_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HVK6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_008173331.1"
                     /db_xref="GI:495448637"
                     /db_xref="GeneID:6023222"
                     /translation="MVLSEELYTQKEAMLYSQRIAQLSKALWKAVEKDWQQWIKPYDL
                     NINEHHILWISYHLKGASISDVAKFGVMHVSTAFNFSKKLEERGFLKFSKRDDDKRNT
                     YVELTEAGTELIVEMNKNYHNTYHSVLEGSLALKDLYGRFPDFLDVMAVIRNIYGEDF
                     IDIFERSFQHFRDSFDTLEERPTVKG"
     gene            complement(422583..422977)
                     /locus_tag="BSPH_RS02040"
                     /old_locus_tag="Bsph_0399"
                     /note="gas vesicle protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6023223"
     gene            complement(423109..423646)
                     /locus_tag="BSPH_RS02045"
                     /note="tryptophan transporter; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319638"
     gene            complement(423795..424208)
                     /locus_tag="BSPH_RS02050"
                     /old_locus_tag="Bsph_0403"
                     /db_xref="GeneID:6023351"
     CDS             complement(423795..424208)
                     /locus_tag="BSPH_RS02050"
                     /old_locus_tag="Bsph_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein hit"
                     /protein_id="WP_012292187.1"
                     /db_xref="GI:501249169"
                     /db_xref="GeneID:6023351"
                     /translation="MSDCLFCKIIDGSIPSTKVYEDEHVYAFTDISPVAKGHTLLIPK
                     HHCQDLYEMPEDVARNLYAVAPKIANAIKAAFEPIGLNTINNNGAAAGQTVFHYHLHF
                     IPRYDEKEGLGLVWQTQKYSPEQLADVAENIKAHL"
     gene            424313..425063
                     /locus_tag="BSPH_RS02055"
                     /old_locus_tag="Bsph_0404"
                     /note="multidrug ABC transporter ATP-binding protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6023352"
     gene            425047..426228
                     /locus_tag="BSPH_RS02060"
                     /old_locus_tag="Bsph_0405"
                     /db_xref="GeneID:6023835"
     CDS             425047..426228
                     /locus_tag="BSPH_RS02060"
                     /old_locus_tag="Bsph_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein EcsB"
                     /protein_id="WP_036160494.1"
                     /db_xref="GI:738204576"
                     /db_xref="GeneID:6023835"
                     /translation="MKNLRDVWSSRFMHYIGEVQKYMQFIFTGHIAIVLVFLIGAGGY
                     QYSEWLKVVQTDFPAEILIAVFIGILLAFSRPTTLLREPDQVYLLPLESKMSHYFSKA
                     LAWTFWSQVWIVAIVYIVSIPLLKAVTDLTTIEIWSIFILVIVLKYISVRGEFSYRYS
                     ERGQMVWVDRLIRAIIFAAAVYMGLQAQLLLTIVATVISIIYMIVFRKKSVGEPVPYE
                     HFVKLEQNRMMSFYRFANYFTEVPHLHGSIRRRGWMDWLYKFVPYGKKNSQKYLVFRT
                     FVRTDDHFYLWLRLTAIAGVIAAFVDIPIVTWIVAGALSFATTIQLKQALLSSGEFRM
                     DMLFPLPDNARQLAVKQIVRLAMVTQAIIVGLCAITQPMFYIVVVIVLVISELTAKVS
                     K"
     gene            complement(426287..426802)
                     /locus_tag="BSPH_RS02065"
                     /old_locus_tag="Bsph_0406"
                     /db_xref="GeneID:6023836"
     CDS             complement(426287..426802)
                     /locus_tag="BSPH_RS02065"
                     /old_locus_tag="Bsph_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292190.1"
                     /db_xref="GI:501249172"
                     /db_xref="GeneID:6023836"
                     /translation="MNIYLTSGTGDFLEQLKNKYPNEHMILIHGEGNSVLIHETEGKS
                     VFATPRKFEVLDSVNELEEHGFFVLNNIPVTDEGRPVFEHRFLQRSHAIEDEPGFESY
                     RLLRPIKSDTYIVMTQWHGPHSFEAWKSSKAFEKAHAKRDDSTGVNQQNIFSAASYVT
                     TYSAMPKEQSE"
     gene            427221..428270
                     /locus_tag="BSPH_RS02070"
                     /old_locus_tag="Bsph_0408"
                     /db_xref="GeneID:6023838"
     CDS             427221..428270
                     /locus_tag="BSPH_RS02070"
                     /old_locus_tag="Bsph_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_031418282.1"
                     /db_xref="GI:670469644"
                     /db_xref="GeneID:6023838"
                     /translation="MTTFNDTLLRAARGEKTTHTPVWYMRQAGRSQAEYRAIKEKYSL
                     EEITHQPELCAYVTRLPVENYNVDAAILYKDIVTPLPGIGIDVKIKAGVGPVISNPIR
                     SVADVDNLGEFNAKEHTPFVLETIKILTEEQLNVPLIGFAGAPFTLASYMIEGGPSRN
                     YNKTKSFMVSEPQAWFALMDKLADMIIADVTAQIKAGAKAIQVFDSWVGALNVEDYRV
                     FIKPIMTRIFAELQKENVPLIQFGVGASHLAKEWNDLPIDVVGLDWRLPIKEARTNGI
                     TKPVQGNLDPSLLLADWSVIEKRTKDIIDQGLEMPGHIFNLGHGVFPEVDPAVLKRLT
                     TLIHEYSAQQIQARS"
     gene            428418..429338
                     /locus_tag="BSPH_RS02075"
                     /old_locus_tag="Bsph_0409"
                     /db_xref="GeneID:6023839"
     CDS             428418..429338
                     /locus_tag="BSPH_RS02075"
                     /old_locus_tag="Bsph_0409"
                     /EC_number="4.99.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016994887.1"
                     /note="protoheme ferro-lyase; catalyzes the insertion of a
                     ferrous ion into protoporphyrin IX to form protoheme;
                     involved in protoheme biosynthesis; in some organisms this
                     protein is membrane-associated while in others it is
                     cytosolic; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_012292193.1"
                     /db_xref="GI:501249175"
                     /db_xref="GeneID:6023839"
                     /translation="MKEVKGLLVMAYGTPYKEEDIEPYYTHIRHGRKPSEEHLEDLRS
                     RYEAIGGLSPLAAATQAQAEALCSRLNEVQDTVEYKLFIGLKHIHPFIEDAIEQMVAE
                     GIKEAVSIVLAPHFSTFSIKSYNGRAVEAAGDRLTITSVESWYDEPKFIEYWKQQVND
                     TFKSMSEEERETACLIVSAHSLPEKIKDLGDPYEDQLIETARLIQEATDLKNVEVGWQ
                     SAGQTPEPWIGPDVQDLTRELYEEKGFRSFVYTPVGFVTEHLEVLYDNDFECKVVCDE
                     LGAKYYRPSMPNTHPLFIDAMVDAIYKKLS"
     gene            429353..430774
                     /locus_tag="BSPH_RS02080"
                     /old_locus_tag="Bsph_0410"
                     /db_xref="GeneID:6024747"
     CDS             429353..430774
                     /locus_tag="BSPH_RS02080"
                     /old_locus_tag="Bsph_0410"
                     /EC_number="1.3.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173311.1"
                     /note="catalyzes the formation of protoporphyrin IX from
                     protoporphyrinogen IX; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_012292194.1"
                     /db_xref="GI:501249176"
                     /db_xref="GeneID:6024747"
                     /translation="MMLVTQKRRKVVVVGGGITGLTAAFYMQKQASTKELPLDIVLVE
                     SSLRLGGKIQTLRKDGFIIERGPESFFDRENYVNALAKDLGIEQKIMTSNAGPNYVAV
                     GSQLYPIPSHLLSGETPHISSFITSGLFSLSGKVRAAGDFFIPRSVQDDDQPLGSFFR
                     RRFGAEVVENLVEPLLAGTFAGDIEQLSMSSTFPQLYHLEQKYRSLLVGMKKAGTNFL
                     SNDVIDENKGIFQTFSNGLETLIESIEESLLPGTVMKGVKVEEIEHGKDGSVHVMLNN
                     FTHIKADAVIIATPFNMADKMFSKYNLLNELGTMKAATIATVTMAFKKEQLGDLDALS
                     FYVSRNSDFSITSCTWMNRKWPGTTPDDYVLLRSYIGRVGDEAIVALSDTEIEKTVLQ
                     DLNKTISIDGEPVTTVVTRWRNAMPQYTVGHEAKVQRIKQELREHFPTVKLAGSSFEG
                     ISIPECVQQGKHVAEEVLAEIFC"
     gene            complement(<431070..>433433)
                     /locus_tag="BSPH_RS02085"
                     /db_xref="GeneID:23319639"
     CDS             complement(<431070..>433433)
                     /locus_tag="BSPH_RS02085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292195.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_041658978.1"
                     /db_xref="GI:753952086"
                     /db_xref="GeneID:23319639"
                     /translation="GVTGATGATGFTGSTGVTGSTGVTGATGNIGPTGATGAAGIAGV
                     TGATGATGFTGSTGITGSTGATGIAGVTGATGVTGATGVTGSTGATGIAGVTGATGST
                     GASGDIGPTGATGVTGVTGATGVTGTTGATGVTGATGNIGPTGATGAAGIAGVTGATG
                     STGATGDIGPTGATGVTGVTGATGVTGTTGSTGIAGVTGTTGATGVTGATGNIGPTGA
                     TGVAGIAGVTGATGSTGATGDIGPTGATGAIGVTGATGAAGIAGVTGATGSTGATGDV
                     GPTGAIGVTGATGPTGAAGIAGVTGATGFTGSIGVTGSTGATGAAGIAGVTGATGSTG
                     ATGDIGPTGATGVTGVTGATGVTGTTGATGATGATGVTGVTGTTGSTGSTGTTGVTGV
                     TGATGVTGTTGATGIAGVTGATGVTGSTGVTGATGATGDIGPTGATGATGIAGVTGAS
                     GSTGATGVTGATGVTGATGATGDIGPTGATGIAGVTGTTGATGSTGATGDIGPTGATG
                     ATGATGFTGATGATGATGATGATGATGAAGIAGVTGATGSTGDIGPTGATGVTGATGA
                     TGAIGVTGATGATGIAGVTGPTGATGATGATGSTGATGSTGVTGATGATGDIGPTGAT
                     GATGATGVTGVTGATGATGATGVTGATGATGATGATGATGATGATGPTGATGFTGPAF
                     TEGFSAFKNTLTVSGSTSITNWSVASPYFTTPAFNPTTGIFTVPTTGRYSFEATINYS
                     TTAAISVTLGAGINPSFAIRQNATTNLISGLFPVLNVNVALVLTLRAV"
     gene            <433897..>434639
                     /locus_tag="BSPH_RS02090"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319640"
     gene            complement(434918..436003)
                     /locus_tag="BSPH_RS02095"
                     /old_locus_tag="Bsph_0413"
                     /db_xref="GeneID:6024750"
     CDS             complement(434918..436003)
                     /locus_tag="BSPH_RS02095"
                     /old_locus_tag="Bsph_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_036160507.1"
                     /db_xref="GI:738204589"
                     /db_xref="GeneID:6024750"
                     /translation="MVSISLCMIVKNEEEVIGRCLESVKGLVDEINIVDTGSTDRTKQ
                     IVAQFTDRIFDFEWIHHFAAARNYSFQQATMDYILWLDADDVFLEEDQEKFKALKNSL
                     SATIDAVSMNYNLSFDSEGNVDALIRRNRLVKKDKNFQWIGAVHEYLEVGGTLLDSDI
                     AVSHLPLTHDHSRNITIYKTLVESGKTLSPRDTFYFANELLDHGQFEEAIYYYELFLT
                     SKLGWVEDNIRACFKLADCYSNLNDPENNFSSILRSFEYDVPRPEACCRLGYHFMEQY
                     KNYQAIFWYEQALIIKQNPNAPFQNKSFSTWLPHLQLCVLFDRLQEYELANAHNELAG
                     SFIPNDAKVLHNKKYFQQILKSNQTDS"
     gene            436191..437150
                     /locus_tag="BSPH_RS02100"
                     /old_locus_tag="Bsph_0414"
                     /db_xref="GeneID:6024751"
     CDS             436191..437150
                     /locus_tag="BSPH_RS02100"
                     /old_locus_tag="Bsph_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417819.1"
                     /db_xref="GI:670469159"
                     /db_xref="GeneID:6024751"
                     /translation="MKKWAFFIFSLLQIIWLAGCTEKSYESIERDRNFIASLNIQEPS
                     LDFIDENGHVLAKWLFDKAYSGATLLGDDQVLLYGHQLNTIDVYTLSTGEKLYSQKVE
                     VGTTNVYYDNNIKQFFITNSKTNTVTSFDHEGNMLASQRIGNYPMSMASYKDKLYVIN
                     FKDTKLSVLNMKDLQIEQEWPIQKSSHGIAIIDEIDELWIGGHGEGSKPNSSVKKYDL
                     NSGQLHGEINMPLMPVGLKKTKDAVLVVSHGHNELYVADFDGHIKWQQEVGANPFVVN
                     QFKDYIVVAGYDDHKLHFIKDGQTEKTVDVGKGAFQLLVREEK"
     gene            437150..437833
                     /locus_tag="BSPH_RS02105"
                     /old_locus_tag="Bsph_0415"
                     /db_xref="GeneID:6023309"
     CDS             437150..437833
                     /locus_tag="BSPH_RS02105"
                     /old_locus_tag="Bsph_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_031417817.1"
                     /db_xref="GI:670469157"
                     /db_xref="GeneID:6023309"
                     /translation="MTTVLIVDDEQDMRNLIEMMLNNSDIETYTAASGTEAYDIIVRE
                     KIDLVLLDVMMPHEDGFVVCQSIRAMSNVPIIFLTARDANEDKVKGLTLGGDDYIVKP
                     FTHDELAARIYAVLRRSGANIAELQQKYVVFGPIKIDEIARKVSVHGKSIPLTLKEFE
                     LLHLFMKNPGNAYTREQLLERIWDIDYVGGTRTVDTHIKTLRIKLGKEAAAHIQTVWG
                     VGYRFDPGE"
     gene            437830..439218
                     /locus_tag="BSPH_RS02110"
                     /old_locus_tag="Bsph_0416"
                     /db_xref="GeneID:6023310"
     CDS             437830..439218
                     /locus_tag="BSPH_RS02110"
                     /old_locus_tag="Bsph_0416"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012292200.1"
                     /db_xref="GI:501249182"
                     /db_xref="GeneID:6023310"
                     /translation="MKKIATRIWLLIFAFLIITVVFMYVLTNFLYQRLYVQDTEDTMV
                     EVGLKLQTMYNNGKVTDEFIADIERFNDYSNLNIFAVRNPRELSACVPFDIDYETLIG
                     PEERQKLLSGSYVQKIGYEPRFDRQLISVVLPLVDQNRLEGIIYIYFPLAKISELANS
                     GVILLFISAFIFLMVVSYLIYKGIRHIMRPLNDLQRAVEQMSFGNYETRVPVNSRDEI
                     GKLSSTFNKMAEAIQQEDEAQKTFLATVSHELRTPISYVKGYSEAMQNGIITENQKEE
                     TIQLIVREANRMERLTNELLQLARTENEQTEIVVYPIPLGETLREVQKILTHQADKKN
                     ITLHLDVDDALIIQADEVKLKQIFINIIENAINYSYENSKVEMVAIEKNGSAQITIKD
                     YGIGIPQEDISHVTERFYRVNKARSRADGGSGLGLSIVEQLLKQLQGRLEIKSIIEKG
                     TIVKITLPLMED"
     gene            439222..439749
                     /locus_tag="BSPH_RS02115"
                     /old_locus_tag="Bsph_0417"
                     /db_xref="GeneID:6023311"
     CDS             439222..439749
                     /locus_tag="BSPH_RS02115"
                     /old_locus_tag="Bsph_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292201.1"
                     /db_xref="GI:501249183"
                     /db_xref="GeneID:6023311"
                     /translation="MKKWLFALIAVPALLVGCGENKEETLPEPEVPQIPEVEILTPKE
                     VALHETIELAAHVEQGGKNVDDAVVEFEVWESGKRDEGQMVDGKLEKDGVYKATTTFD
                     HDGVYYMYAHTTANGVHNMPKQQIIAGSPDMTQVLPEDEKSNNSMDNNMMNHGNGTSD
                     DTDQNEEKKDEKNHH"
     gene            439870..440442
                     /locus_tag="BSPH_RS02120"
                     /old_locus_tag="Bsph_0418"
                     /db_xref="GeneID:6023312"
     CDS             439870..440442
                     /locus_tag="BSPH_RS02120"
                     /old_locus_tag="Bsph_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016995101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_012292202.1"
                     /db_xref="GI:501249184"
                     /db_xref="GeneID:6023312"
                     /translation="MDRRQEILEAAAKSFTLFGYKATTMEQVAKIANVGKGTIYTFFA
                     NKEILFQEIAMSLVREMKGEADAVLDASASFMDNAHNALMKMLQFREKHLLFAKLIEE
                     EKELRTPAVKQVLLRIETEILSYVAELIQRRINKGEIRDCDAELVSYLLLKAYLAFVV
                     DWHELHGDAIPEEKILNLFKETIFRGLILT"
     gene            440572..442761
                     /locus_tag="BSPH_RS02125"
                     /old_locus_tag="Bsph_0419"
                     /db_xref="GeneID:6023313"
     CDS             440572..442761
                     /locus_tag="BSPH_RS02125"
                     /old_locus_tag="Bsph_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292203.1"
                     /db_xref="GI:501249185"
                     /db_xref="GeneID:6023313"
                     /translation="MIKAEWLKIFKTRKMLVSIIAVLFIPVMYAGMFLWAFWDPYAGL
                     PNLPVAVVNEDTGAEMDDVKLDLGDTLVDKLIDSEQFNFIEVSKEEAEKGLNSRDYYM
                     ILEIPTNFSEHATTLLDDKPSKLVMNYIPNEGLNFLGAQIGETAMDRVRAEVNSQVSA
                     TYAEKLFDSIATLGDGFTEAADGSNKLDEGAQKVANGAKDLKGYLEQLASSTVELSNG
                     TDKLTKGAGDAAKGANDLSSGLVKLQDGTVQLQQGAQQAANGASSLEQGISQYTQGVA
                     KVGAGLNTLNDKQQQISAGAASIAENAGALNGAANQLTAGSAKVEAGITALSNQLQTM
                     MTSMPEEQAAALKQTLAELQAGSASVHNGLTTLSAGTEKLQAGANQVSSGAGQIAAGQ
                     AEVLAGANALTAKSNALVEGAKGLQAGNATLAAKLGELNAGVTTAVTGSKTLASGLNE
                     LANGTTTLNQGTSTLASKSGELAQGSATLADGSTELADGTSTLSGKLGEASEKANEVK
                     ANQDTYDMVGSPVEVEKESVNHVPNYGTGFAPYFISLGLFVGALLISIVFPLVEPAIR
                     PKNGASWFTSKVTVLAVVGLVQTVLTVVIVKWGLGLEVNNMGYFIVTALLTSYVFLAL
                     IQMLVSIFGDPGRFMAIVVLILQLTTSAGTFPLELIPSPLQVFNKLLPMTYTVQAFKS
                     SISTGDTSFLMQNYGVLAGFLVAFLAITFGYFMLLHNKRYSKIAEEN"
     gene            443230..444222
                     /locus_tag="BSPH_RS02130"
                     /old_locus_tag="Bsph_0421"
                     /db_xref="GeneID:6023135"
     CDS             443230..444222
                     /locus_tag="BSPH_RS02130"
                     /old_locus_tag="Bsph_0421"
                     /EC_number="6.3.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004230456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate-protein ligase A"
                     /protein_id="WP_012292205.1"
                     /db_xref="GI:501249187"
                     /db_xref="GeneID:6023135"
                     /translation="MIFVDNKGIHDPRVNLAIEEYLLKTMDVEKEPVLLFYINQPSII
                     IGKNQNTIEEINTDYVEDNGIIVVRRLSGGGAVYHDLGNLNFSFITNDDGDSFMNYKK
                     FTQPVVDALAKMGVNAELSGRNDILAEGRKVSGNAQFSTRGRMFSHGTLMFDTEIDAV
                     VSALKVKKDKIESKGIKSIRSRVANISEFLKEKMTIEEFRLEILKSIFGGETNIRYYE
                     LTDEDWVNIHKLSAERYQTWEWNYGKSPRFNIQKTHRFPTGGIDIRLEVNHGVIEEAH
                     IFGDFFGVGDMTDIEQRLVGTNHDRTAIANALVDIDIPTYFGGISTEDFLQLIY"
     gene            444323..445027
                     /locus_tag="BSPH_RS02135"
                     /old_locus_tag="Bsph_0422"
                     /db_xref="GeneID:6023136"
     CDS             444323..445027
                     /locus_tag="BSPH_RS02135"
                     /old_locus_tag="Bsph_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012292206.1"
                     /db_xref="GI:501249188"
                     /db_xref="GeneID:6023136"
                     /translation="MEKHRIFIVEDDVKIASLLAETLRKYQYEVETIQEFDHLIEEFT
                     AFNPHMVLLDINLPSYDGYYWCRQLRQHTTCPIIFISARSGEMDQIFALENGGDDFIT
                     KPFNYEIVLAKIRSHLRRTYGEYATRQEERTIKQGQLILHLERMELHKNELEIPLQKK
                     ECIILELLMGNAPKVVTREQLLEELWDDQAFVDENTLNVNMTRVRKKLADYHISSTIE
                     TVRGAGYRFILSAGEL"
     gene            445027..446011
                     /locus_tag="BSPH_RS02140"
                     /note="histidine kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319641"
     gene            446023..446448
                     /locus_tag="BSPH_RS02145"
                     /old_locus_tag="Bsph_0425"
                     /db_xref="GeneID:6022973"
     CDS             446023..446448
                     /locus_tag="BSPH_RS02145"
                     /old_locus_tag="Bsph_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292209.1"
                     /db_xref="GI:501249191"
                     /db_xref="GeneID:6022973"
                     /translation="MTEVSIEGWLLNINKEKTKALYMTHLQEGDQVSYQNFVMANEVL
                     NEELLHFSNILGLNLQQPTLLQAFPVDGQQIMYSGHYTVYGEILEGEMDAWDVIIGEH
                     CFSLVAEESVLGLTEPHFQIGFEVVLQWLLPQSLELMKK"
     gene            446461..447237
                     /locus_tag="BSPH_RS02150"
                     /old_locus_tag="Bsph_0426"
                     /db_xref="GeneID:6022974"
     CDS             446461..447237
                     /locus_tag="BSPH_RS02150"
                     /old_locus_tag="Bsph_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacitracin ABC transporter ATP-binding protein"
                     /protein_id="WP_012292210.1"
                     /db_xref="GI:501249192"
                     /db_xref="GeneID:6022974"
                     /translation="MPILQIKDVTKVYEGKVTHRALNQLSFEVEEGEFLAVMGPSGSG
                     KTTLLNIISTIDEPTSGEIILDGMNPHTLNATELAYFRRRQLGFVFQDFNLLHMLTVE
                     ENIVLPLTLDQQPLEVMEERLANIVEKLDLTPFLHKRPNEISGGQAQRTAIGRALIHN
                     PSLILADEPTGNLDSNSSRDVLELLTKVNKDKRTTIVMVTHDPIAASYCDRVLFIKDG
                     EFFNEIYRDDRRQMFFQRILNVLSLLGGGQVGDLSTIRLP"
     gene            447209..449143
                     /locus_tag="BSPH_RS02155"
                     /old_locus_tag="Bsph_0427"
                     /db_xref="GeneID:6022975"
     CDS             447209..449143
                     /locus_tag="BSPH_RS02155"
                     /old_locus_tag="Bsph_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_036160509.1"
                     /db_xref="GI:738204591"
                     /db_xref="GeneID:6022975"
                     /translation="MTFRQFAYRNVVRNSRIYGAFFMASFFSVAVFFIYSMLMFHPDI
                     ERGILGEVSLIGMVGAEIVLVLFTLFFLYYSMSAFLEARSHEFAILLHLGMEKRQMNK
                     LVFLETMIIGAGSIIVGIVFGFSFSKFFFMIVREILHLDELPLYVSWQPFLLTIGVFT
                     SAFVVISFISVYFTRERKLRDLIKGSDYLNSLTTYSKIRAVYGIALILGTYILAFVVG
                     HTSLIGLTLLIPFSATFGTYYFFSDSVPCFLDLARGKRKFHWQRYRLLSLAEQTHIMM
                     DNVKMFFVVTMVSTLAFLSVGVLATMSSYTTQYDRLNPLGLVYKGDIDNPYEREHINS
                     LRLQLEEKGLSYQLSRFVVIKQTSSFTQNEVEVFRESDMNVLLSSYSYPLLDLGSGEA
                     VFIPYSEDSLKKLKNRVVHTVLEENSIPITIDSVYPKIVFPGSIVSVNSIVISDEDFA
                     KLIHPISEKNLIQPSYHLFTFVIPQWMETKEVGKDIDYLESNLYFLKKDKFSPFYFEN
                     AGLNYSYILATYSLFTLVGVLVATVFLLAAGSFIYFKLHTSLEREKRKFDVLKRMGLT
                     DIELKKLVNRHLFPQFFLPWGVAMMHSAFAFLMVQGILKDIANISIVKEVFFAFGFFV
                     LIQVVYFYLIRWRYISHIRS"
     gene            449286..450833
                     /locus_tag="BSPH_RS02160"
                     /old_locus_tag="Bsph_0428"
                     /db_xref="GeneID:6022976"
     CDS             449286..450833
                     /locus_tag="BSPH_RS02160"
                     /old_locus_tag="Bsph_0428"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292212.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_012292212.1"
                     /db_xref="GI:501249194"
                     /db_xref="GeneID:6022976"
                     /translation="MNLVSRVRQQATEQPDKVAYHFMGKDTTYGEFEQTVGRFAKGLQ
                     DLGIEKGDHVAFLLGNTPHYLIALYATMRIGATAIPVNPIYTPDEISYILHNGDVKAV
                     IALDLLLPLVEKGVQAFPQVKAFVVCETTADIAEKVAALSLKAQEKTHLFTQIVKNTS
                     QSLQPVEVADDDNAIILYTSGTTGTPKGAMLTHENVYSNARDVAHYLDIQEKDRVIAT
                     LPVFHVFALTVVVNAPLLSGATVLLAPKFSPTEIFALAREQKATVFAGVPTMYNFLYQ
                     LPEGNPEDFSTIRLAISGGASLPVALLHNFEQKFNVRVSEGYGLSEASPVTCFNPLDR
                     DRKAGSIGTSISNVENRVVDVNGQEVPVGEVGELIVRGPNVMKGYYKMPEETAMAIRD
                     GWLYTGDLAKVDDEGYFYIVDRKKDMIIVGGFNVYPREVEEVLFAHNNIVEAAVVGFP
                     DPNLGEAVHAYVVLKEVAATTTEDLLSYCGKHMVKYKVPKVIEIMDELPKNTTGKILR
                     RSLKEKV"
     gene            451086..451733
                     /locus_tag="BSPH_RS02165"
                     /old_locus_tag="Bsph_0429"
                     /db_xref="GeneID:6022977"
     CDS             451086..451733
                     /locus_tag="BSPH_RS02165"
                     /old_locus_tag="Bsph_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome O ubiquinol oxidase"
                     /protein_id="WP_012292213.1"
                     /db_xref="GI:501249195"
                     /db_xref="GeneID:6022977"
                     /translation="MIELIKELISFIVHIDVHLEEIIRDFGNWSYLILFAIVFVETGV
                     VIFPFLPGDSLLFASGTLAAAMGAFDMWILIPVFLAAAILGDTMNYHIGHKVGTSIPP
                     KSLLGRVVKKERMEAAEKFFNTHGGKTIVIARFMPFIRTFIPFVAGASKMNYSYFLLY
                     NILGAILWVFSCTLLGYFFGNIPIIKDNFSVVLILIIFISVVPAVIGAIKAKVGK"
     gene            451905..453134
                     /locus_tag="BSPH_RS02170"
                     /old_locus_tag="Bsph_0430"
                     /db_xref="GeneID:6022001"
     CDS             451905..453134
                     /locus_tag="BSPH_RS02170"
                     /old_locus_tag="Bsph_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012292214.1"
                     /db_xref="GI:501249196"
                     /db_xref="GeneID:6022001"
                     /translation="MEVFIGRQPIFNLHEQVVAYELLYRGKNVNAFPMVDSDAATIDV
                     LVNSFLSIGFEEVTKGKPGFVNFTDNLLMSSIHEFLNPSQVVIEILEDVPLTSQLVKR
                     VVELKNYGFQIALDDFIMDEQVDIYDELFEQVDFIKVDFLATSMVKRMEIENKVKGNY
                     PHIQLLAEKVETRHQFEVAKSSGYVLFQGYFFEQPQIIKATDIPANTIQYIHIISLLK
                     EEEPNIQLLAENIERDISLTYKLLQMINNSSKRSKSKVRSIKQAIVLLGISNLRKWIY
                     LLAMREIDIDADSDLFKEVMCMSLFRAKVCEKLAKLSYKKNFSEYFLVGMFSLIDTLL
                     QRPMSVILHQLPFSEDITNTILGHETDMTSFLEFSIALGKLDWARLEELSAQLNIQLN
                     DMDHLYYEAMEWAEKSF"
     gene            453308..454150
                     /locus_tag="BSPH_RS02175"
                     /old_locus_tag="Bsph_0432"
                     /db_xref="GeneID:6022003"
     CDS             453308..454150
                     /locus_tag="BSPH_RS02175"
                     /old_locus_tag="Bsph_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016991710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_031417809.1"
                     /db_xref="GI:670469148"
                     /db_xref="GeneID:6022003"
                     /translation="MKHDVRENIVDYVYVIVGAAVIAIGFNVFLLPNQVASGGVSGIS
                     TILHGLFGWNPGIVQYAFNIPLFIAGVLLLGKKFGIKSFIGTITLPFIVLLTNSWEPW
                     TDNPLLGALFGGIVVGLGIGLVFKGNASTGGTDLLAQIITKYTGLTLGTSVLLIDGII
                     AISAAVVFDLEKGLYALIGLYVTTKTIDIIQLGFSQSKMVYIITLKQDEVREAIYAEI
                     NRGVTKLQAFGGYTGEARPVLMVVVYQTEFTKLKQLIKSVDPSAFVIVSDAYEVLGEG
                     FKRA"
     gene            454203..454521
                     /locus_tag="BSPH_RS02180"
                     /old_locus_tag="Bsph_0433"
                     /note="CccB; disrupted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6022004"
     gene            454644..455581
                     /locus_tag="BSPH_RS02185"
                     /old_locus_tag="Bsph_0434"
                     /note="serine kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6022005"
     gene            455627..456448
                     /locus_tag="BSPH_RS02190"
                     /old_locus_tag="Bsph_0435"
                     /db_xref="GeneID:6024321"
     CDS             455627..456448
                     /locus_tag="BSPH_RS02190"
                     /old_locus_tag="Bsph_0435"
                     /EC_number="2.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016991708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_012292219.1"
                     /db_xref="GI:501249201"
                     /db_xref="GeneID:6024321"
                     /translation="MDLLLLQINPIAFHLGPIPVRWYGLLIVSGIILAYVVGQREAVK
                     RGLPEDFLADLLLWAVPISIICARIYYVSMRWDYYSENPGKIIEIWNGGIAIHGALIG
                     AFVTAYIFTRIKNVSFLRVADIAAPSILIGQIIGRWGNFMNQEAYGGPVSKEFLENLM
                     LPDWIINQMYIEELGTYVHPTFLYESVWNLIGLIILLILRKVNLNRGEIFFSYLIWYS
                     IGRFYIEGMRTDSLYLVGDLRSAQIVSIIGIVVGLGAIIYRRIKVKPAMKYLDNK"
     gene            456462..457103
                     /locus_tag="BSPH_RS02195"
                     /old_locus_tag="Bsph_0436"
                     /db_xref="GeneID:6024322"
     CDS             456462..457103
                     /locus_tag="BSPH_RS02195"
                     /old_locus_tag="Bsph_0436"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173275.1"
                     /note="hydrolyzes pyrophosphate formed during
                     serine-46-phosphorylated HPr dephosphorylation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase"
                     /protein_id="WP_012292220.1"
                     /db_xref="GI:501249202"
                     /db_xref="GeneID:6024322"
                     /translation="MAVKALLFDFDGTLLNTNELIIQTFMHVLNERFPGQFSPKDCLK
                     FIGPSLKQTFNDIAPGEEEALIAKYRAWNIEHHDELVSQYPDVVSTLEQLKAQGIRLA
                     IVSTKRNDTIDRGLSILGATHLFDVRIGTDDVHNVKPDPEPVLLALERLGINKDDAIM
                     IGDNSHDIEAGHRAGVRAAGVAWAIKGEAYLQQFQPEYILHHMTDLLDIVKEG"
     gene            457109..457651
                     /locus_tag="BSPH_RS02200"
                     /old_locus_tag="Bsph_0437"
                     /db_xref="GeneID:6024323"
     CDS             457109..457651
                     /locus_tag="BSPH_RS02200"
                     /old_locus_tag="Bsph_0437"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_012292221.1"
                     /db_xref="GI:501249203"
                     /db_xref="GeneID:6024323"
                     /translation="MARKTERYRVEGANSLWKIYDTVSFWKVMKCFIVIQIGRFTPFL
                     RVKNWLYRTFLKMTIGEKTSLALMVMPDTMYPERIFIGDNTVIGFNTTILAHEYLIEE
                     YRLGDVRIGHEVMIGANSTILPGVTIGDGAIVSAATLVHKDVPAGCLAGGNPMQIIYT
                     AEQMAERKRHEVVQWCTPKK"
     gene            457902..459074
                     /locus_tag="BSPH_RS02205"
                     /old_locus_tag="Bsph_0438"
                     /db_xref="GeneID:6024324"
     CDS             457902..459074
                     /locus_tag="BSPH_RS02205"
                     /old_locus_tag="Bsph_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HVP6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_031417804.1"
                     /db_xref="GI:670469143"
                     /db_xref="GeneID:6024324"
                     /translation="MSSIKMFEKPLGMRDTFPQIFEKVEAVRQTGRDFLTKRGYEFIK
                     TPAVEYFDTVGKASAIADTHLFKLVDSQGNTLVLRPDMTTPIARVATSKLLKEMIPQR
                     LAYFASVFRAQEAEGGRPAEFDQMGIELIGDQSVFADAEVIVTAMELLKHLKLEAFKV
                     TIGHAGILNCILQDYTESIEQQTTLRTLLVHRNYVGFEEAVDSFNLPKAKADALLQFI
                     EEAMDVKDIRDIEKYVRKNDALVYMQQLAQLLEMADLAAYVTFDFTLSSHMSYYTGML
                     FEVFALGSGFPLGNGGRYDGLLEVFGSKAGATGFSIRVDRLLETLHGQSEMQQEATVV
                     LFDEEQFEAALIKVNTLRAAGKLATLQLRSSLVDEEAFLAHFTEVVVVGQEEIGSE"
     gene            459067..459711
                     /locus_tag="BSPH_RS02210"
                     /old_locus_tag="Bsph_0439"
                     /db_xref="GeneID:6024325"
     CDS             459067..459711
                     /locus_tag="BSPH_RS02210"
                     /old_locus_tag="Bsph_0439"
                     /EC_number="2.4.2.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HVP7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_012292223.1"
                     /db_xref="GI:501249205"
                     /db_xref="GeneID:6024325"
                     /translation="MNELTIAMPKGRIFEEAYQMLLKAGFHLPEEVEMSRKLMIEIPE
                     EKIRFILSKPMDVPVYVEHGVADIGIAGKDVLLEQQREVHELLDLNISNCYIASAGLP
                     NTDMNEIAPRIATKYPNIAMKYYKGIGEQVEIIELNGSIELAPMIGLADRIVDIVSTG
                     RTLKENGLVEYEFISTVSSRLIANPVSYRMKGERIIDLVRRLKKCVNEQKSNHI"
     gene            459744..461018
                     /locus_tag="BSPH_RS02215"
                     /old_locus_tag="Bsph_0440"
                     /db_xref="GeneID:6022945"
     CDS             459744..461018
                     /locus_tag="BSPH_RS02215"
                     /old_locus_tag="Bsph_0440"
                     /EC_number="1.1.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_012292224.1"
                     /db_xref="GI:501249206"
                     /db_xref="GeneID:6022945"
                     /translation="MKITKLAKGISLKRPLEGGNEEQLKVVRQVLTDVRTQGDVALRA
                     YTERWDGYMPTSLRVTKEEIQEAVNALDQQLYQDLVEAAQNIRLYHEQQSRQGYRLEL
                     GDGSWLGQRVTALDAVGLYVPGGTAAYPSSVLMNVIPAQVAGVKRIVIASPAGLDGKM
                     PAGVLVAAQLLGIEEIYKIGGAQAIAALAYGTETIAPVDKITGPGNIFVALAKREVFG
                     EVAIDMIAGPSEIAVLADDTAFPDEIAADLLSQAEHDRLACAVLVTTSEKLAKKVAEE
                     VEKQLEILPRQEVARASIENFGVIYIAETVSDAVEAINSLAPEHLEIMTNNAEAIAEQ
                     IRHAGGIFIGRYSSEPVGDYFAGTNHVLPTNSTARFASGLNVDDFVKKSSVVYYSEKT
                     WQEHAPKIARLARMEGLEGHARAVESRGWKKE"
     gene            461023..461622
                     /locus_tag="BSPH_RS02220"
                     /old_locus_tag="Bsph_0441"
                     /db_xref="GeneID:6022946"
     CDS             461023..461622
                     /locus_tag="BSPH_RS02220"
                     /old_locus_tag="Bsph_0441"
                     /EC_number="4.2.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004227994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="WP_012292225.1"
                     /db_xref="GI:501249207"
                     /db_xref="GeneID:6022946"
                     /translation="MTEKKRYAQVERTTNETQISVAIDLDGEGKADIKTGVGFMDHML
                     DLFIKHGLFNGTIQANGDTYIDDHHTTEDLGIVLGQAIREALGDKKGIKRYGTAFVPM
                     DDALAQVVVDCSNRPHLEYRVPPLKEKVGTFDTELVHEFLWKFALEARMNVHVIVPYG
                     HNTHHIIEAIFKALARAIDAAVEIDPRVKGVPSTKGLLT"
     gene            461619..462251
                     /gene="hisH"
                     /locus_tag="BSPH_RS02225"
                     /old_locus_tag="Bsph_0442"
                     /db_xref="GeneID:6022947"
     CDS             461619..462251
                     /gene="hisH"
                     /locus_tag="BSPH_RS02225"
                     /old_locus_tag="Bsph_0442"
                     /EC_number="2.4.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292226.1"
                     /note="with HisF IGPS catalyzes the conversion of
                     phosphoribulosyl-formimino-5-aminoimidazole-4-carboxamide
                     ribonucleotide phosphate and glutamine to
                     imidazole-glycerol phosphate,
                     5-aminoimidazol-4-carboxamide ribonucleotide, and
                     glutamate in histidine biosynthesis; the HisH subunit
                     provides the glutamine amidotransferase activity that
                     produces the ammonia necessary to HisF for the synthesis
                     of imidazole-glycerol phosphate and
                     5-aminoimidazol-4-carboxamide ribonucleotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="WP_012292226.1"
                     /db_xref="GI:501249208"
                     /db_xref="GeneID:6022947"
                     /translation="MKIGVVDYGMGNLFSVVQALNRLGCEVIVTANQQLLDTTDALIL
                     PGVGAFPDARKRLAETKLDCYLKNAQSQHRPLLGICLGMQLLFEKSDEVTPTNGLGFF
                     KGHIKRFSGTNEGRAYRVPHMGWNELVMANRPAWLENSAPAKHVYFVHSFYATNIEKS
                     ELVAYADYCGIQVPGIVAKGSVTGMQFHPEKSGELGVYLLEQWLKGVKSC"
     gene            462245..463006
                     /locus_tag="BSPH_RS02230"
                     /old_locus_tag="Bsph_0443"
                     /db_xref="GeneID:6022948"
     CDS             462245..463006
                     /locus_tag="BSPH_RS02230"
                     /old_locus_tag="Bsph_0443"
                     /EC_number="4.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993560.1"
                     /note="catalyzes the conversion of
                     5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-
                     1-(5-phosphoribosyl)imidazole-4-carboxamideand glutamine
                     to imidazole-glycerol phosphate,
                     5-aminoimidazol-4-carboxamideribonucleotide and glutamate;
                     the HisF subunit acts as a cyclase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="WP_012292227.1"
                     /db_xref="GI:501249209"
                     /db_xref="GeneID:6022948"
                     /translation="MLTKRIIPCLDVKEGRVVKGIQFVSIRDAGDPVELAKFYDEQGA
                     DELVFLDISASHEGRETMIEVVQQTAATLAIPFTVGGGIRTLDDMKRILRAGADKVSV
                     NTSALERPSLIQEGSDFFGAQCIVVAIDARYSEEDGTWMVYTHGGRNKTTWSAIDWAK
                     EAVRLGAGEILLTSMNQDGEKSGFDLGLTKAVREAVSVPVIASGGAGYAEHFYEVLAE
                     EVDADAALAASIFHYKETSVAQVKEYLRAKGVAVR"
     gene            463003..463620
                     /locus_tag="BSPH_RS02235"
                     /old_locus_tag="Bsph_0444"
                     /db_xref="GeneID:6022949"
     CDS             463003..463620
                     /locus_tag="BSPH_RS02235"
                     /old_locus_tag="Bsph_0444"
                     /EC_number="3.5.4.19"
                     /EC_number="3.6.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="WP_012292228.1"
                     /db_xref="GI:501249210"
                     /db_xref="GeneID:6022949"
                     /translation="MIERIRFDEKGLVTAVVQDANTKEVLTVAYMNKESFVKTMESGE
                     TWFYSRSRQELWHKGATSGHTQKVVAIKTDCDYDAIVVEVLPEGPACHNGTASCFTEV
                     VQQNTGVGSVEIIAKLVRVIEKREQEMPVGAYTTYLFEKGIDKICKKVGEEATEVVIG
                     AKNRDAEEVKWEAADLIYHLLVLLQEQKVSIYDVLDVLKKRHEEK"
     gene            463711..465234
                     /locus_tag="BSPH_RS02240"
                     /old_locus_tag="Bsph_0445"
                     /db_xref="GeneID:6021270"
     CDS             463711..465234
                     /locus_tag="BSPH_RS02240"
                     /old_locus_tag="Bsph_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_031417798.1"
                     /db_xref="GI:670469137"
                     /db_xref="GeneID:6021270"
                     /translation="MEKKRQNKNQSNIVSFIPTGDYYYKKSIQAMNSGQMNKAYKYLQ
                     RAVDLSPDDPMIILQLAIIELEGQRFEEAYDLLRRAYQIDPDNPEIIFYMAEVSGCVG
                     IMQDAKRFAEEYLQLEPEGAYADEAAEILEFVAFEQDEFEELEGSGEDLYRQEQARRH
                     MEKGDFPEAITILEDLIEDRPAFWSAYNNLALAYFYVGEEEQAKALLHTVLRENKGNL
                     HALCNLTVIAYYEKNEEDLQELLNVLVKIQPYTWEHRYKLGATLALIGQYELAYKWLR
                     SMQKRGYVGDAGFYFWLSHAAYFSGHEEVSKSAWGQLLEVDPDKEGFEPWRQHDNEFA
                     LDALEHDRNFIVEKLESSYLSERIFGLFLLKATAHKQEIIAHPKWVNIEQFGAFEKLF
                     LAYALGHEFDKKNKVEASFLRAVNVPEILLKQYGKLSTLIVPMFQMWFVLCEQALIQN
                     YRFTNPVAIAGANDYLFRSSQMLKVTKKEIAQQYGVSVATLSKYIDEILAFLPSSHN"
     gene            465466..466410
                     /locus_tag="BSPH_RS02245"
                     /old_locus_tag="Bsph_0446"
                     /db_xref="GeneID:6021271"
     CDS             465466..466410
                     /locus_tag="BSPH_RS02245"
                     /old_locus_tag="Bsph_0446"
                     /EC_number="1.8.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="WP_012292230.1"
                     /db_xref="GI:501249212"
                     /db_xref="GeneID:6021271"
                     /translation="MSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQM
                     ANTEEVENYPGFDTILGPELSTKMFDHAKKFGAEYAYGDVTEIIDGEEFKTIKSGTKE
                     YKTRAIIITTGAEYKKMGVPGEKELGGRGVSYCAVCDGAFFKQKNLVVVGGGDSAVEE
                     GVYLTRFADKVTIVHRRDKLRAQKILQDRAFANDKIDFIWNATVKEINEANGKVGSVT
                     LQSTVDGTESEFTTDGVFVYIGMLPLTKPFESLGILNDAGYILTNDNMETTIPGIFAA
                     GDVREKSLRQIVTATGDGSIAAQAVQHYVEELLEKINA"
     gene            466739..467206
                     /locus_tag="BSPH_RS02250"
                     /old_locus_tag="Bsph_0447"
                     /db_xref="GeneID:6021272"
     CDS             466739..467206
                     /locus_tag="BSPH_RS02250"
                     /old_locus_tag="Bsph_0447"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_012292231.1"
                     /db_xref="GI:501249213"
                     /db_xref="GeneID:6021272"
                     /translation="MQRIANLIAVKDGKVLLLQKPRRGWYVAPGGKMESGESIFEAAI
                     REFQEETNVIPLHVHLKGVYTMVIKENNEVVDEWMLYTFVARDVEGVPFVETREGKLA
                     WHPVEDLVHLPMAEGDRTNLQFAVSQSGIQYGTFDYTTNFELLHQKIQISKEQ"
     gene            467216..468109
                     /locus_tag="BSPH_RS02255"
                     /old_locus_tag="Bsph_0448"
                     /db_xref="GeneID:6021273"
     CDS             467216..468109
                     /locus_tag="BSPH_RS02255"
                     /old_locus_tag="Bsph_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glmZ(sRNA)-inactivating NTPase"
                     /protein_id="WP_012292232.1"
                     /db_xref="GI:501249214"
                     /db_xref="GeneID:6021273"
                     /translation="MTVVVEGQQRTHELVIITGMSGAGKTVAIQSFEDLGYYCIDNLP
                     PALLTTFLTLLRDSGKNSTRIAAVMDMRGGNFFDALIGALDHILKEGDIVARILFLDA
                     DDATLVRRYKETRRAHPLAVSGLPLDGIKQERALLSEVKGRANFVYNTSNMKPKQLRE
                     KIVKEFASEADTIFTVNIMSFGFKHGMPIDADLVFDVRFLKNPYYVEELRPKTGLQTE
                     VSSYVLALEDTQILIQKLTDLFDFMIPLYRQEGKSQLVIAFGCTGGQHRSVTLAEFFG
                     AYLASKENTVITHRDINRRKE"
     gene            468114..469082
                     /locus_tag="BSPH_RS02260"
                     /old_locus_tag="Bsph_0449"
                     /db_xref="GeneID:6021274"
     CDS             468114..469082
                     /locus_tag="BSPH_RS02260"
                     /old_locus_tag="Bsph_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292233.1"
                     /db_xref="GI:501249215"
                     /db_xref="GeneID:6021274"
                     /translation="MGKKQTKLVVIGGGTGLSTLLRGLKHHPFDITAIVTVADDGGSS
                     GRLRDDYDIPPPGDVRNVIAALSDIEPLVEQMFQYRFSASEDLRGHSLGNLMLTALTD
                     ITGDFNHAISEMGKVLKVHGRVIPAANKKINLHAVLEDGSIIEGESKIPTATKRIDRV
                     FLVPENVQPLPEAIRAIQRADYILIGPGSLYTSIIPNLLVKEIGESVVKAKGRKMYVC
                     NLMTQKGETISYTAGDHVSAIHKHVGASFIDSILVNDEELPNPVKELYKEERAEPVTF
                     DVAKLESMGLEVIRRDIATIRPDGTVRHNATNVAEWLVDYAGIYDR"
     gene            469176..470123
                     /locus_tag="BSPH_RS02265"
                     /old_locus_tag="Bsph_0450"
                     /db_xref="GeneID:6021704"
     CDS             469176..470123
                     /locus_tag="BSPH_RS02265"
                     /old_locus_tag="Bsph_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation regulator WhiA"
                     /protein_id="WP_008173244.1"
                     /db_xref="GI:495448550"
                     /db_xref="GeneID:6021704"
                     /translation="MSFASETKKELTQIEADNHCMKAEVSALIRMNGSLSFANKQLSL
                     DVQTENAAIARRLYTIMKKLYPYNVELLVRKKMRLKKNNVYICRVREGARELLIDLEI
                     ISDDFQFNHTISRKLIKKNGQKRAYLRGAFLAGGSVNNPETSAYHLEIYSLYKEHGEA
                     LMDLMNEFELNAKTIERKKGFVTYLKEAEKISDFLNIVGAHQAMMKFEDVRILRDMRN
                     SVNRIVNCETANLNKTIGAALRQVENIRFIENSIGLDQLPEKLREIARLRVEYQDVTL
                     KELGEMVSSGTVSKSGVNHRLRKIDEIADALRRGEKIGG"
     gene            470237..470494
                     /locus_tag="BSPH_RS02270"
                     /old_locus_tag="Bsph_0451"
                     /db_xref="GeneID:6021705"
     CDS             470237..470494
                     /locus_tag="BSPH_RS02270"
                     /old_locus_tag="Bsph_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173242.1"
                     /note="catabolite repression HPr; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_004228023.1"
                     /db_xref="GI:490348250"
                     /db_xref="GeneID:6021705"
                     /translation="MIERRVQVKLKLGLQARQAALFVQEANRFSADIFLEKDEKKVNA
                     KSIMGVMSLAVAKGTEVTLSSEGNDAEQAVTALATIIENED"
     gene            complement(470545..471138)
                     /locus_tag="BSPH_RS02275"
                     /old_locus_tag="Bsph_0452"
                     /db_xref="GeneID:6021706"
     CDS             complement(470545..471138)
                     /locus_tag="BSPH_RS02275"
                     /old_locus_tag="Bsph_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HVR0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="WP_008173241.1"
                     /db_xref="GI:495448547"
                     /db_xref="GeneID:6021706"
                     /translation="MNLIPTVIEQTSRGERAYDIYSRLLKDRIILLGSAIDDNVANSI
                     VAQLLFLQAEDPDKDISLYINSPGGSITAGMAIYDTMQIIKPKVQTICIGMAASMGAF
                     LLAAGEPGKRFALPNAEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNGILSERTGQ
                     PLEVIARDTDRDNFMTAERAKEYGLIDHIMHRSTDNK"
     gene            471455..471529
                     /locus_tag="BSPH_RS02280"
                     /old_locus_tag="Bsph_tRNA26"
                     /db_xref="GeneID:6021707"
     tRNA            471455..471529
                     /locus_tag="BSPH_RS02280"
                     /old_locus_tag="Bsph_tRNA26"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:471488..471490,aa:Arg,seq:ccg)
                     /db_xref="GeneID:6021707"
     gene            472028..472822
                     /locus_tag="BSPH_RS02285"
                     /old_locus_tag="Bsph_0453"
                     /db_xref="GeneID:6021708"
     CDS             472028..472822
                     /locus_tag="BSPH_RS02285"
                     /old_locus_tag="Bsph_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012292235.1"
                     /db_xref="GI:501249217"
                     /db_xref="GeneID:6021708"
                     /translation="MKKTAWMLLMILAALTLALAGCGTKDTASSGSTPSEGGDGKKVY
                     KVGTEATFAPFESVDDKGKIVGIDVDILKAIADEMDFEVEWNNIGWEPVFQTIKNGET
                     HIGASGITITDERKESFDFTEPYYESQLLIVVKEDSKIKSLDELKDKKVSVQINATGH
                     MAAKKLQGEASTNIMAFESQPIAIQEMLNGNVDAAIGDNAVVYEYIKAHPDQKIKVIQ
                     DDAFEKEYYGFMVQKGNKELLDKLNEGLKKIKENGKLKEITGTDFE"
     gene            472906..473610
                     /locus_tag="BSPH_RS02290"
                     /old_locus_tag="Bsph_0454"
                     /db_xref="GeneID:6024444"
     CDS             472906..473610
                     /locus_tag="BSPH_RS02290"
                     /old_locus_tag="Bsph_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_031417795.1"
                     /db_xref="GI:670469134"
                     /db_xref="GeneID:6024444"
                     /translation="MDIFDLRWDIVWNYRDMFIRGIGVTLILTLSGYFGGILLGLFLG
                     LGKLSSKKWIYWPSKLYIDLFRGTPMLVQILLIHLAVIPTIFGHSLGYMVSGITALIL
                     NCAAYNAEIFRAGIQSIAKGQMEAARSLGLTHNQAMRKVILPQAFRRMIPPLGNEFIA
                     LLKDSSLVTVIAAPDILYASKVVAGASFRFWEPYMVAALLYLILTYGVTKIVAFIEKR
                     FSNSYVPRKAEGREAR"
     gene            473607..474329
                     /locus_tag="BSPH_RS02295"
                     /old_locus_tag="Bsph_0455"
                     /db_xref="GeneID:6024445"
     CDS             473607..474329
                     /locus_tag="BSPH_RS02295"
                     /old_locus_tag="Bsph_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_012292237.1"
                     /db_xref="GI:501249219"
                     /db_xref="GeneID:6024445"
                     /translation="MIKIENLHKYFGKLEVLKGIDYEIQEKQVVCVIGPSGSGKSTFL
                     RCINMLEEVTDGAIYIEDVKINDPKTNINAIRAEVGMVFQQFNLFPHMNVIDNVTMAP
                     MQIRKMSRSEAEALGHELLNKVGLDSKAYNYPEQLSGGQQQRVAIARALAMKPKAILF
                     DEPTSALDPEMVKEVLDVMKNLAAEGMTMVVVTHEMGFAREVGDRVVFMDGGYIVEEG
                     LPEELFGNPQSERTKAFLGKVL"
     gene            complement(474384..474998)
                     /locus_tag="BSPH_RS02300"
                     /old_locus_tag="Bsph_0456"
                     /db_xref="GeneID:6024446"
     CDS             complement(474384..474998)
                     /locus_tag="BSPH_RS02300"
                     /old_locus_tag="Bsph_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore coat protein GerQ"
                     /protein_id="WP_012292238.1"
                     /db_xref="GI:501249220"
                     /db_xref="GeneID:6024446"
                     /translation="MSQSFYNESSNQTNLNQQHSLNHGGHEMMDMHEAIGEIIAGMNQ
                     AIILRPQVKDQELLSILDRQYNFSLGMYNTIVESFKTGHDPSVPTGRYQMETGNDFKY
                     GLTPGQPKKPMQNANEINDEAISGFLLGAQKGVAKCMTAAATETTNPVVRRVVADSIP
                     NCIEMAYELSIYQNKHGYYQVPQYSQQDMQTMLNAFDTTSNPLH"
     gene            475137..475717
                     /locus_tag="BSPH_RS02305"
                     /note="LemA family protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319642"
     gene            475717..476466
                     /locus_tag="BSPH_RS02310"
                     /old_locus_tag="Bsph_0459"
                     /db_xref="GeneID:6025139"
     CDS             475717..476466
                     /locus_tag="BSPH_RS02310"
                     /old_locus_tag="Bsph_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417792.1"
                     /db_xref="GI:670469131"
                     /db_xref="GeneID:6025139"
                     /translation="MKRCILQLIIICSVLLFCRDITEAAMPSPMKNTYIHDFANVLSL
                     DVKQKLNHYSEQLDKGTGAEIMVVTVDSLHGQEAKMYATKLIRSWGIGDKEKNNGALI
                     LATFGQGKGQNDVVIAVGQGLEGALPDGKLGRILDNAFYPLASEGDNDQAFLATYAEV
                     FRAVAEEYNWNGELPAGANADEEIPIWLMIVIIIAVIIFSSFFSKGGGGPRGRGYGGY
                     PGSFGGRRSGGGSFGGFGGGSSAGGGASRKF"
     gene            476600..478870
                     /locus_tag="BSPH_RS02315"
                     /old_locus_tag="Bsph_0460"
                     /db_xref="GeneID:6025140"
     CDS             476600..478870
                     /locus_tag="BSPH_RS02315"
                     /old_locus_tag="Bsph_0460"
                     /EC_number="3.4.14.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_012292240.1"
                     /db_xref="GI:501249222"
                     /db_xref="GeneID:6025140"
                     /translation="MKKRFLTASLAIILTTATVIPATLQEVRAANETNIVLAQEQQLS
                     AQEFLDLAVTALTFQHGSDSMRQQIKDQWVKAGEITDLSATIKRDQAARILVRAANKE
                     GKEKTLAEYLKKANKLGFFKGISSSTDFISKQEASKLLNNVKKIKNGSSNKGVKEISV
                     EDFVKNPGNFGYELSPDGNYITFASAWENRSNVFVKKMNDNSEPVRVSSSKDRNIAGF
                     FWKDDSLLYLKDKGGDENFHIYSTTFNGSVEKDLTPYPNVTVGILDSLQGVKDEILIM
                     MNKEDATVFDVYKLNVKTGKTTHVAKNPGNITNWLADRNGNVRVAVATDGVKGAILYR
                     DSEKDEFRPFIKMGAGDEVMPLAFSKDNKFIYATSNKGRDKVEVVKYDLQGKEEVIMS
                     NDEVDVSGVLYNAEKDKLLFGAYATDKIHYQFFDKDFEKLFRKIQNKLGVHESELGIN
                     DYNKEMTKFIVSVSSDTIYGKYYYYDSTTDELKELATLSPWLKSADLAEMHPISYKSR
                     DGLTINGYLTLPKNKKAENLPLIVNPHGGPWARDMWGFNPEVQLLANRGYAVLQVNFR
                     SSTGYGKEFLQAGNKQWGLKIQDDITDGVQWAIDQGIADPKRIGIYGASFGGYATLAG
                     ITYTPDLYAAAVDYVGVSNIFTLLDTIPPYWETMRDLFYERVGHPEKDKELLKAVSPV
                     FHVDKIKTPLFVAQGANDPRVNKAESDQIVEALRARGVDVEYMLKDNEGHGFANEENR
                     IEFYNAMVKFLDHHLK"
     gene            479073..479306
                     /locus_tag="BSPH_RS02320"
                     /old_locus_tag="Bsph_0461"
                     /db_xref="GeneID:6025141"
     CDS             479073..479306
                     /locus_tag="BSPH_RS02320"
                     /old_locus_tag="Bsph_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292241.1"
                     /db_xref="GI:501249223"
                     /db_xref="GeneID:6025141"
                     /translation="MIVQFFSRANCPLCVEGLHTLKLVQEDVAFDIEIVNIEEDDHIH
                     EKYMFMIPVVEKDGTVIQYGNLDYATLMEHLGS"
     gene            479860..480909
                     /locus_tag="BSPH_RS02325"
                     /old_locus_tag="Bsph_0463"
                     /db_xref="GeneID:6025143"
     CDS             479860..480909
                     /locus_tag="BSPH_RS02325"
                     /old_locus_tag="Bsph_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="central glycolytic genes regulator"
                     /protein_id="WP_012292243.1"
                     /db_xref="GI:501249225"
                     /db_xref="GeneID:6025143"
                     /translation="MFTIPEAQQRLLPEMYPLLQSRYRILQAVQLMQPIGRRTLADSL
                     KMTEREIRKETDILREQGLLDSQKSGMVCTDDGEEVIEKLRAIVYEWSGLTQLAKLLE
                     KHFGIQHVVVVPGDYSEDNTVLTLLGKEAALQFMSTAFDEQVVAVTGGKSVASLAQFL
                     HPLDGQKDITFVAARGGIGHEMQMQANTLVATFAMQMEEQYRTLFLPEHLSEQAYKAM
                     LTEPMVTEMMAFYDRADCVIHGIGSAEEMAIRRNSSSEDLRILEEKGAVSEAFGYYFN
                     AEGEIVHRIRTIGIQLEQVKNSQQVIAVAAGKQKVNAMLSYFKVAPKQTIFITDEAAA
                     KAIAATLPSDNSHFE"
     gene            481039..482055
                     /locus_tag="BSPH_RS02330"
                     /old_locus_tag="Bsph_0464"
                     /db_xref="GeneID:6022039"
     CDS             481039..482055
                     /locus_tag="BSPH_RS02330"
                     /old_locus_tag="Bsph_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_031417788.1"
                     /db_xref="GI:670469127"
                     /db_xref="GeneID:6022039"
                     /translation="MALKLAINGFGRIGRLVFREAMKQSEFEVVAVNDLTDAGQLAHL
                     LKYDSVHGIYDAEVNADEDSFVVNGQRIKVYAEKDPSQLPWGELGVDVVLECTGHFRS
                     LEEVGKHIEAGAKKAILSAPAKGAMPTFVMGVNHTDYNPATDDVISNASCTTNCLAPV
                     AKVLDEKFGIERGMMTTIHSYTNDQRILDFPHSDPRRARAGAVSMIPTTTGAAVAVSK
                     VLPQLKGKLDGFSMRVPTPNVSCVDLVVELKADVTKEAINAVLKEASENELKGILDYN
                     ELPLVSIDYNGNHHSSTVDGLSTMVLENKMVKVLAWYDNEIGYSTRLMDLALYIAEQG
                     LNNK"
     gene            complement(482059..482298)
                     /locus_tag="BSPH_RS02335"
                     /db_xref="GeneID:23319643"
     CDS             complement(482059..482298)
                     /locus_tag="BSPH_RS02335"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417786.1"
                     /db_xref="GI:670469125"
                     /db_xref="GeneID:23319643"
                     /translation="MIRSVVGYALNEREPFVYSAHHPHLLRWAFPAEFSKKGVRVIPY
                     SQYPCILYLFDIIKAILFVHKKQYYVTLFTQNVEI"
     gene            482604..483788
                     /gene="pgk"
                     /locus_tag="BSPH_RS02340"
                     /old_locus_tag="Bsph_0465"
                     /db_xref="GeneID:6022040"
     CDS             482604..483788
                     /gene="pgk"
                     /locus_tag="BSPH_RS02340"
                     /old_locus_tag="Bsph_0465"
                     /EC_number="2.7.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173217.1"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_012292245.1"
                     /db_xref="GI:501249227"
                     /db_xref="GeneID:6022040"
                     /translation="MLNKKTMKDIDVKGKRVFVRVDFNVPMADGVITDETRIRAAIPT
                     VEYLVEQGAKVILASHLGRPKGEVKEDMRLTAVGIRLAELMSKPVTKLDESIGQAVEK
                     AVANMQDGDILLLENVRFHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGI
                     AKHIPAVSGFLMQTELDVLGKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLII
                     GGGLSFTFIKAQGYDIGKSLLEEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQD
                     AETKVVDVDAIPADWMGLDIGPKTAAHYAEVINNSKLIIWNGPMGVFEMDKFANGTKT
                     VADAMATTSGYTVIGGGDSAAAVEKFKVADKMDHISTGGGASLELMEGKELPGIVALN
                     DK"
     gene            483815..484576
                     /gene="tpiA"
                     /locus_tag="BSPH_RS02345"
                     /old_locus_tag="Bsph_0466"
                     /db_xref="GeneID:6022041"
     CDS             483815..484576
                     /gene="tpiA"
                     /locus_tag="BSPH_RS02345"
                     /old_locus_tag="Bsph_0466"
                     /EC_number="5.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173216.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_012292246.1"
                     /db_xref="GI:501249228"
                     /db_xref="GeneID:6022041"
                     /translation="MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPA
                     LYLPTLVQVASESELAIGAQTMHYENEGAFTGEISPAQLASVDVDYVILGHSERREYY
                     NETDEAINKKVAAALAHNIVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQVE
                     HMVIAYEPIWAIGTGKTATADDANQVCGAIRSVVEELFDAATANAVRIQYGGSVKPDN
                     VHELLSKEHIDGALVGGASLQPESYLTLLEAAANA"
     gene            484569..486110
                     /locus_tag="BSPH_RS02350"
                     /old_locus_tag="Bsph_0467"
                     /db_xref="GeneID:6022042"
     CDS             484569..486110
                     /locus_tag="BSPH_RS02350"
                     /old_locus_tag="Bsph_0467"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228068.1"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="WP_012292247.1"
                     /db_xref="GI:501249229"
                     /db_xref="GeneID:6022042"
                     /translation="MPKKPVALIILDGFAFRDETFGNAVAQAKKPNFDRYWSQFPHAT
                     LTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRLNKSIREGDFFTNQAFLDAVA
                     HVKAHNSKLHIMGLLSDGGVHSHYEHMFALLKLAKQQDLNDVFVHGFLDGRDVGPTTA
                     LDYIEETEKQMSEIGIGQFASIHGRYYAMDRDKRWDRVALTYNVLVDGVGQTAESAKS
                     GVAASYEREVTDEFVIPFSIQEHGEPVATIGDNDAVIFFNFRPDRAIQLSKVFTNEDF
                     DGFAISAKHPKNLKFVSFTHYSDEVNAQIAYENDNLKNTIGEVLAMNGKTQLRIAETE
                     KYPHVTFFMSGGREEKFLGEERILIASPKVATYDLKPEMSAYEVTEALLAEIEAEKFD
                     GIILNFANPDMVGHSGMLEPTIKAIEAVDECLGKVVDALLAKGGAAIITADHGNSDEV
                     VTLAGQPMTAHTTNPVPVIVTKPNVVLRNGGILADLAPTMLELLQVSQPTEMTGQSLI
                     EKEEN"
     gene            486113..487405
                     /gene="eno"
                     /locus_tag="BSPH_RS02355"
                     /old_locus_tag="Bsph_0468"
                     /db_xref="GeneID:6022043"
     CDS             486113..487405
                     /gene="eno"
                     /locus_tag="BSPH_RS02355"
                     /old_locus_tag="Bsph_0468"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228070.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_012292248.1"
                     /db_xref="GI:501249230"
                     /db_xref="GeneID:6022043"
                     /translation="MPFITQVYAREVLDSRGNPTVEVEVFTESGAFGRSIVPSGASTG
                     EYEAVELRDGDKSRYLGKGVLKAVENVNTIIAQELEGNYSVLDQVVIDKALIELDGTE
                     NKGKLGANAILGVSMAVAHAAADYLDVPLYQYLGGFNSKQLPVPMMNILNGGAHADNN
                     VDIQEFMVMPVGAESFRHALRIGAEIFHNLKAVLKDKGYNTAVGDEGGFAPNLGSNEE
                     AITVILEAIEKAGYKPGEEVKLAMDVASSELFNKEDGKYHLDGEGVVKTSEEMVDWYE
                     ELTNKYPIISIEDGLDENDWAGHKLLTERIGSRVQLVGDDLFVTNTKKLAAGIEQGVG
                     NSILIKVNQIGTLTETFEAIEMAKRAGYTAVISHRSGESEDATIADIAVATNAGQIKT
                     GAPSRTDRVAKYNQLLRIEDQLGSTAEYLGLKSFYNLK"
     gene            488117..488653
                     /locus_tag="BSPH_RS02360"
                     /old_locus_tag="Bsph_0469"
                     /db_xref="GeneID:6022413"
     CDS             488117..488653
                     /locus_tag="BSPH_RS02360"
                     /old_locus_tag="Bsph_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292249.1"
                     /db_xref="GI:501249231"
                     /db_xref="GeneID:6022413"
                     /translation="MQRKTKSAIVIIAVLVIFGGIFGYFKFTEPMEKPTPVKEKAIVE
                     NAGVTLDDKRVTKEELLYPDNLIEHKMNEAIHSMSHQKVEAKTKWGHTQITQAKVDRL
                     LEISKESNYKFRELYIEILERWSKGDFSHAIEDHNAIWEMQGGDESGNSGKAIRLLTP
                     AEEQAYIENNLTYDLYDK"
     gene            488771..489292
                     /locus_tag="BSPH_RS02365"
                     /old_locus_tag="Bsph_0470"
                     /db_xref="GeneID:6022414"
     CDS             488771..489292
                     /locus_tag="BSPH_RS02365"
                     /old_locus_tag="Bsph_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_012292250.1"
                     /db_xref="GI:501249232"
                     /db_xref="GeneID:6022414"
                     /translation="MKILETERLILRLQTTEDALFILELVNDPSWIQFIGDRGVKTVE
                     EAASYIENGAIRMYEQFGFCLYVVEIKENQTPIGICGFVKRETLEDVDIGFAFLPDYW
                     GKGYAYEAASAVLAYGLVTLGFNRIVAITTQENYASAKLLERIGLQFERVIQFSNDSE
                     ELRLFSLNGEKSK"
     gene            complement(489357..490532)
                     /locus_tag="BSPH_RS02370"
                     /old_locus_tag="Bsph_0471"
                     /db_xref="GeneID:6022415"
     CDS             complement(489357..490532)
                     /locus_tag="BSPH_RS02370"
                     /old_locus_tag="Bsph_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein dltD"
                     /protein_id="WP_012292251.1"
                     /db_xref="GI:501249233"
                     /db_xref="GeneID:6022415"
                     /translation="MIKKGFLSLFIAFALFTGFVFFPNSWIKAWISEDDVEQAKTNMS
                     PLVFQGTYLQERMLQEPTSMPLYGSSELNRFDPFHPYNYTRATDAPYSTFMIGRGGMQ
                     SITHFLNFAAQEKNLAGKKLVFIISPQWFTEKGMGEFHFSPNYSMLHAYDLAFNDDMD
                     ADLRKQAMERLLEFDTVERDRLLKTMYQYQMSNGKKHPVTGRMAMVAGRFHKELLEKK
                     DLYYSLFPRKGHPLKNNDKLVTDQSFEQQIQHAEAYGEKRVSNEYMIENRAFKRLVNA
                     NFSKFKDMRKHEDYTESPEYKDFQLVMDVLKDAGAKPLFISIPVNGYWYDYNGYPKER
                     RQQYYEKMAQLLKDADVDYVDFTDHEYDPYFIMDTIHIGWKGWVYLDQHMDKYWAQQ"
     gene            complement(490529..490762)
                     /locus_tag="BSPH_RS02375"
                     /old_locus_tag="Bsph_0472"
                     /db_xref="GeneID:6022416"
     CDS             complement(490529..490762)
                     /locus_tag="BSPH_RS02375"
                     /old_locus_tag="Bsph_0472"
                     /EC_number="6.1.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292252.1"
                     /note="D-alanyl carrier protein subunit; involved in the
                     incorporation of D-alanine into membrane-associated
                     D-alanyl-lipoteichoic acid; D-alanyl carrier protein is
                     the acceptor of activated D-alanine which it donates to a
                     membrane acceptor(D-alanyl transferase) for incorporation
                     into membrane lipoteichoic acid; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--poly(phosphoribitol) ligase"
                     /protein_id="WP_012292252.1"
                     /db_xref="GI:501249234"
                     /db_xref="GeneID:6022416"
                     /translation="MDKQQVLEMLVELCEDEIIVENPDIDLFEEGLLDSFGTINLLVE
                     IENRFNISVPITDFNREEWNTPNRIAGKLAERQ"
     gene            complement(490811..491974)
                     /locus_tag="BSPH_RS02380"
                     /old_locus_tag="Bsph_0473"
                     /db_xref="GeneID:6022417"
     CDS             complement(490811..491974)
                     /locus_tag="BSPH_RS02380"
                     /old_locus_tag="Bsph_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine transporter"
                     /protein_id="WP_012292253.1"
                     /db_xref="GI:501249235"
                     /db_xref="GeneID:6022417"
                     /translation="MTPYGNIAFFLIIGLLLLPTILLGLRGKSAKHYNLFVSLIVLAL
                     IFGHSLNGSISLILFTVFQIILITAYQRYRLRQNNGPVFVMAVLLSILPLVLVKVLPI
                     LGLHHLFGFLGVSYITFKAVQMILETRDGLMKEKISIAELAYFLLFFPTVSSGPIDRW
                     RRFTKDFHSVPSSEDYQKLLLSGINYIFVGFLYKFILAYLIYNYTLIYLPNHTYNYLT
                     PFQGQLAYMYMYSFYLFFDFAGYSAFAVGVSRIMGIQTPINFNRPFASRNIKDFWNRW
                     HMSLSFWFRDYVYMRFVLWMTKKKWLKNKFTISYIGFFLLFFLMGIWHGLEWHFVVYG
                     LYHALLIISFDKFERWNKKHKLWPKNKWTHAIGVFITFNAVCFGFYIFSGKLF"
     gene            complement(491971..493446)
                     /locus_tag="BSPH_RS02385"
                     /old_locus_tag="Bsph_0474"
                     /db_xref="GeneID:6021199"
     CDS             complement(491971..493446)
                     /locus_tag="BSPH_RS02385"
                     /old_locus_tag="Bsph_0474"
                     /EC_number="6.1.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--poly(phosphoribitol) ligase"
                     /protein_id="WP_012292254.1"
                     /db_xref="GI:501249236"
                     /db_xref="GeneID:6021199"
                     /translation="MLSILAAIERVAIQQPQKTAYQTHNASLTYGELWHFSDCIADYI
                     MTHHLQRQQPIVVYGHMSPLQIVAFLGAVKAGHPYVPVDSSTPSERLQLILEASKAGL
                     LFTTEPLQMLTNIPVVAVSDVLDSPSLPNSPATRDWVQQEDIHYIIYTSGSTGQPKGV
                     QITANNLAHFVTWMQEHFPLQKSGVFLNQAPYSFDLSVMDLYPALVGGHTLYAITQQE
                     IANPRALFDSLALSNTRVWTSTPSFAKMCLMNKEWEQQLMPALDTFLFCGEVLPIAVI
                     KELMQRFPQATIYNLYGPTETTVAVSYVKVTKALLEQFEQLPIAPISEPNVSLLDDGE
                     IVISGSTVSAGYLGAPELTAKAFPTVDGHRIYQTGDMGYEQDGYLFFLGRKDFQVKLH
                     GYRLEIEEIEKQISNLPPVSSCVVVPVYKDKEIVSLNAHIVLREPLADSAFKMTKQLK
                     ALLSEYLPAYMIPRTFKYMDALPLNANGKVDRKGLAVMETV"
     gene            complement(493464..493601)
                     /locus_tag="BSPH_RS02390"
                     /db_xref="GeneID:23319644"
     CDS             complement(493464..493601)
                     /locus_tag="BSPH_RS02390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004228095.1"
                     /db_xref="GI:490348322"
                     /db_xref="GeneID:23319644"
                     /translation="MQSIKNNEYLRFIGFTLFYLIVLVLLFLIHGFHDMNAGPFIYTE
                     F"
     gene            complement(493882..495528)
                     /locus_tag="BSPH_RS02395"
                     /old_locus_tag="Bsph_0475"
                     /db_xref="GeneID:6021200"
     CDS             complement(493882..495528)
                     /locus_tag="BSPH_RS02395"
                     /old_locus_tag="Bsph_0475"
                     /EC_number="3.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_012292255.1"
                     /db_xref="GI:501249237"
                     /db_xref="GeneID:6021200"
                     /translation="MKYAKKWASLFLASAVTLSAVSIPQQDVQAAPVKKPTNVIMLVM
                     DGSSNNAVTLSRWYKGESLAMDEILSGAMRTYSAESAITDSAPAATALATGNKSNDKY
                     IGVLPSEINSPGLAQIDKKDAFRPVANVLEGAKQQGKATGLISTSEIQHATPAGFSAH
                     ANNRSQYGDIAEQQVYQNIDVVLGGGLESLTPGTSKNARKDGEDLLKVLKDHQYDLVH
                     TRDELLNSPSSKIWGSFAPSALAYDLDRAKTRKSEPTLAEMTNKAINTLKKDKDGFFL
                     FVEGSKVDWAAHANDTIGIISDILSFDDAVKEAVDFAKEDGNTLVIAVTDHGNSGITM
                     GNANTTSTYSSIPVSAYIDPLKKASMTVEGALSQLKEDRSNLVEVAALYGLDPLTKDE
                     LSTLKSAKDVGSEMVKMLANRANIGYTTGGHTGEDVFLYSFGPSKLTGLVENTDVAHT
                     MAQFMGFDLKSLTDDLYVPATKAFTKKGFTTKIDLSDKENPIFIAQKADVTVKIPVNK
                     NTMIYEQASKNTTKTHTFNTINVYNGSEFYVSKKVINAVK"
     gene            complement(495707..496980)
                     /locus_tag="BSPH_RS02400"
                     /note="peptidase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319645"
     gene            497189..497416
                     /locus_tag="BSPH_RS02405"
                     /old_locus_tag="Bsph_0478"
                     /db_xref="GeneID:6021203"
     CDS             497189..497416
                     /locus_tag="BSPH_RS02405"
                     /old_locus_tag="Bsph_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008173196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_008173196.1"
                     /db_xref="GI:495448502"
                     /db_xref="GeneID:6021203"
                     /translation="MHTVVLVSLVIVSLALIVVVLLQSSKSAGLSGAISGGAEQLFGK
                     QKARGMDLILHRATIVLAILFFILAIAITKI"
     gene            497605..498351
                     /locus_tag="BSPH_RS02410"
                     /old_locus_tag="Bsph_0479"
                     /db_xref="GeneID:6023636"
     CDS             497605..498351
                     /locus_tag="BSPH_RS02410"
                     /old_locus_tag="Bsph_0479"
                     /EC_number="3.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009373237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_012292258.1"
                     /db_xref="GI:501249240"
                     /db_xref="GeneID:6023636"
                     /translation="MNKSLSQPFFFQAGPRAVLLLHGFTGSSADVRMLGRFLEKKGYT
                     TLAPHYKGHGVEPEELITTGPADWWQDVVAAYKQLQDAGYEEIAVAGLSLGGVMALNV
                     ALNNPVKGIVTMCAPMTMRTTDVMFDGVLKYAKDYKKFQGKQEEQIETEVALIAEKGM
                     PSLQELREFIVRTRQEIDMIYAPIFVVQATNDEVIETESANIIYNQTESLDKHIKWYE
                     NSKHVITLDQEKDQLHEDIYRFLESLNWAQ"
     gene            498391..500862
                     /locus_tag="BSPH_RS02415"
                     /old_locus_tag="Bsph_0480"
                     /db_xref="GeneID:6023637"
     CDS             498391..500862
                     /locus_tag="BSPH_RS02415"
                     /old_locus_tag="Bsph_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="WP_031417774.1"
                     /db_xref="GI:670469113"
                     /db_xref="GeneID:6023637"
                     /translation="MKDQKDTLQGRLLVFFGQDDYEPLTVGEIEDEFGFEDAEEFKEL
                     VKTLVRMEGQGLVVRSRSNRYGLPERMNLLRGKFIGHAKGFGFVAPDMEGMDDVFIPP
                     HEINGAINGDIVLIRVLKESFGDRREGTVTKVVERGQTSFVGTFQANRGFGFVVLDDK
                     KLPMDIFIAKGDTLGAVDGHKVVVEVATWPEDLKSATGYITKILGHKNDPGVDILSIL
                     YKHDIPPEFPDEVIAAAQRVPDDITEADLVGRRDLRHETIVTIDGADAKDLDDAVTVT
                     KNVDGTYKLGVHIADVSYYVTQGSVIDLEAYDRATSVYLTDRVIPMIPHRLSNGICSL
                     NPQVDRLTLSCEMIIDANGNVIAHEIFQSVIKTTERMTYKDVYKILEEQDEALMKRYE
                     PLVPMFKNMAELSGILRRKRESRGAIDFDFKESKVIVNEEGWPVDIELRERTVAEKLI
                     EDFMLAANETVAEHFHWMNVPFLYRIHEDPKPEKLQRFFEFVTNFGILIKGTGNTVHP
                     KALQDVLKAIEGMPEEPVISTMLLRSMQQAKYYPESLGHFGLSTDFYTHFTSPIRRYP
                     DLIVHRLIRTYLINKDTSRETVAQWGMAMDEIADHTSERERRAVDAERDTDALKKAQY
                     MSDKIGEEFEGIVSSITNFGIFVELPNTIEGLVHISNMTDDYYRFDDRQMIMIGERTN
                     RQFRIGDEVTVRVANVIIEESSIDFEIVGMVTSYGRTRKAAPTVIHARKNYNDNKGGR
                     SSRSTRSDDEKGGRGGSRRSSRHEEESGSRSTKRGERREGDRDPRGRRKDDSSSPGPK
                     KRVKQKQKFYEGIAKKNKKKKSKRK"
     gene            500934..501401
                     /locus_tag="BSPH_RS02420"
                     /old_locus_tag="Bsph_0481"
                     /db_xref="GeneID:6023638"
     CDS             500934..501401
                     /locus_tag="BSPH_RS02420"
                     /old_locus_tag="Bsph_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HWE9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_012292260.1"
                     /db_xref="GI:501249242"
                     /db_xref="GeneID:6023638"
                     /translation="MAKGSGKVLAQNKKAGHDYFIEDTIEAGMVLTGTEIKSIRAGKA
                     QLKDSYVRITNGEAWISNMHVSPFDQGNRFNHDPLRARKLLLHKKQIGELVGAVKRDG
                     YTIVPLKMYIKDGYAKLLIGVGKGKKDYDKRNDMRKKEAKREMERTFKSKNQY"
     gene            complement(502433..503605)
                     /locus_tag="BSPH_RS02425"
                     /old_locus_tag="Bsph_0482"
                     /db_xref="GeneID:6023639"
     CDS             complement(502433..503605)
                     /locus_tag="BSPH_RS02425"
                     /old_locus_tag="Bsph_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012292261.1"
                     /db_xref="GI:501249243"
                     /db_xref="GeneID:6023639"
                     /translation="MAKKKVSPIKSYELKNGETRYEFPVYLGIDPLTGKQKRTMKRGF
                     KTHKQAELALARIKLDVANGTYKQARAETYQELYDLWIPHYEKTVEESTFTKTVGIFR
                     NHILPAMREYKIDKITVDVCQKHVDKWAEKLKKFRVVKAYAAKVLDFAIKRGYMQTNP
                     FTHVDMPIAASKKVTIIEEEEAENFYTREQLIQFLACLEQENNYKAYALFRLLAFSGM
                     RKGEALALTWNDLNFTTNEMRINKALSRGKNNKLYVKSTKTGFARTIKMDDKTMAILK
                     EWKKKQKQEYLVLGFNTMQPKQLVFSNERNEFLQPTKTRKWILHVQKKYKLGTITTHG
                     LRHTHCSLLFEAGASLKEVQDRLGHSDVQTTMNIYAHVTKKAKEEAIQKFASYLEM"
     gene            complement(503714..503953)
                     /locus_tag="BSPH_RS02430"
                     /old_locus_tag="Bsph_0483"
                     /db_xref="GeneID:6023640"
     CDS             complement(503714..503953)
                     /locus_tag="BSPH_RS02430"
                     /old_locus_tag="Bsph_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292262.1"
                     /db_xref="GI:501249244"
                     /db_xref="GeneID:6023640"
                     /translation="MEYTNIQKIEDVILKTLNSALNNGLVKEWLSLSEAAKYIGVSYN
                     TFIKFRHMGLKVCEIDGIKRVSRKEIDSFLESHSF"
     gene            complement(503970..504896)
                     /locus_tag="BSPH_RS02435"
                     /db_xref="GeneID:23319646"
     CDS             complement(503970..504896)
                     /locus_tag="BSPH_RS02435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012103267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036163126.1"
                     /db_xref="GI:738207217"
                     /db_xref="GeneID:23319646"
                     /translation="MNANFTIPLTSDSGIHFEKFLNTITQNDSVLYDRLQELFGYVLS
                     EIRDIKYIPILIGQKDTGKSVILKLLEYIIGEDNFSNISIDQFNNSVYLAELYGKRLN
                     SCAEISELNLKRLDILKKLSGNDYVTARPMYSDPIKFINQSVLLFAGNNLPNIENLDS
                     SSAFKERLLLFPFNNPIPKEHQDNELIDKLIAEIDYIAHWSIKGIHRLLNNNFQFTTS
                     FEIEDTFKPYLSNSLEEFLLSECAYQTKYQIHTDDLYQAYIVYCENYSFKIISKKSFI
                     QILKKQSNLSFRRFRMRGTNKYGFIGIGLKNF"
     gene            506073..507356
                     /locus_tag="BSPH_RS02440"
                     /old_locus_tag="Bsph_0485"
                     /db_xref="GeneID:6023583"
     CDS             506073..507356
                     /locus_tag="BSPH_RS02440"
                     /old_locus_tag="Bsph_0485"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292264.1"
                     /db_xref="GI:501249246"
                     /db_xref="GeneID:6023583"
                     /translation="MDKPCFSRKILKTRIDEYTSNVDEFLQNYKGDMLSISLSNKDIQ
                     FNGLKQIYQYMNIFNLANANNFYTKEAQLQALNIEEICALQDKFIEDLIIVKLAESIQ
                     NIRGFFRKKKNQKEFKPIFEKMTFSEKEIEKISKNVFFSKFEKIRDYFEMYADEIAQN
                     IERAYLPIFIYSLYLRHNEDGFMDIEVKSVLKKRSMELRYTKSKKYDLDSETNVFETA
                     QENLAIFIEINTIFSEEYNLNWSLSLYEFNNYTNLLDIYELSNSISNSKLKNTLLDDK
                     LYKIEKKKQKKRLKKFIQNEKSLLLDLKEDKKFFNDNFYKLEPVSFKLYIGDALYNPI
                     INDNSDIWIICEKLFKHCKVEIERFVENNKMGILGNNKKFPSEIINDLIIIELFGKHN
                     PYDIWKNINFYKMDPIHKKVYRRIYKEAYSSINKK"
     gene            complement(507511..507990)
                     /locus_tag="BSPH_RS02445"
                     /db_xref="GeneID:23319647"
     CDS             complement(507511..507990)
                     /locus_tag="BSPH_RS02445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_036162518.1"
                     /db_xref="GI:738206605"
                     /db_xref="GeneID:23319647"
                     /translation="MKGLDRMDKIKSLPAKRINIVQIKLIREKSILYKDRQIRSPQNA
                     CEIIQNFSGDNDREHFVVLCLDTKNQPTCLQIVHIGNLNASIVHPREVLKSAILSNSA
                     SIIVAHNHPSNNCEPSPEDIEVTKRLIKAAEIIGITLMDHLILSTDSFKSLKELGYI"
     gene            complement(508420..508767)
                     /locus_tag="BSPH_RS02450"
                     /old_locus_tag="Bsph_0487"
                     /db_xref="GeneID:6023585"
     CDS             complement(508420..508767)
                     /locus_tag="BSPH_RS02450"
                     /old_locus_tag="Bsph_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_036162520.1"
                     /db_xref="GI:738206607"
                     /db_xref="GeneID:6023585"
                     /translation="MYTRIKEIRNALSMNQTEFAQHLGLSQSTLAMIEVGKRTFSDKH
                     IKIICSTFNINEDWLRNGKGEMFNSSLYEKELIEIFDSLTPETQEYLLVIAKELLNTQ
                     QKLLNSKYIDDNQ"
     gene            509843..510874
                     /locus_tag="BSPH_RS02455"
                     /old_locus_tag="Bsph_0490"
                     /db_xref="GeneID:6023897"
     CDS             509843..510874
                     /locus_tag="BSPH_RS02455"
                     /old_locus_tag="Bsph_0490"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292269.1"
                     /db_xref="GI:501249251"
                     /db_xref="GeneID:6023897"
                     /translation="MGNLVLFLAVFVVFVLGSFFIIQSLIRQIKIRRAIQANKLLLNR
                     MRDKNEDGNFHTYNNLLHQTLVNLKGRIKNLPYKKLQSVIDKEINNLTGGYVRRFVSS
                     IWVLLKFTFALVFVFMSFMFALIVIDEFKVVENVQDVFDINSNNDVRDIESDDNPLTT
                     QESKDDRDKQIYEEGLTAYNEGRTSEAVEALNKINGKSEYYEKSQEMLKDIDKKIYWE
                     NIKYPNYAEITKSPQNYIEKKVGFTGSILDVVEYNGKTMMIIGTDLINDYYKVYGGDI
                     LVLYGNVTGYEEGDFVSIAGTMKGSYIETEQKGLIGSYLNNASSFSPSGYVNINQMPV
                     IIADIIDYQ"
     gene            complement(511573..512892)
                     /locus_tag="BSPH_RS02460"
                     /old_locus_tag="Bsph_0492"
                     /db_xref="GeneID:6023899"
     CDS             complement(511573..512892)
                     /locus_tag="BSPH_RS02460"
                     /old_locus_tag="Bsph_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292271.1"
                     /db_xref="GI:501249253"
                     /db_xref="GeneID:6023899"
                     /translation="MAYNSKGGLPFESASKLGHLSLMNSEWINSLVKDFEAQFSSPSS
                     SVTSNWTEFNSSSQNLIDQIWVVDGSYVPVQSDATPPKEVAFIKTAILNISEASLKNI
                     DKYNPHPMDLQKIMKDNALFHSTVLPLRNIKSSKGTNFDTIRNIIFESIKIDEKGEYF
                     ETLKWLAYQKWLVAPTNSPSFNCPYCETNLEFTADLEKMNCTTCSKELYLTDMIGFHL
                     DMTEDKATDAIASAYMSIMEHLMLFTIIRLYWSKQDKSLFINTLFIKDGPLSLNSQYV
                     KLIPRIRDFLEYAKQQGILINILGQEKSGKFVDHLSTIARYVKPLEKCDRLHYHVLSH
                     KYVETEVQDKPSTINYGQRSNWGEKVLVKVDPVTQLVINVPTGDYLDRKNAPLANELI
                     NLEVILTVIPHIISRRFLGGLYPIELANGIASLSSYPSAKILQKLLE"
     gene            complement(512909..514894)
                     /locus_tag="BSPH_RS02465"
                     /old_locus_tag="Bsph_0493"
                     /db_xref="GeneID:6023900"
     CDS             complement(512909..514894)
                     /locus_tag="BSPH_RS02465"
                     /old_locus_tag="Bsph_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292272.1"
                     /db_xref="GI:501249254"
                     /db_xref="GeneID:6023900"
                     /translation="MSAIQGLVSNAVLSNNPLIMLKDFLDNQHQLHSAGVKQDYRFIG
                     YVLDLGYDTAKIITSDPYKIAVGGIPRGSFLILALDERDEQGNPIQTGLPPHFTLLRV
                     KSVSSTPLSNQVQQTYFELHKKSMPELDIWTQAELQWGALECDVIGMFYPNPSDNNLV
                     EFSGDVNNVVSAHKYKVFSPDKDLLDLILNGLVNKKNQQQLGVFRPTECQIGLSNNNY
                     PEINISIEDFKGRRTAMFGKTRLGKSNVVKVLADAIIRTSITTQSVGQLIFDINGEYA
                     NDNPQDGNRSLASAHPNDCVVYALNPRNSSFKELKINFSDQPDSAISILKSFLERDKK
                     TSDYIKSFANVELPSIMEIKSESDKGKQTRGIRKIQMFWAILKSAGFSMDESKLNSLN
                     LSSGTSRGFNPGYSKNLREAIYSGNVPNHPSSLNDLVNELKILSTFVQNNKDSKLLMG
                     SSEPLFDQDALALLRFLNPSTGSGPQILTSYRQYHSPNAGDFINEIIQFLNDGKTVIL
                     DLGNAAQEIRQYFSDMLSKAVFAAQENKFVSNTLGNHFIQLYFEEAHNLFPNSNKDND
                     TVYHRFAKEGAKFHIGMVYSTQSPSTISQELLVQTENFFVGHLASTNEANALSKLQHT
                     FSGLEEDIKKSRTPGYMRTLTNSHRFVIPVQVKKFTV"
     gene            complement(514907..515722)
                     /locus_tag="BSPH_RS02470"
                     /old_locus_tag="Bsph_0494"
                     /db_xref="GeneID:6023625"
     CDS             complement(514907..515722)
                     /locus_tag="BSPH_RS02470"
                     /old_locus_tag="Bsph_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_036160521.1"
                     /db_xref="GI:738204603"
                     /db_xref="GeneID:6023625"
                     /translation="MSNKEILPFLTWAGGKRWLVNNYPEIFPSDFNVYIEPFLGSGSV
                     FFHLKPQKAILSDINEDLINTYIALKTDWQNVYKHLKIHQRKHSPDYYYKIRDYTPRK
                     LETKAARFLYLNRTCFNGIYRVNKQGKFNVPIGSKQNVILNTDDFKEISDRLKSVLIL
                     NHDYEAIINMATRDDFIFVDPPYTVNHNDNGFIQYNEKLFSWADQVRLCEALGRARDR
                     GAKIIVTNANHESVRNLYEGHGFEYQIVSRFSGISSKAKGRKKYEEIIVKSNF"
     gene            516141..517886
                     /locus_tag="BSPH_RS02475"
                     /old_locus_tag="Bsph_0495"
                     /db_xref="GeneID:6023626"
     CDS             516141..517886
                     /locus_tag="BSPH_RS02475"
                     /old_locus_tag="Bsph_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003209788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041658734.1"
                     /db_xref="GI:753951655"
                     /db_xref="GeneID:6023626"
                     /translation="MELFRQFIELREEQERLTNLINDIQENGFEINFIKKKIYLYKNG
                     IAYIGLDCQNIEREKLISVFLIKESKSRRIQEIDSYFIDYFNANLKDIVINLEIENLF
                     LESKAYLLEELFMLEQLISEDLTVDFRINSIKFEEYKCFKDEEITFEERITVLVGKNA
                     SGKTSILDAISVAIGAYLSGIDESTDTKSILKSDVRFTSKDVHGTKVVKHHAPTRINF
                     NSDFINKRFDWSRTRSKLKSTKLTTKDSKQVVNLSRFLYREINNNDLRNITLPVFSYH
                     GTGRVANFTKNMNQLEKTENISRFFGYKDCLKPASNYKTFISWYSKMQYRAFMLNKRI
                     EVLDQVTKCLKETFVFLTEEDKNKVSDVIYLEGSLHLKYSNGDMIPIEFLSDGYKDII
                     GIISDIAYRMAILNPHLEKDVIKATPGIVLIDEIDLHLHPRWQQKIIKLLKNLFPKVQ
                     FVVTTHSALVVSSTEYREAKELKVVEENLNENFTIVAEIIGDSKEWYIHDILRNVFHV
                     DPLLHTRLTSEYIDQDEVDDLINDLNEYVKKYLVSREEHILKKINTLNGKLNTCLTPN
                     TPKKRVVDALMEMVR"
     gene            517883..518614
                     /locus_tag="BSPH_RS02480"
                     /old_locus_tag="Bsph_0496"
                     /db_xref="GeneID:6023627"
     CDS             517883..518614
                     /locus_tag="BSPH_RS02480"
                     /old_locus_tag="Bsph_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002738635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292275.1"
                     /db_xref="GI:501249257"
                     /db_xref="GeneID:6023627"
                     /translation="MKAYYRNPKEIPKKLIDDINKKKWYENLRDGKNNIRDRWNTTQE
                     DKRPIIREKLYQITNGCCAYCGKKIKISEMDVDHFLPSHKFNYLSYCWLNYIPSCKTC
                     NQSFKHQYYPKSIAEKQIIEHCCQGIVVPFDATYNQNILFTVTQDRIIDPFYDDISIH
                     LTFQPLTYSYKAHTDIGKEMNKIFFRRQEFIEYIEGISFAVKRLVKNNNPRNILDPFI
                     NLYGSEFYYNAYWDFWSERKSDGLL"
     gene            complement(518937..520217)
                     /locus_tag="BSPH_RS02485"
                     /old_locus_tag="Bsph_0497"
                     /db_xref="GeneID:6023628"
     CDS             complement(518937..520217)
                     /locus_tag="BSPH_RS02485"
                     /old_locus_tag="Bsph_0497"
                     /EC_number="2.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease BsuRI"
                     /protein_id="WP_012292276.1"
                     /db_xref="GI:501249258"
                     /db_xref="GeneID:6023628"
                     /translation="MEFKGKEKGRGKFKPAPDLDRETVRNVLLNKISEEKALIIDDPK
                     DLEVLKQVQYKSKKYNVVGLFSGCGGLDLGFELAGLIAEIGEENAMTAFKNKEKFDEI
                     RHKSVFNTIYTNDMFKEANETYKLNFPDHIIQHEKDIRKVANFPMCNLMLGGFPCPGF
                     SEAGPRLIDDERNFLYIHFIRALMQTQPEFFVAENVKGMMTLGKGEVLRQIVEDFSSA
                     GYEVTPYLVNSRDFGVPQLRERVFLIGVHKEKIAEKYGFKYPKPQPTHGDGLKPYVTL
                     RDAIGDLEESPGPYFEGTYSPIYLSRNRKKTWEEQSFTIQASGRQAPIHPSGEPMRYI
                     EKNKWELVGENRRLSVKEIARIQTFPDWFEFSDGAKEKMSESGRLDKKYKQIGNAVPV
                     LLAKEIAKPIAEFAKMHLQNKDEQEEPMLQLSLF"
     gene            complement(520319..521215)
                     /locus_tag="BSPH_RS02490"
                     /old_locus_tag="Bsph_0498"
                     /db_xref="GeneID:6023629"
     CDS             complement(520319..521215)
                     /locus_tag="BSPH_RS02490"
                     /old_locus_tag="Bsph_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160533.1"
                     /db_xref="GI:738204615"
                     /db_xref="GeneID:6023629"
                     /translation="MSNFSQNERYVLSLFSPNNEFVYGGVRYKVVESGKPTSSKGEPK
                     TDIYVMSISLDNSKYLEFKISFKQDNADFLENKMTAERAEQIFGPNWQNIIESFTSSI
                     DQKFATRNYIFKNKEGRTSAGSITLGWRFELVNKSGGGLSGLANLTPEQVLEVYAGRK
                     LAASKKNAIVNGRIIEDSGVANCMINCDVSSLQSIQDAIDSIISIEDFAQNNPNVYFV
                     CKALNYRSFDDKIEGNRPLSVFINWEVVDNKLVPNLVYSNPLLTKGNEVRDKLKESLN
                     LLKISNTNDINEDNFASFQIVN"
     gene            complement(521772..523520)
                     /locus_tag="BSPH_RS02495"
                     /old_locus_tag="Bsph_0499"
                     /db_xref="GeneID:6023509"
     CDS             complement(521772..523520)
                     /locus_tag="BSPH_RS02495"
                     /old_locus_tag="Bsph_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_012292278.1"
                     /db_xref="GI:501249260"
                     /db_xref="GeneID:6023509"
                     /translation="MMKKNLRLQSISGKLMLLITIIILVTVVIIGSTSYWVAKDQLLE
                     SGQRELQSIVKGAYTSIELINEEVESGKITLEEGKEQARIILNGPVNEMGEYDYQKSN
                     FTYKENGYILAFDEDLVLQLHPSKIGGAPADDLNRSNREKIIAGGKSKNESDRFVIYS
                     DKQPDGSFKDKTAYTEYFEPWGWTIGIAVFQDEFYEGLNILQYIIFGATVVLITLSSL
                     VFYLGIRKKLNTLKEVAEAATKISDGHIMVTHLPESNDEIGQLATAFNKMSQQLCTLV
                     EKTKNTSEHLLDSATNLSAVSEETSASSDEVGRAITEIATGTQEQAHDLDTINQTVEL
                     LSNSIETTEKQSKVMYDITKHAEKISSEGIEIVQQLQQSNTISLAASQEVSDEIKKLH
                     DQINQITQVMETIETIAEQTNLLALNASIEAARAGEYGRGFSVVADEIRKLAEQSKMA
                     THQVQGVVSSIVSETTKTVETVEGTMETAKKLNDDVALTQSKFNQMSDSVKQIVESIL
                     AVNKEMDVMTSYNKLMSEGIESASSVSEQTAASVQEIASSIDEHIKAITDVAHAAEKL
                     TELNRELNTLMERYTI"
     misc_feature    523913..524164
                     /note="T-box leader; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            524246..525607
                     /locus_tag="BSPH_RS02500"
                     /old_locus_tag="Bsph_0500"
                     /db_xref="GeneID:6023510"
     CDS             524246..525607
                     /locus_tag="BSPH_RS02500"
                     /old_locus_tag="Bsph_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_012292279.1"
                     /db_xref="GI:501249261"
                     /db_xref="GeneID:6023510"
                     /translation="MNDNHQDSQLKRGLSTRHMQLIALGGSIGVGLFYGSSSTIQMAG
                     PSILLAYLIGGLVIFTIMRALGEMAVAEPVSGSFSTYANKYLGRFAGFLSGWTYWFMW
                     IVVGMAELTVVGVYINYWFPDIPQWVTALVVLVMMTLVNLANVKAYGEFEFWFAMIKV
                     VAIIGMIVLGLTIIFFGVGNHGEAIGFENLWAHGGFMPNGFHGILMSLVLVMFSFGGV
                     ELVGISAGEAKNPSKSIPSAINNIVWRILIFYIGALGVMMVIYPWNEVGSEGSPFVQI
                     FDYVGIPAAAHIINFVVITAAMSAFNSGLYGSGRMLHNLSVQKNGPNYFKTVSKNGSP
                     RRGILFSSAVLLMAVVLNYVVPEKVFIYISAVATVAVITSWMIILFAQLKFRRAKTKE
                     EVAELKFKIPLYPLSTYIAIAFLLMVIVLMAFIPDMRVALYVAPIWFLILFVGYKGIN
                     IKK"
     gene            525749..525898
                     /locus_tag="BSPH_RS02505"
                     /old_locus_tag="Bsph_0501"
                     /db_xref="GeneID:6023511"
     CDS             525749..525898
                     /locus_tag="BSPH_RS02505"
                     /old_locus_tag="Bsph_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_012292280.1"
                     /db_xref="GI:501249262"
                     /db_xref="GeneID:6023511"
                     /translation="MGKYQLDTKGKVAVAKYHEKHKPAKFDKKQQLEKIRAEYLKKKQ
                     EQTDQ"
     gene            complement(526048..526443)
                     /locus_tag="BSPH_RS02510"
                     /old_locus_tag="Bsph_0502"
                     /db_xref="GeneID:6023512"
     CDS             complement(526048..526443)
                     /locus_tag="BSPH_RS02510"
                     /old_locus_tag="Bsph_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_012292281.1"
                     /db_xref="GI:501249263"
                     /db_xref="GeneID:6023512"
                     /translation="MELEYFRFYEKPIKAIELMKLYNDAGWWEERKEQDIEEMLKREI
                     SIGVWKDGTLIGFARAVTDGKFRAYIEDVVIHKAYQKSGIGKNLVSKLLDELSHIDVI
                     SLFCEEHLIPFYKKNNFKYSKSQFVLHRK"
     gene            complement(526539..>526823)
                     /locus_tag="BSPH_RS02515"
                     /db_xref="GeneID:23319648"
     CDS             complement(526539..>526823)
                     /locus_tag="BSPH_RS02515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180055.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162523.1"
                     /db_xref="GI:738206610"
                     /db_xref="GeneID:23319648"
                     /translation="HPDRGKEFDNTLISKALETFGIQQSLSMKGCPYDNAVAEAIFKV
                     FKTEFANGAHFSTLEQLALELDDYVHWFNNIRIHGTLGYLTPVEFKQQTL"
     gene            527070..528074
                     /locus_tag="BSPH_RS02520"
                     /old_locus_tag="Bsph_0504"
                     /db_xref="GeneID:6023869"
     CDS             527070..528074
                     /locus_tag="BSPH_RS02520"
                     /old_locus_tag="Bsph_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012292283.1"
                     /db_xref="GI:501249265"
                     /db_xref="GeneID:6023869"
                     /translation="MARDQNSKRLSLAVLYRRAKRMKKKITIIGKILAGLVIAILLFL
                     LIVFLVNTICSKMEQGKIETYGQSVRVDGKNMNVFIQGEGEEIVVLLPGYGTAAPGLD
                     FQPLVDELSPFYKVVVVEPFGYGLSDLTEKERSSENIVSEVHEALQQLHIERYILMGH
                     SISGLYGLDYVNKYPNEVSGFVGLDSSVPTISEKKIGASIITTIKFLKQSGLARLQVK
                     LGDDPYAELSYDEKTKEQLRMLQHKNLYNSTQLNEAEIMYENFKAAENLSFPKDLPVI
                     FFIQANHPVTDRWVPEHQRQIKNSVYGQVVTFDGDHYLYRAQAKEIVDSLREFMKVVR
                     "
     gene            complement(528229..528873)
                     /locus_tag="BSPH_RS02525"
                     /db_xref="GeneID:23319649"
     CDS             complement(528229..528873)
                     /locus_tag="BSPH_RS02525"
                     /EC_number="4.1.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008180009.1"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and acetaldehyde from
                     2-deoxy-D-ribose-5-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="WP_031417744.1"
                     /db_xref="GI:670469079"
                     /db_xref="GeneID:23319649"
                     /translation="MDYAKLIDHTLLSPNTTEKEIIQLCQEAIQYGFASVCVNPTWVS
                     LSADLLRESDVNICTVIGFPLGANTTETKVFETLNAIGNGATEIDVVMNIAELKNNKN
                     NMLVEKEISMIVNAVQGKALVKVIIEACLLTDEEKIRACQIAVKAGADFLKTSTGFSL
                     HGATAKDVAIMRQAVGPNVGVKASGGVSTMEDIKFMIDAGASRIGTSSAVKILR"
     gene            529269..530540
                     /locus_tag="BSPH_RS02530"
                     /old_locus_tag="Bsph_0507"
                     /db_xref="GeneID:6023872"
     CDS             529269..530540
                     /locus_tag="BSPH_RS02530"
                     /old_locus_tag="Bsph_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_031417743.1"
                     /db_xref="GI:670469078"
                     /db_xref="GeneID:6023872"
                     /translation="MDKQHHRYRWVVFVAVLFTYLLMASQRTAPGLITDQLMSDFGVM
                     ASTIGLLTSIQFFVYTSLQIPMGVLADRFGPNLFLIMGAILTGLGTILYSLGTHEFIL
                     FFSRILTGIGDATIWVNMVLILAQWFQKKEFVRLIGFAGMTGSLGFLLATVPFATLIL
                     LLGWRISFFSTGLLLCLCGVLLYFVLVKNAKRIFSVKSIVEAEVLQREKTSVLLRKIF
                     LNRQAWALFFCHFGVVGGYVGFISSWAVPYGIHMYEMTRSEASQLIMIGLFGALIGAP
                     LTSWLAGRLETIKKPYIGVQLAVLLSWLSFLLRKGHPSLYLLIILFFIIGFGYGASAL
                     TFAAVRQTFPISESGIVSGFANTGGFLSAALLPIIFGYVLDYFQSTSGYLGDGYYYGF
                     FTPVLFSAIGLMGVLLLKEQRMRAGKKMSNR"
     gene            complement(530581..531021)
                     /locus_tag="BSPH_RS02535"
                     /old_locus_tag="Bsph_0508"
                     /db_xref="GeneID:6023873"
     CDS             complement(530581..531021)
                     /locus_tag="BSPH_RS02535"
                     /old_locus_tag="Bsph_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall hydrolase"
                     /protein_id="WP_025116607.1"
                     /db_xref="GI:640692284"
                     /db_xref="GeneID:6023873"
                     /translation="MPRVKYRDADVALMARMMRAEAEGEGQQGMLYVGNVIVNRAVAS
                     CLDFNDVRTIEQVIYQVQGGNYSFEAVQKGNMFYQRARETEKRLAKQNLDFWRQHPAK
                     YALWYFNPYAPCPPTWYGQPFTGQFKNHCFYEPAPDTCESVYMG"
     gene            complement(531163..531714)
                     /locus_tag="BSPH_RS02540"
                     /old_locus_tag="Bsph_0509"
                     /db_xref="GeneID:6022978"
     CDS             complement(531163..531714)
                     /locus_tag="BSPH_RS02540"
                     /old_locus_tag="Bsph_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292287.1"
                     /db_xref="GI:501249269"
                     /db_xref="GeneID:6022978"
                     /translation="MQNIQRSSYTRPRTKTFDLVITAILAALVFVATMFINLKLPFGQ
                     GGLIHLGTSMLFISAILFGPKKGALAGAIGMGLFDIVGGWLIWAPTTIISRALQGFIV
                     GKIAWSKGYKGDHIGLNILGAVVSMPVMIAVYYIGQAIMFNSWIAPLASIPGDVIQNM
                     VGLIIAIPVCVVLKKTPYFKRNF"
     gene            531893..532738
                     /locus_tag="BSPH_RS02545"
                     /old_locus_tag="Bsph_0510"
                     /db_xref="GeneID:6022979"
     CDS             531893..532738
                     /locus_tag="BSPH_RS02545"
                     /old_locus_tag="Bsph_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine kinase"
                     /protein_id="WP_036160536.1"
                     /db_xref="GI:738204618"
                     /db_xref="GeneID:6022979"
                     /translation="MKKVAVIQDMSSFGKCSLTAAMPVLSVMGMQAVPLPTAILTAQT
                     GYSSFYCEDLTSRMDYFMDEWSKLGASFDGIHTGFVTGKEQIDNIFRFLGVFHSTDTT
                     LLVDPVMGDHGEVYKMFTGDLLERMKELVKCADIITPNVTECCLLTGLSFERMQSYQH
                     EIDYIQVLEEAGQQLQQATGAKVIITGLNPPTAAGKRYVGNMFVDAERSFHSIRDYNG
                     ESYSGTGDLFASVIMGGMMRGQDLVESMKLAETFLAAAIEATSKEQVPREAGVHFEQF
                     LRMLL"
     gene            532802..533311
                     /locus_tag="BSPH_RS02550"
                     /old_locus_tag="Bsph_0511"
                     /db_xref="GeneID:6022980"
     CDS             532802..533311
                     /locus_tag="BSPH_RS02550"
                     /old_locus_tag="Bsph_0511"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_012292289.1"
                     /db_xref="GI:501249271"
                     /db_xref="GeneID:6022980"
                     /translation="MEIRLLTAQDATSYRTLRLEGLQTNPEAFGSSFEEEKDMGLELF
                     ASRLEAQGSFTFGAFDQNELCGVATLVQESKMKLKHKASIFAVYVSPKKRGHGLGKRL
                     MQEIIKQGKQLADVEQINLTVVSSNESAKGLYTSLGFLMFGTEKRALKIDHQCFDEDY
                     MVLYVKPLK"
     gene            complement(533342..533587)
                     /locus_tag="BSPH_RS02555"
                     /old_locus_tag="Bsph_0512"
                     /db_xref="GeneID:6022981"
     CDS             complement(533342..533587)
                     /locus_tag="BSPH_RS02555"
                     /old_locus_tag="Bsph_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162525.1"
                     /db_xref="GI:738206612"
                     /db_xref="GeneID:6022981"
                     /translation="MVSADIAITIFFMLGITYNYFYDSFPIQIEYLGNLVFWLILPLS
                     IIIVALSLWLLKKKVSMVSTLLALFIAVITLFIVLFF"
     gene            534041..534592
                     /locus_tag="BSPH_RS02560"
                     /old_locus_tag="Bsph_0514"
                     /db_xref="GeneID:6022491"
     CDS             534041..534592
                     /locus_tag="BSPH_RS02560"
                     /old_locus_tag="Bsph_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general stress protein"
                     /protein_id="WP_036160539.1"
                     /db_xref="GI:738204621"
                     /db_xref="GeneID:6022491"
                     /translation="MKNENYKIENFFGRNMEQIKNPIIKSFLANAKNLYLVEKAILYP
                     TDCNMKLVDETFQLHYINVQKIKYVSNLIYFYSLDFDKKRRRLHDRFLLIVDDGLFET
                     GMVRKDEIIQEGLLDAVENEELFQSLKSLTDKQLQILEMIYAHDYSIKAVAETLQTTP
                     QNISNLHRKALKKLQQKLRKEEG"
     gene            534596..534793
                     /locus_tag="BSPH_RS02565"
                     /old_locus_tag="Bsph_0515"
                     /db_xref="GeneID:6022492"
     CDS             534596..534793
                     /locus_tag="BSPH_RS02565"
                     /old_locus_tag="Bsph_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292293.1"
                     /db_xref="GI:501249275"
                     /db_xref="GeneID:6022492"
                     /translation="MERENSYHEESLQFIENFSPKIKQCLHQTSYQEREDLEQEIKLK
                     IIEKLATKEFINTPSFWDFFT"
     gene            complement(534844..535743)
                     /locus_tag="BSPH_RS02570"
                     /old_locus_tag="Bsph_0516"
                     /db_xref="GeneID:6022493"
     CDS             complement(534844..535743)
                     /locus_tag="BSPH_RS02570"
                     /old_locus_tag="Bsph_0516"
                     /EC_number="1.1.1.35"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228188.1"
                     /note="similar to Hydroxyacyl-coenzyme A dehydrogenase;
                     converts (S)-3-hydroxybutanoyl-CoA to 3-acetoacetyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="WP_012292294.1"
                     /db_xref="GI:501249276"
                     /db_xref="GeneID:6022493"
                     /translation="MNYQNITVAGSGVLGSQIAYQSAFKGFQVTIYDINDEALKNAQD
                     RITKLKPLYQQDLGATQEEVDAAYARLTFKSDLAQAVADADLVIEAIPEVVQIKTEFY
                     TNLGKVAPAKTIFATNSSTLLPSQFAEATGRPEKFLALHFANTIWKNNTAEIMKHPGT
                     DMKVFDEVVAFARAIGMVPLPLYKEQPGYILNSLLVPFLDAAESLLVKEVADPETIDK
                     TWMIGTGAPLGPFAILDIVGINTAYNIVEAKATATGDENMKKLANLLKTEYIEKGKLG
                     RATGEGFYTYPNPSFAKPDFLKG"
     gene            complement(535970..536866)
                     /locus_tag="BSPH_RS02575"
                     /old_locus_tag="Bsph_0517"
                     /db_xref="GeneID:6022494"
     CDS             complement(535970..536866)
                     /locus_tag="BSPH_RS02575"
                     /old_locus_tag="Bsph_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase"
                     /protein_id="WP_012292295.1"
                     /db_xref="GI:501249277"
                     /db_xref="GeneID:6022494"
                     /translation="MVITPGISDLPYRIQVDGTKLFTLTAEEITWELVNGIFIQVWGY
                     NGSTPGPTIRVFPGDRVCIRVINRLPEKTSVHWHGLMVPNAMDGVPPIEPSPFIEPGH
                     YFDYHFTIKNPPGTYMYHSHVNVAVQDNAGLLGGFIVEDPSKQNLSQHKDYLCLLQEW
                     AVDQLPWGALTKGTYPLNFKKPEFNFFTMNGKCYPFTKSLSVNFGDTVKIRFGNIQMH
                     HHPIHLHGHQFHVVGADGFPIARHTQIAKNTILVASGETWDIEFLANNPGIWPLHCHM
                     PHHVTNNGAPDVGGMFTTVDYC"
     gene            537202..538263
                     /locus_tag="BSPH_RS02580"
                     /old_locus_tag="Bsph_0518"
                     /db_xref="GeneID:6022495"
     CDS             537202..538263
                     /locus_tag="BSPH_RS02580"
                     /old_locus_tag="Bsph_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292296.1"
                     /db_xref="GI:501249278"
                     /db_xref="GeneID:6022495"
                     /translation="MMKIMLAGALSIVCFTGGLGGQAYAQEAVDVANLIHQKQTVAAA
                     DQLQAMSYQDIYKILLLSKVGYENNEVTIVTTNTNITVKISLEAILQSYKDGTNLYPE
                     GEKDFTENYEEIKKLFGNAIQIRITQTGNGFKSEIFTANKWEAISAADLNSMLVVFAR
                     ADVELKPGGYFKDAIGHWAESYIQLLYQADIINGSSATTFNPNGQVTRGELAAIIFRA
                     SGLDVNEDYEGPATYTDLNGFWGAKEVAILEEYGLIDIFDGSKFEPKKPVTREEMAYV
                     TARYLEAMEVDLSKVSKANTFTDKNQMRKETVESIGLLQQLGILNGTNGKFNPKGNLT
                     RAEVSKILTLTLMELSDEE"
     gene            complement(538414..539133)
                     /locus_tag="BSPH_RS02585"
                     /old_locus_tag="Bsph_0519"
                     /db_xref="GeneID:6021264"
     CDS             complement(538414..539133)
                     /locus_tag="BSPH_RS02585"
                     /old_locus_tag="Bsph_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc transporter family protein"
                     /protein_id="WP_012292297.1"
                     /db_xref="GI:501249279"
                     /db_xref="GeneID:6021264"
                     /translation="MMRRGILQVSAMILGGFLFFSVSFGGAIAWIFSKLFQHTTQGLS
                     LLCGGFLVGLLVLDIIPSSFQIYQSFGIILGIFIGYFIFQLLDTLFHASHAQNPSVSL
                     LTLAMIIHTIPISLTVGNLLGNAALSISLTASIILHHVPEGFALSTALISQGERLWRL
                     FIYFFIFSVFFSIFIWFGQYWALPEKAQGILMGISIGLIATASISEFILHQLRYVSFR
                     SFFMYLILGYLLSYIFHTLVE"
     gene            539330..541018
                     /locus_tag="BSPH_RS02590"
                     /old_locus_tag="Bsph_0520"
                     /db_xref="GeneID:6021265"
     CDS             539330..541018
                     /locus_tag="BSPH_RS02590"
                     /old_locus_tag="Bsph_0520"
                     /EC_number="1.3.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292298.1"
                     /note="initiates steroid ring degradation; catalyzes the
                     transhydrogenation of 3-keto-4-ene-steroid to
                     3-keto-1,4-diene-steroid e.g., progesterone to
                     1,4-androstadiene-3,17-dione; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketosteroid-delta-1-dehydrogenase"
                     /protein_id="WP_012292298.1"
                     /db_xref="GI:501249280"
                     /db_xref="GeneID:6021265"
                     /translation="MKWDASFDVVVVGSGAAGLTAGLSAKLQGLKSLVIEKTDRYGGA
                     SAISGGALWIPNNHVIKGEGVPDTHELARQYLDATIGDRVPEALKEAYITKGPEMLRF
                     LYNKTNHMRFQYAKGYSDYYPEKLGGLSQGRSIEPLIFDLTKMGSLADHMRRATLSTK
                     GFTMNSYEFHKVNMITRTFKGKTTALRLGIRLVKSKVTKSEPVALGEALVARLRLSLA
                     EANGELWLSTAFKNFIMDNERVVGVIIERDGQEQRIEAKRGVVLSSGGFSHHQALREK
                     YLPAPTNAAWTSSPVGQTGDIIEPSVTIGATLDLMDKVWGAPSVIDPQGQPFFLVADR
                     GVPNMVVVDSAGQRYVNEAAPYHEFVDTMYKHQEETKQAVPSWILIDAAAKSRYIFTG
                     LFPGQAFTKSWYDHGIVKSAETIEDLARQMDVPKENLVETVNRFNIFAHNGHDDDFNR
                     GDSAYDNYYGDPTLPNPNLAELKKAPFYALRLYPGDIGTKGGVVVDEFARVVKKDGQP
                     IEGLYASGNCSASIMGETYPGPGATIGPGMTLSYIATTHMANAVTKIEEPLIKV"
     gene            541154..542773
                     /locus_tag="BSPH_RS02595"
                     /old_locus_tag="Bsph_0521"
                     /db_xref="GeneID:6021266"
     CDS             541154..542773
                     /locus_tag="BSPH_RS02595"
                     /old_locus_tag="Bsph_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162526.1"
                     /db_xref="GI:738206613"
                     /db_xref="GeneID:6021266"
                     /translation="MLDYKIITSMDMLEPYRSTWSGILEQEKNNNPFIEYEWVTTWWA
                     TLGIHDNVEIFIVEHQGTAVAFFPLVHTVGFGKIHYFGFLGQGYATYMEVIAEKQWME
                     RAIHYILKVFTQKYKRYLLVFQGLIESKDTSQQLEKYAIEYQMPYSIFRTVTSFIDFQ
                     SMTVDDFLKKHRKTFKSIKRYEKKLKLFGRLDFQDVGVNHFHKMFTLFMRRWRKKLDK
                     SRFTEAQTRLFYERLADVSNEAFRVEVDSLQFEGHWISFTIDLCCRDRNFCQAMGHEP
                     DFNRFGPGSLIEKENMLKAHDSGFRYYDFGSGYEPYKFQWYTDIDFTRKFIMSTKGTT
                     ERFIRSWMVLRDRVKGKLTNNHQLVKLKRDRLGELLYFLKHARTREWLRLMKGVLQRI
                     VAIHRIDIYIAEQKYDQGYMPFEELHMKDIMTLNERPAYIAHFYKGNRFFGDGDQIVY
                     RRHDHIAYEEVSGYTYELSANMSFIREYDTQLLKEIVVEVQREGRSVCTIAPWYEGRR
                     RRKLKQAGFHKVSQITLVRLFKWRKEFHAKQ"
     gene            complement(542822..543445)
                     /locus_tag="BSPH_RS02600"
                     /old_locus_tag="Bsph_0522"
                     /db_xref="GeneID:6021267"
     CDS             complement(542822..543445)
                     /locus_tag="BSPH_RS02600"
                     /old_locus_tag="Bsph_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketosteroid-delta-1-dehydrogenase"
                     /protein_id="WP_012292300.1"
                     /db_xref="GI:501249282"
                     /db_xref="GeneID:6021267"
                     /translation="MILTKQEAIQALKKNKFIGFTITTGNIIMKKMNKTDYNIFVFEE
                     GKEKPLRYVGSIMNVMATMSDKASNKDFVIVEQLPTQNNVAETQTSENEATLEEKAVA
                     AEVAEVAVVDETEESRAIAGYEDLYKMTVSGRIITVRENRPLARCNDEYGFHIARLTK
                     DGKASSHNVFELWKQTFPEVEQTQFKGALKAKYGTGCKLIDKPGIHF"
     gene            543725..544174
                     /locus_tag="BSPH_RS02605"
                     /old_locus_tag="Bsph_0523"
                     /db_xref="GeneID:6021268"
     CDS             543725..544174
                     /locus_tag="BSPH_RS02605"
                     /old_locus_tag="Bsph_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292301.1"
                     /db_xref="GI:501249283"
                     /db_xref="GeneID:6021268"
                     /translation="MVQHKFTMDLTWSDGRNGTGTINASNLKTQISIPQEMDGPGIGT
                     NPDEMLLGASATCYLITLAALLERSEVAVHDLSLQSEGYVSVVNGVFTYEKIIHKPKI
                     VILNLTEHLETKITRFAQKAEQTCMISKALKGNVEIECDAQILGARI"
     gene            544315..544950
                     /locus_tag="BSPH_RS02610"
                     /old_locus_tag="Bsph_0524"
                     /db_xref="GeneID:6021269"
     CDS             544315..544950
                     /locus_tag="BSPH_RS02610"
                     /old_locus_tag="Bsph_0524"
                     /EC_number="2.7.8.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-phosphate glucose phosphotransferase"
                     /protein_id="WP_012292302.1"
                     /db_xref="GI:501249284"
                     /db_xref="GeneID:6021269"
                     /translation="MHVSTTKNLTFYGQYGKRIFDITGALLLLFMTIPLMLAVFLILL
                     FTTGRPIFFKQIRTGLDHHRFVIWKLRTMCIQAVPINMPAICTNGIPDDYFFKVEQDT
                     RITKVGAILRKLSIDEIPQLLNVLKGEMSIVGPRPEVPTITNAYNNLQARRLEVKPGL
                     TGLAQINGRSNISHGQKISYDIEYVDHYSFWMDVQIVLKTLYVVLARTGAY"
     gene            544961..546091
                     /locus_tag="BSPH_RS02615"
                     /old_locus_tag="Bsph_0525"
                     /db_xref="GeneID:6024948"
     CDS             544961..546091
                     /locus_tag="BSPH_RS02615"
                     /old_locus_tag="Bsph_0525"
                     /EC_number="2.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyl transferase"
                     /protein_id="WP_012292303.1"
                     /db_xref="GI:501249285"
                     /db_xref="GeneID:6024948"
                     /translation="MAILKIVQLITRMDKIGGAQKHVEALAIQLKQDGHEVTVVTGSY
                     QPSLWRLQEEKITVIRIPAMQRAIHLAKDFRTFWQLRAVIKRLHPDVVATHSSKAGVI
                     GRIVGSLLHIPTVFTAHSWSFTEGVPQRKQMLYYRMEKSVQRFSTKIITVSDYDRELA
                     LMKKVAPAHKLLTIHNGIAPIDSNPSTEKTYTEQPVIVMVARFEVPKRQDLLLEALAE
                     LTDVPWQLQLVGDGSLRPALEEFVAQHNLTDRIIFLGDQLDVHTYLEKSHVFVLLSDW
                     EGLPISIIEAMRIGLPIVATNVGGVKELVVDHGNGFLVEREDKELLKQRLRHLLLDAT
                     LSQKMGNASERRYLQYFTFTPMYQKTLMVYQQAVSEFGKKGD"
     gene            546093..547766
                     /locus_tag="BSPH_RS02620"
                     /old_locus_tag="Bsph_0526"
                     /db_xref="GeneID:6024949"
     CDS             546093..547766
                     /locus_tag="BSPH_RS02620"
                     /old_locus_tag="Bsph_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160542.1"
                     /db_xref="GI:738204624"
                     /db_xref="GeneID:6024949"
                     /translation="MQLIRIRTDDELMWYKEIWDGILEEEDNDNPFIEFAWFYNWWQI
                     VGRKERVELFAIEHEGVILAFFPFTVTSRWGIRVYSFAGEGIANYTGVVVKKEWLMNT
                     TTFVFDELIRKHRHVIFSLHGLLESKVSTKVIEQYFVERQLRANIFRVVTPYLAFSEV
                     DFLQHFQQRRKLHGVDRRERKLRKLGTVTRRVPAQDELWQMFRLFDRRWAKKLDTSDF
                     TKGKKRDFFERLTMLNGEALQVEVDALVFENQWIAFTYGLFCRGRYVTYALAHEPTFN
                     VFGPGRIVNQESIQRTFAANYRLFDMSIGYEPYKFDWRTNIDFTRRMLASSGTKRAKL
                     VTGLMLLKERFKEYVKSNQRIVDWKRNTLGRFRYLVKYGKLRDWLEYGQQFVDRFIRL
                     KHVELYELSPTEDVFPQQPVGNLFEEMTIQEAMQLDQEEVIALYYKGYTVYKDSFAET
                     NKPAFALHATNWRVDSLQIIEALPKQTYFLAYDMFKQIEIITAYFRKVKPRQTLWVTA
                     SFWQWRKRKRLGQLGYKPIIRMKHYKVARFERQHVQKNTESGGDVHSVH"
     gene            547789..548493
                     /locus_tag="BSPH_RS02625"
                     /old_locus_tag="Bsph_0527"
                     /db_xref="GeneID:6024950"
     CDS             547789..548493
                     /locus_tag="BSPH_RS02625"
                     /old_locus_tag="Bsph_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292305.1"
                     /db_xref="GI:501249287"
                     /db_xref="GeneID:6024950"
                     /translation="MQHFYFLEKPANVRKSMKVIGYTNSLVPSRKLVKSEAIHIDLQG
                     HELSLYLALSEGNRKILRRAHKEYYQVILYKEPSVENLRAFQQFYNHFAKRKKLEAIG
                     KSQMETIMLLNKQGALLLSEIQSICGQTLCYRLDIVHENKAMSYYEATCAASAISTHL
                     KRPYRYANRFLIWHNLLHFKEQGFVLYDMGELTDNRNVRAFKLSFGGQVVNVYSGYIT
                     QSKIRALLLGVQKWRK"
     gene            548498..549490
                     /locus_tag="BSPH_RS02630"
                     /old_locus_tag="Bsph_0528"
                     /db_xref="GeneID:6024951"
     CDS             548498..549490
                     /locus_tag="BSPH_RS02630"
                     /old_locus_tag="Bsph_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_012292306.1"
                     /db_xref="GI:501249288"
                     /db_xref="GeneID:6024951"
                     /translation="MNGGGLVISLDFELNWGVHDVFRYGQYNKNLYGVRKALPSILAL
                     FEQYDIHATWATVGLLFAESKAEMAHYLRGIPVKYDNMRYAAHSQLAKVGENEQEDLL
                     HFGKSLIEEIKRTPHQEIGSHTFSHYYCLEKGQTEAAFCADLDATKTIIEGYISPMKS
                     MVFPRNQVNKDYFKACVEAGYVCYRGTENHPLYDAQKFTKKGRFLGAKKWLDSYINLT
                     GHHMATLEEMRDEQLINIRSSAFLRPYFRPLHVFEGSKVKRIKESMLEAAKAQAFYHL
                     WWHPHNFGKNTAKNLAMLEELLRYFQELRSQYNFESYSMYEVAELCENISKQQK"
     gene            549731..550723
                     /locus_tag="BSPH_RS02635"
                     /old_locus_tag="Bsph_0529"
                     /db_xref="GeneID:6024952"
     CDS             549731..550723
                     /locus_tag="BSPH_RS02635"
                     /old_locus_tag="Bsph_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formimidoylglutamase"
                     /protein_id="WP_031417726.1"
                     /db_xref="GI:670469061"
                     /db_xref="GeneID:6024952"
                     /translation="MYMFIEPECRWKQENGSAMHQWIKQQTNPNPNDVDIVVYGALLS
                     YAEEASGKAQYPTAFRKVWPSFQSYNLDEQINLRALSVVDIGDVAIHEQDRMLSESAI
                     EAAAENLSIAFQKSFTCLIGGDHAITACSLKGIKNAFPQDRIGIIQIDTHLDARNQEE
                     IGLAQDSPIHQLIASGIVEGRHIYNVGLHGFFNSPEMIHYAREQGIHMITLKQMRRDG
                     IQLTIHEMLRQLMYEVDRIYVSVDLDALDIMFARDVPAATPGGLTAYELFDILKLIGE
                     NEGVRHIDFVYADPKEGTLRPETVKIGVTAFLQWLTGIQLDHRNRISNKGKVTL"
     gene            550829..551719
                     /locus_tag="BSPH_RS02640"
                     /old_locus_tag="Bsph_0530"
                     /db_xref="GeneID:6020930"
     CDS             550829..551719
                     /locus_tag="BSPH_RS02640"
                     /old_locus_tag="Bsph_0530"
                     /EC_number="3.1.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-3' exonuclease"
                     /protein_id="WP_012292308.1"
                     /db_xref="GI:501249290"
                     /db_xref="GeneID:6020930"
                     /translation="MMTTVPKLLIVDGMALLFRSFFASAAMGHFIRLADGTPTNGAQG
                     FVRHVLTAQSLMKPTHMAVCWDMGAHTFRNELFDGYKANRPAPPEEMLPQFDMAKNLS
                     LQMGWQNFGVKGMEADDLIGSMIAKWQDDADITVISGDKDLLQLLRPSTEIAFMKKGY
                     TEYDIYTHGRFKEEYSIEPAQFAQVKAFMGDTSDGYPGVKGIGPKQALTLIQTYGSID
                     SVLASLGELKPGQRTKIQDQIDMLKLSHELATIQTDVPIEADLSSLVLPNYEPQIFKE
                     MEESGYTLIAKHARSLYSLI"
     gene            complement(551810..552313)
                     /locus_tag="BSPH_RS02645"
                     /old_locus_tag="Bsph_0531"
                     /db_xref="GeneID:6020931"
     CDS             complement(551810..552313)
                     /locus_tag="BSPH_RS02645"
                     /old_locus_tag="Bsph_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160547.1"
                     /db_xref="GI:738204630"
                     /db_xref="GeneID:6020931"
                     /translation="MRQQLGLLGKSQYDASIAPNYRNSACGPTTVHVILNYLNGSAPS
                     INELYKQLGSTKIGLFKWRLIRKLRQLYPSWDVRTCSLKEALQEIDAGRPVAMRFDRY
                     FSFRWRDQTSTFAYHWVPLIGYDIKNNQLWLIFHDNGTSNRDSIIRQVLYQNNEKVLS
                     FVKMVPH"
     gene            complement(552373..552690)
                     /locus_tag="BSPH_RS02650"
                     /old_locus_tag="Bsph_0532"
                     /db_xref="GeneID:6020932"
     CDS             complement(552373..552690)
                     /locus_tag="BSPH_RS02650"
                     /old_locus_tag="Bsph_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_031417721.1"
                     /db_xref="GI:670469056"
                     /db_xref="GeneID:6020932"
                     /translation="MKTITTAEQFNELINGDQKVLVKFYAGWCPDCTRMNMFIDPIIE
                     EYNQFDWYELNRDELPEIADKYDVMGIPSLLIFQNGEKLAHLHSANAKTPQQVTEFLS
                     AQQ"
     gene            553067..555451
                     /locus_tag="BSPH_RS02655"
                     /old_locus_tag="Bsph_0533"
                     /db_xref="GeneID:6020933"
     CDS             553067..555451
                     /locus_tag="BSPH_RS02655"
                     /old_locus_tag="Bsph_0533"
                     /EC_number="1.1.1.35"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_012292311.1"
                     /db_xref="GI:501249293"
                     /db_xref="GeneID:6020933"
                     /translation="MTYNIKKAAVLGSGVMGSGIAAHLANIGIPTLLLDIAPKELTHE
                     EEAKGLSLEHPAVRNRLVNGALQKLLKQKPAPLTSKKNLSLLTVGNFEDDLGKLKDVD
                     WIIEVVVENLPIKQSLYEKIDAIRTPGTIISSNTSGISINAMAEGRSEDFKKHFLGTH
                     FFNPPRYLKLLEVIPADTTAPEVVSFMKTFGEDVLGKGVVLAKDTPNFIANRIGTYGL
                     LITLQEMLKGGYSVGEVDSVTGPLIGRPKSATFRTLDVVGLDTFIHVAKNVYDQTTGE
                     EQQVFAVPEFLQKMVTNGWLGAKSGQGFFIKQGKEIHEIDPMTLAYSPVKKLKTPSIE
                     MAKQTRGLANKVKALTYAKDRTGELLWGIFAPTLIYSAQLYGEIADDIVAIDNAMKWG
                     FGWQQGPFEIWDAIGVKEAVAKMETEGREVPAFVKEMIANGFETFYSDIDGDLAYYNG
                     SDYVKVPINEKEIDLKRYKKKHGVIKSNTGASLIDLGDGIALLEFHSQSNAIGLDIIQ
                     MINFAIDEVEANYKGLVIGNQGKNFCVGANLGMILVEAQDDNIFELDFVIKAFQDAMQ
                     KIKYSRKPVVAAPFAMTLGGGAEVCLPAAHIQATMETYMGLVEVGVGLIPGGGGNKAL
                     YQKFLKGLPNGVEIDYQHIANKVFETIAMAKVSTSGEEARENNFLNFADGISVNPDHQ
                     LYDAKQAALALYEAGYQPPVPTKVPVVGASGYGTLLIGAQGMYESGFISKHDLKIAKK
                     LAYVIAGGKVPYGTLVDEQYLLNLEREAFLSLVADPLSQQRMQHMLLKGKPLRN"
     gene            555500..556672
                     /locus_tag="BSPH_RS02660"
                     /old_locus_tag="Bsph_0534"
                     /db_xref="GeneID:6020934"
     CDS             555500..556672
                     /locus_tag="BSPH_RS02660"
                     /old_locus_tag="Bsph_0534"
                     /EC_number="2.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228221.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_012292312.1"
                     /db_xref="GI:501249294"
                     /db_xref="GeneID:6020934"
                     /translation="MREAVIVAGARTPIGKAKKGSLATVRPDDFGAAVVKETLKRAGY
                     EGPIDDLILGCAMPEAEQGMNVARSIGALAGLPDTTPALTINRFCSSGLQAIAYAAER
                     IMLGHSKAILAGGVESMSMVPMVGNTPRLNPTLAETAPQYYMGMGHTAEEVARQYNVS
                     REDQDAFAVRSHVLAEEAIKEGKFNDEIVPIEVEQHYVDENNKPQVKKFTFSMDEGVR
                     SGTSVEGLAKLRPAFHVKGSVTAGNASQTSDGAAAVLVMEREEAVKQGLTPMAKFLGF
                     AVGGVPPEVMGIGPIVAVPKALEIAGLSIDAIDLWEINEAFASQSLQVVRHLGIDQDK
                     VNVNGGAIALGHPLGATGAILTLKLIHELKRQGKKYGVVTMCIGGGMGAAGVFEIL"
     gene            556929..558713
                     /locus_tag="BSPH_RS02665"
                     /old_locus_tag="Bsph_0535"
                     /db_xref="GeneID:6024799"
     CDS             556929..558713
                     /locus_tag="BSPH_RS02665"
                     /old_locus_tag="Bsph_0535"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_012292313.1"
                     /db_xref="GI:501249295"
                     /db_xref="GeneID:6024799"
                     /translation="MTEKTTDFIKGGGFLIEDVELDRVFTPEDFTDEHKMIAKTTEEY
                     VANEVLPVVENLEHHEFEHSVRLLKSAGELGLLGADVPEEYEGLGLDKVSSALIAEKM
                     SVAGGFSITHGAHVGIGSLPIVLFGDENQKKKYLPKLASGELIAAYALTEPGSGSDAL
                     GAKTTAKLNDAGTHYILNGEKQWITNAGFADVFVVYAKIDGDKFSAFIVERTFNGVSV
                     GPEEKKMGIKSSSTRTLVLEDAEVPVENLLGEIGRGHVIAFNILNIGRYKLGVGTIGG
                     SKRAFELAVQYTNQRQQFKTKLSDFNLTKEKLSTMASHLYASESLNYRTVGLFEDRLS
                     QLSPEEQKEGKVIAGAIAEYAIECSIAKVFGSETLDYIADEAVQLHGGYGFMAEYEVE
                     RIYRDSRINRIFEGTNEINRMIVPGTFMKKALKGELPLLQVAQNLQQELLMLMPEDIG
                     TEPLAQEKYLVKNAKKIAVLAAGLAAQRFGAKLDQEQEVLVNIANIANQLFAMESAVL
                     RTEKAIARDGVEKAHQKLLYTQIFCQEAFAEIEKEAKDTILASADGDAARMTLSALRK
                     LTRNNPYNLITKKREASVKLIEAEKYIV"
     gene            558900..559256
                     /locus_tag="BSPH_RS02670"
                     /db_xref="GeneID:23319650"
     CDS             558900..559256
                     /locus_tag="BSPH_RS02670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008179957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031417717.1"
                     /db_xref="GI:670469052"
                     /db_xref="GeneID:23319650"
                     /translation="MTIQFFHYPKCTTCKKAQKWLNDHDVSYEEVHIVEQPPTKDEIT
                     ALWQVSGLPLKKFFNTSGMKYRDLGLKDKLADMTEEEQLELLASDGMLIKRPLVTDGK
                     KVTLGFKESDFEQAWI"
     gene            559338..559718
                     /locus_tag="BSPH_RS02675"
                     /note="glycine cleavage system protein H; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319651"
     gene            559810..560152
                     /locus_tag="BSPH_RS02680"
                     /note="TOPRIM domain-containing protein; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319652"
     gene            560168..560479
                     /locus_tag="BSPH_RS02685"
                     /old_locus_tag="Bsph_0540"
                     /db_xref="GeneID:6024032"
     CDS             560168..560479
                     /locus_tag="BSPH_RS02685"
                     /old_locus_tag="Bsph_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_012292318.1"
                     /db_xref="GI:501249300"
                     /db_xref="GeneID:6024032"
                     /translation="MEEWSKEQWETALQSGEKAAFYLYTPMCGTCAVASKMMSIVEQL
                     LPHLKLGKANINFLEQIAFEHQIESVPCLLVCDGGKVTEKIYAFQSVPFLYELLKKSI
                     D"
     misc_binding    560536..560639
                     /note="SAM riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="S-adenosyl methionine"
     gene            560723..561752
                     /locus_tag="BSPH_RS02690"
                     /old_locus_tag="Bsph_0542"
                     /note="methionine ABC transporter ATP-binding protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6024034"
     gene            561742..562410
                     /locus_tag="BSPH_RS02695"
                     /old_locus_tag="Bsph_0543"
                     /db_xref="GeneID:6024035"
     CDS             561742..562410
                     /locus_tag="BSPH_RS02695"
                     /old_locus_tag="Bsph_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter permease"
                     /protein_id="WP_031417714.1"
                     /db_xref="GI:670469049"
                     /db_xref="GeneID:6024035"
                     /translation="MLTNLFPNVDWDSMWQATYETLYMTAISTVITFILGLAIGIVLF
                     LTSPNQLWANKIVSFLTGSLVNIFRSIPFIVLIILLIPFTKFLLGTIRGANAALPALI
                     IGAAPFYARMVLIALREIDKGVIEAARSMGAKTATIIWKVLIPESLPALISGITVTAV
                     ALVGYTAMAGIIGAGGLGNLAFLDGFQRNRQDVTLMATILILVVVFIIQWIGDFITEK
                     IDKR"
     gene            562477..563328
                     /locus_tag="BSPH_RS02700"
                     /old_locus_tag="Bsph_0544"
                     /db_xref="GeneID:6024036"
     CDS             562477..563328
                     /locus_tag="BSPH_RS02700"
                     /old_locus_tag="Bsph_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012292322.1"
                     /db_xref="GI:501249304"
                     /db_xref="GeneID:6024036"
                     /translation="MKKLLTGLFLSILVLALAACGTDKKEDSNAASGDKTDSKENVTL
                     TVGASNTPHAVILDKAKPILAEKGIDLKVETYTDYVLPNQDLESKELDANYFQHIPYL
                     ELQIKDNGYDFVNAGGVHIEPIGIYSKKYKSLEDLPEGATILLSNSVSDHGRMLSLLE
                     AKGLIKLKDGIDKTAAEIKDIEENPKNFKFDANTAPEMLVQMYENNEGDAVLINSNFA
                     IDNGLNPIEDAISLEDKESPYVNIIAVRAGDESRPEIKTLLEVLTSKEIQDFILEEWK
                     GAVVPVQ"
     gene            564019..565323
                     /locus_tag="BSPH_RS02705"
                     /old_locus_tag="Bsph_0545"
                     /db_xref="GeneID:6025212"
     CDS             564019..565323
                     /locus_tag="BSPH_RS02705"
                     /old_locus_tag="Bsph_0545"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-glucosamine dehydrogenase"
                     /protein_id="WP_012292323.1"
                     /db_xref="GI:501249305"
                     /db_xref="GeneID:6025212"
                     /translation="MSSALLNKIQLKKATIGVIGLGYVGLPFAIEIVQKGFHVLGFDK
                     NQEKIAMLQNGESYIADIPKENIQQILKDQHFEATFDFSKLASVDVVIICVPTPTTVD
                     GTPDISYIEEAAHDIGRYIKANALVILESTTYPGTTEEIVQPILQKHGFAVGQDLFLA
                     YSPERVDPGNSNFSVSNTPKVVGGVTSNCLEVSKGFYETVIHTSVFTVTSPKVAEMEK
                     LLENTFRQINIALVNELSQMCYKMNIDVWEVIDAASTKPYGFMPFKPGPGVGGHCIPV
                     DPKYLLWAGQQHGISATLIEAADKINDSMPNFVVERLEQYLRIQNIELCHAKIVIIGV
                     TYKPDINDSRESPALRVIQQLLDSQSSLQIIDPYIQTFPVEQTLLNTVPLTEKSVKDA
                     DAVLILTNHSNIDYSLIDQEASLIFDTRNTHFLFKNKNYYRL"
     gene            565376..566770
                     /locus_tag="BSPH_RS02710"
                     /old_locus_tag="Bsph_0546"
                     /db_xref="GeneID:6025213"
     CDS             565376..566770
                     /locus_tag="BSPH_RS02710"
                     /old_locus_tag="Bsph_0546"
                     /EC_number="3.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitin deacetylase"
                     /protein_id="WP_012292324.1"
                     /db_xref="GI:501249306"
                     /db_xref="GeneID:6025213"
                     /translation="MFLAGCQSTPQKTIQPIDSSIEIKESDGTMSDSISHVDIIKPKV
                     ALTFNGFADNQTMELLLAKLDESNMKATFFLEGLRVAQEPELVRDILKRGHDVQNGTL
                     SFPDVTALNYDQTYEEIYLTNQIFEEHLGYKPKFVRSRSGDITDNMRLAAAALDMKAV
                     IGLSINPLDRKMQSAQDLIDYIDKYIDRGSIIHLNTYINPAIIDAIPLLAQLAEKHDY
                     TITTLSDVIDERYLTKSLEEIAGYDAVKPNLNYENVEPHLYYRKETSKKEIAITFDDW
                     AHEQQVKAVLDVLKKYNIKSTFFLIGSGVEKNPQLAKLILEEGHEVASHSYYHLDVTK
                     MTPEEIQDDLVKAHNALTYALQEPPLLYFRPAQGIMDERTAKVITAAGIKTIAMYDIA
                     SFDWNLDYSAQDIYDRVISRAAPGKVIVMHILDGTKTVEALPLIIEKLQQDGYSFSKM
                     SNWIEEDANGDVNK"
     gene            566767..568638
                     /locus_tag="BSPH_RS02715"
                     /old_locus_tag="Bsph_0547"
                     /db_xref="GeneID:6025214"
     CDS             566767..568638
                     /locus_tag="BSPH_RS02715"
                     /old_locus_tag="Bsph_0547"
                     /EC_number="2.4.1.212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hyaluronan synthase"
                     /protein_id="WP_012292325.1"
                     /db_xref="GI:501249307"
                     /db_xref="GeneID:6025214"
                     /translation="MIKTKKEVLTVPRSDRRILSNIPDPENVRNLVNRRGASYQKEEI
                     DPTDVNEIYRLQQLSLRYETHFEVQVRRARHKMSSDKYYAEDISVTGILVYSQQPQQL
                     LIDEILEMNFTIPGGAMPEGYEAKVKLKAKVVRHFTKEVDGQTLYYFACEFLQPLNKY
                     MVKKRWGISVFMASLFLLVVSLIVMLMRAESVIYFRFNKFLYLYSIIAATFLLSRYLF
                     GIFYKNVPINPNYEPGVSIIIPVFNEEEWIHRTISSCINQYYPVDKLEVIVVDDCSTD
                     RTEEKAKEMIDLIHFEGGRFKTTDRLKFSKLPQNGGKREALVAGVHQAKHDLVVFVDS
                     DSFLEPHAIRNLVQPFQDPKMGGVAGRTEVENKFTNALTKLQTVRYYIAFRIMKAAES
                     WFDTVTCLSGPLACYRKELILKNETAWLNQKFLGQPATFGDDRSMTNYILKTHRTGYQ
                     DNAICSTIVPSDTKVFLSQQMRWKRSWLRESLRAFLFMWKKEPFMFLFFIIGLIVPIA
                     APIVVVYNLIYVPIMYGVFPTTFLLGLLLMAMLMSLAHLFFRKSKLWLFGFIFVLYYE
                     FILLWQMPVAWVTFWKSTWGTRETPQDVLAKEKKIEKQKLRKSRFSMLKIRKMGEKE"
     gene            568635..570386
                     /locus_tag="BSPH_RS02720"
                     /old_locus_tag="Bsph_0548"
                     /db_xref="GeneID:6025215"
     CDS             568635..570386
                     /locus_tag="BSPH_RS02720"
                     /old_locus_tag="Bsph_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_012292326.1"
                     /db_xref="GI:501249308"
                     /db_xref="GeneID:6025215"
                     /translation="MKEKNVILQPAKKNRRKIIRSIIQLVVVIFLAVVLIKAVFLTDK
                     RFAEAVPLNNKDGFIALSYFGVSRNDSSKYVSKKNLEEQLTLLEKQGYQTITQKDILD
                     FYQKNKPLPEKALFLSFEDGRTDSSIFAQNVMEKLNYKATMFTYANKMDTRDHKFLKP
                     KDLKLMEKSGYWELGSNGYRLTYINIFNDKGQSLGMIDENNIPNKTTIEYYNHYLMDF
                     IRNQYMIPSETRQEMEARIKKDYKLMQEIYQQEFGEVPKAYAIMHANSLYNNMDPLVQ
                     SVNDKEIKDKFRMHFNLELSAYNDKDSDLYNLNRLQVSPYWSTNHVMMKIKQASNQNI
                     EFKIGDPQLAQKWQTINGAAEFDNNEVTLTSAPSSEGRILLKEMMPQQYNVNFTFKGN
                     VVGEQALYVNYDEKTNSYLRIALVDNELVVSEKLPASDIVEKARFPLNEIKWNEEEYA
                     FNKATVYTYQDTQKGSRIVEEEYPRNLTKNRVFNITVNKDKIKVDVDHVLSETIQINP
                     GLHGSQIGFGALFSHKDTSHEQYADDIYDTIIEDILITDRKDQTIFTNQYTNFEKVKH
                     KSTTLFNHVVDFFIETF"
     gene            570400..571470
                     /locus_tag="BSPH_RS02725"
                     /old_locus_tag="Bsph_0549"
                     /db_xref="GeneID:6025216"
     CDS             570400..571470
                     /locus_tag="BSPH_RS02725"
                     /old_locus_tag="Bsph_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_012292327.1"
                     /db_xref="GI:501249309"
                     /db_xref="GeneID:6025216"
                     /translation="MKQVKNFILFICIALLFITACSNSKEPPAIAKEELKDKAKLRLS
                     MWLPEWQNQSALEDVQNSQQGLQDMRVFGAYFNHKDELLLTDNAVDMLRQTQQQFNES
                     HHVILTLINDYVTDNASSVQKDSTLLHRLVQDSSARKKHINNILQVVEQYQPDGIEID
                     YEKIAKEDLSKYVQFLKELYRELAKKNVTLHVVLEPSFPFDVKLPNGPSYTVMAYNVH
                     GYHSGPGAKATFSFLNDLIKNIKKSNQKLAIAFATGGFDWVAQGNTVALTELEAEKVL
                     AETNAKKQRDKASGAVYFTYTDTSNMSHEIWYADQETLEKWVKYVQRKSYHDVVLWRA
                     GGLGVKTLQWINEQETGERLSP"
     gene            complement(571794..572696)
                     /locus_tag="BSPH_RS02730"
                     /old_locus_tag="Bsph_0550"
                     /db_xref="GeneID:6024060"
     CDS             complement(571794..572696)
                     /locus_tag="BSPH_RS02730"
                     /old_locus_tag="Bsph_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_031417711.1"
                     /db_xref="GI:670469046"
                     /db_xref="GeneID:6024060"
                     /translation="MELRQLRYFVEVAEREHISEAAEHLHVAQSAISRQIANLEDELG
                     TPLFERVGRNVKLTPIGKTFLEHTITALKAIDFAAKQVEEYLDPAKGSIKIGFPTSLA
                     SYVLPTVISAFKREYPNLQFQLRQGSYRFLIDAVKNRELNLAFLGPLPPKDESIESTI
                     LFTENIAALLPANHPLAKRESIQLAELRNDLFVLFPNGYILHKVAMDACRAAGFMPNI
                     ISEGEDLDALKGLVAAGIGVSLLPESSLYDSAARFTVKVPIESPSIPRTVGIISPVNR
                     EIAPSEAIFLNFVKDFFSRLSQFQ"
     gene            573217..573996
                     /locus_tag="BSPH_RS02735"
                     /old_locus_tag="Bsph_0551"
                     /db_xref="GeneID:6024061"
     CDS             573217..573996
                     /locus_tag="BSPH_RS02735"
                     /old_locus_tag="Bsph_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_016994918.1"
                     /db_xref="GI:515562059"
                     /db_xref="GeneID:6024061"
                     /translation="MSTLVIKDLHVAIDGKEILKGVNLTINTNEIHAIMGPNGTGKST
                     LASAIMGHPKYEVTSGTVELDGEDVLEMEVDERAQAGLFLAMQYPSEIAGVTNADFLR
                     SAINARREEGDEISLMKFIRELDKNMEFLEMNEDMAQRYLNEGFSGGEKKRNEILQLM
                     MIKPTFAILDEIDSGLDIDALKVVSKGINAMRGEGFGCLMITHYQRLLNYITPDHVHV
                     MMQGRVVKSGGAELAQRLEAEGYDWIKKELGIEEETEEQEA"
     gene            574015..575322
                     /locus_tag="BSPH_RS02740"
                     /old_locus_tag="Bsph_0552"
                     /db_xref="GeneID:6024062"
     CDS             574015..575322
                     /locus_tag="BSPH_RS02740"
                     /old_locus_tag="Bsph_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly protein SufD"
                     /protein_id="WP_012292330.1"
                     /db_xref="GI:501249312"
                     /db_xref="GeneID:6024062"
                     /translation="MTVELNLPVTVQDVRSFSEANGEPTWFTELRAAALDKVTGLDLP
                     KPDRTNITKWDFMNFPAFTVHSEAFPSLDALPEEAKGLIDLEAQENLYIQRNNTPAYI
                     KISQELVDKGVVFTDIFTAVREHGELVQKYFMTEAVKVDEHKLTALHTALVNGGVFVY
                     VPKNVVIEQPLQVVFLNDNAEASLYNHVLVVAEANSAVTYVETYVSTVEQAKGQANII
                     AEVVVQDNAQVTYGAVDVLAKGFTTYVNRRARLARDAKVDWALGLMNDSDTISENITH
                     LIGDGSHADTKTVVVGRGEQKLNFTTEVRHWGKNSNGHILKHGVMKDAAQSIFNGIGY
                     IEHGATKADAQQESRVLMLSEKARGDANPILLIDEDDVTAGHAASVGRVDPLQLYYLM
                     SRGISKAEAERLVIHGFLAPVVTQLPIEGVQKQLTEVIERKVR"
     gene            575322..576551
                     /locus_tag="BSPH_RS02745"
                     /old_locus_tag="Bsph_0553"
                     /db_xref="GeneID:6024063"
     CDS             575322..576551
                     /locus_tag="BSPH_RS02745"
                     /old_locus_tag="Bsph_0553"
                     /EC_number="2.8.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_012292331.1"
                     /db_xref="GI:501249313"
                     /db_xref="GeneID:6024063"
                     /translation="MMNKDIKSYFPILNQDVNGHRLVYLDSAATSQKPVQVIEAIKAY
                     YEFDNSNVHRGVHTLGNRATDKYEGAREKVRKFINAQSTQEIIFTRGTTTSLNTVAAS
                     YGRANVAEGDEIVITQMEHHSNIIPWQQLAKEKKATLKYIELEADGTISLEKVRATIT
                     PQTKIVSVSMASNVLGTINPIKEIAQIAHANGAVMVVDGAQAAPHMKIDVQELDVDFL
                     GFSGHKMCGPTGIGVLYGKKEHLEKMEPIEFGGEMIDFVGLYDSTWKELPWKFEGGTP
                     IIAGAIGLGAAIDFLTEIGLDNIAEHEHKLVGYAMDQLETIDGLKIFGPRDPMKRCGL
                     VTFNLDDVHPHDVATVLDMNGIAVRAGHHCAQPLMKCLQQVATARASFYLYNTEEDID
                     RLVAGLRSAKEYFGDVF"
     gene            576541..576966
                     /locus_tag="BSPH_RS02750"
                     /old_locus_tag="Bsph_0554"
                     /db_xref="GeneID:6024064"
     CDS             576541..576966
                     /locus_tag="BSPH_RS02750"
                     /old_locus_tag="Bsph_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen-fixing protein NifU"
                     /protein_id="WP_012292332.1"
                     /db_xref="GI:501249314"
                     /db_xref="GeneID:6024064"
                     /translation="MSFNNLDQLYRSVIMDHYKNPRNKGSLEGEAVTIDMNNPTCGDR
                     IHLTLKVTDGVVEDAKFEGEGCSISMSSASMMTQLIKGKKVDEALELADIFSKMMMGE
                     EYSDKYDLEDVEALQGVSQFPARIKCATLAWKAMEKGVK"
     gene            577065..578462
                     /locus_tag="BSPH_RS02755"
                     /old_locus_tag="Bsph_0555"
                     /db_xref="GeneID:6020888"
     CDS             577065..578462
                     /locus_tag="BSPH_RS02755"
                     /old_locus_tag="Bsph_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly protein SufB"
                     /protein_id="WP_031417705.1"
                     /db_xref="GI:670469040"
                     /db_xref="GeneID:6020888"
                     /translation="MAKKMPDIGDYKYGFHDKDVSIFRSKRGLTEEIVREISNMKQEP
                     EWMLEYRLKALETFYTKPMPQWGGDLGDLDFDEITYYVKPSEATQKSWDEVPDEIKAT
                     FDKLGIPEAEQKYLAGVSAQYESEVVYHNMKQDLEDLGIVFKDTDSALRENEDIFKQY
                     WGKVIPYTDNKFAALNSAVWSGGSFIYVPPGVKVETPLQAYFRINSENMGQFERTLII
                     VDEGAHVHYVEGCTAPVYTTNSLHSAVVEIVVRKDAYCRYTTIQNWANNVYNLVTKRT
                     VVEENGTMEWIDGNIGSKLTMKYPACILKGEGARGMTLSIALAGKGQHQHAGAKMIHM
                     APNTSSTIVSKSIAKQGGKVTYMGQVRFGPKASGARANIECDTLIMDNQSTSDTIPYN
                     EILNDNVSLEHEAKVSKVSEEQLFYLMSRGISEEEATEMIVMGFIEPFTKELPMEYAV
                     EMNRLIKFEMEGSIG"
     gene            578652..579620
                     /locus_tag="BSPH_RS02760"
                     /old_locus_tag="Bsph_0556"
                     /db_xref="GeneID:6020889"
     CDS             578652..579620
                     /locus_tag="BSPH_RS02760"
                     /old_locus_tag="Bsph_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-uptake system-binding protein"
                     /protein_id="WP_012292334.1"
                     /db_xref="GI:501249316"
                     /db_xref="GeneID:6020889"
                     /translation="MIAVFMLSLAACGEKKTTEEDRSTESMKEEVAQTQDSTTNENLT
                     RTIDYLGESYEVPEKVERIVVTGAMEAMEDMVVLDVHPVGAIAVGGKFPELYAAVTDK
                     AESIGEKIKPNFEKILELDPDVILGSTKFPEEVQSKLEKIAPTILVSHISTNWESNLN
                     LLAELTGKQAEAEKILSTYKADIEAAKSSLTKKLEDKKVAAIRIRRGQAYVYPKEVFL
                     NPVLYGELGLEVPAEIAKATSQEAISVEQLADMNPDFLFVQFSTDENADAPNALEDFK
                     QNPIIQNINAFKNEQVFVNVVDPLMEGGPAFSRITFLEAIQQNLDK"
     gene            579755..580612
                     /locus_tag="BSPH_RS02765"
                     /old_locus_tag="Bsph_0557"
                     /db_xref="GeneID:6020890"
     CDS             579755..580612
                     /locus_tag="BSPH_RS02765"
                     /old_locus_tag="Bsph_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292335.1"
                     /db_xref="GI:501249317"
                     /db_xref="GeneID:6020890"
                     /translation="MIVVGLTGWGDHPSLYSGVTSSKDKLFDYTGHFLAVEVDTSFYA
                     IPSKDNVRKWCENTPENFRFVVKAYQGMTGHLRGDIPFESKNDMFNAFIECAQEFKRF
                     GKLGMILAQFPPWFDCQSKNVQYLLYIRQQLKDFQVAIEFRNQTWYADNVVQQTMDFL
                     REHQFIHTICDEPQAGVGSVPFYPVVTADKALVRIHGRNIHGWRNTGNAENWRKVRFL
                     YDYNKEELQQLGQQILKLEPEVQELFILFNNNSGNHAAKNAKELQGVLNIKDVGLAPK
                     QLNMFEGEL"
     gene            580612..581436
                     /locus_tag="BSPH_RS02770"
                     /old_locus_tag="Bsph_0558"
                     /db_xref="GeneID:6020891"
     CDS             580612..581436
                     /locus_tag="BSPH_RS02770"
                     /old_locus_tag="Bsph_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292336.1"
                     /db_xref="GI:501249318"
                     /db_xref="GeneID:6020891"
                     /translation="MAFILLVIIALFSGLLGSLVGLGGGVVLVPATLYIGLNLGMIPD
                     ITPQKVVGLSVVMMIFTGLASTLSYMKSKTVDYKTGYIFFIGSIPGSILGAWVNKGLD
                     LPSFNLYFGILLIILSIILLVRDKLKPVEWFVKNGLQQEFTDAQGKTFVYGYPIWFAI
                     LFTFGVGFASGLFGIGGGSMIVPAMIILFLFPPHVAIATSMFLVFLTSVVNTASHIYL
                     GHVPWLYTIPVIPGAYIGAKLGAALNKKIKSDTLVLVLRIILLLLGIRSIVEGILA"
     gene            581472..582836
                     /locus_tag="BSPH_RS02775"
                     /old_locus_tag="Bsph_0559"
                     /db_xref="GeneID:6020892"
     CDS             581472..582836
                     /locus_tag="BSPH_RS02775"
                     /old_locus_tag="Bsph_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_031417701.1"
                     /db_xref="GI:670469036"
                     /db_xref="GeneID:6020892"
                     /translation="MLEKIHIFHTNDLHSHFKYWPRMQSYVKEKRSSLAKIGETSYLF
                     DVGDHLDRSNIYTEATIGKGNVQLLNEAAYDVVTIGNNEGITLSHDELFHLYDDANFD
                     VVVGNIDAYQGRNPAWLKPYVVLTTEKGTKLGIIAATAMFEVYYQALNWQMVEARSTL
                     LRLAHQLRKEVDIVLCLSHLGITEDELLAEECPEIDVIFGSHTHHVLPEGKLVNGVLL
                     TGGGKFGQYTGHLVIEYDKKMRKIVEKKDALIHNKDLPNIQNEQQIVQSLEDEGIRIL
                     DTPVFTTKKSYNKEWFHYSQLSDLFAHAILEKSGADCALFNAGIFLDGLPKGTVTALD
                     LHRIFPHPINLCTIELSVMEMKEIYMQSKNEEWPYIELKGLGFRGVIFGKMLTYGFSM
                     NDNRQLLINGNLADDNHIYKLVTLDLFTFGYFYPSFKYAKKQYILPEFLRNIMIDYGQ
                     SFFK"
     gene            582873..583982
                     /locus_tag="BSPH_RS02780"
                     /old_locus_tag="Bsph_0560"
                     /db_xref="GeneID:6023063"
     CDS             582873..583982
                     /locus_tag="BSPH_RS02780"
                     /old_locus_tag="Bsph_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_012292338.1"
                     /db_xref="GI:501249320"
                     /db_xref="GeneID:6023063"
                     /translation="MRLISIDVLKEGMVLGRTIWNEAGHPLLKKDVIINDRIIQRLQQ
                     LNTHYLYIDDDISEGIEVEETVPPAMRNKVITTIKDSFQSIDGLNSVNASYILDQQSK
                     TIVSIVDELLSAVTGNDEILTILTDAYLFDEYLYQHSFQVTLYSIAIAKELGYSAEDL
                     RLVGIGALLHDVGKLMVPKDILTKPGRLTNEEFEAMKMHARYGFDLLRNLHSISLLVA
                     HCAFQHHERIDGSGYPRGLVDFEIHPFAKIIGVADVFDAVTTNRVYREKMLPSQGLAI
                     VEAGSGTLYDARIVNALKRAVVHYPNGVILKLSDGRRGIVSRQNPLDAALPWIRIFEE
                     QNQLLAATYEINLVDFPSILIENVETDYMVPAKVE"
     gene            584048..584803
                     /locus_tag="BSPH_RS02785"
                     /old_locus_tag="Bsph_0561"
                     /db_xref="GeneID:6023064"
     CDS             584048..584803
                     /locus_tag="BSPH_RS02785"
                     /old_locus_tag="Bsph_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein"
                     /protein_id="WP_031417699.1"
                     /db_xref="GI:670469034"
                     /db_xref="GeneID:6023064"
                     /translation="MKLRSYHKRGIRLNRLTILIVSMVVCLILFIYYLNERLMPTYLQ
                     YAEVQTTKIASYVVSKAINSRTSNVLDVNDIIEDIPPGSSDMMTTKFNTEIINRVRAE
                     TLELVKMYLEQAEQGELSHLPELDNVEYDINRIQEGDGIVFFVPLGQAANIPLLGNLG
                     PKIPIRFHVIGNVHSNVTSSIQEFGINSAYVEVGIHLEVNVQIIVPFASKSSTVAQDI
                     PVAMGLTRGPVPNIYTNSSDAPQPSIEIPVPFK"
     gene            584910..585827
                     /locus_tag="BSPH_RS02790"
                     /old_locus_tag="Bsph_0562"
                     /db_xref="GeneID:6023065"
     CDS             584910..585827
                     /locus_tag="BSPH_RS02790"
                     /old_locus_tag="Bsph_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl synthase"
                     /protein_id="WP_031417697.1"
                     /db_xref="GI:670469032"
                     /db_xref="GeneID:6023065"
                     /translation="MTSCKPTSKEEHLRKPDWLKIKLNTNDEYKGLKKLMREKNLHTV
                     CEEARCPNIHECWGERRTATMMILGSVCTRACRFCAVKTGLPNELDLAEPERVADSVA
                     IMNLKHVVITMVARDDLKDGGAEVLAETVRAIRRKSPFTSVEVLPSDLGGMKENLQML
                     MDAKPDILNHNIETVRRLTPRVRARAKYERSLEFLRLAKEMQPEIPTKSSLMIGLGET
                     HEEILEVMDDLRANNVDIMTIGQYLQPTKKHLPVKKYYSPIEFGKLRKIAMEKGFKHC
                     EAGPLVRSSYHADEQVNAATKERQLQAEL"
     gene            585860..586138
                     /locus_tag="BSPH_RS02795"
                     /old_locus_tag="Bsph_0563"
                     /db_xref="GeneID:6023066"
     CDS             585860..586138
                     /locus_tag="BSPH_RS02795"
                     /old_locus_tag="Bsph_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292341.1"
                     /db_xref="GI:501249323"
                     /db_xref="GeneID:6023066"
                     /translation="MIIVEGLEYELLEDFREAFQEEVFQERYSDILARYDYIVGDWGY
                     NQLRLKGFFDDKNQKSTFDTKISTLQDYLYEYCNFGCAYLSYVKQGKL"
     gene            complement(586133..586360)
                     /locus_tag="BSPH_RS02800"
                     /db_xref="GeneID:23319653"
     CDS             complement(586133..586360)
                     /locus_tag="BSPH_RS02800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012294309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041658738.1"
                     /db_xref="GI:753951663"
                     /db_xref="GeneID:23319653"
                     /translation="MLEEYVGYSNDLPDIENERERNMTKAIENKLLDDFCLQSNLMYD
                     HIKFLLFILLMVLGRLAVQLLHSHPAPLAVS"
     gene            complement(586371..>586957)
                     /locus_tag="BSPH_RS02805"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319654"
     gene            587205..587732
                     /locus_tag="BSPH_RS02810"
                     /old_locus_tag="Bsph_0566"
                     /db_xref="GeneID:6024988"
     CDS             587205..587732
                     /locus_tag="BSPH_RS02810"
                     /old_locus_tag="Bsph_0566"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol phosphatase"
                     /protein_id="WP_012292342.1"
                     /db_xref="GI:501249324"
                     /db_xref="GeneID:6024988"
                     /translation="MKRAVFLDRDGVINEVLTKRVKFVNKPRDLYFLPQVPEAIRKLN
                     KHFDYIFVVTNQGGVGLGFMSESGLQKIHEHMVKELKKKGAIIHEVVYCPHKPKSGCA
                     CRKPNSKLIIDLGKKYNIDLSKSYMVGDTDTDIIAGKQAGTKGVFLGEDDPLADAIFP
                     DLMRAARWIIKDATA"
     gene            587798..587977
                     /locus_tag="BSPH_RS02815"
                     /old_locus_tag="Bsph_0567"
                     /db_xref="GeneID:6024989"
     CDS             587798..587977
                     /locus_tag="BSPH_RS02815"
                     /old_locus_tag="Bsph_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036162532.1"
                     /db_xref="GI:738206619"
                     /db_xref="GeneID:6024989"
                     /translation="MTKDKRNKKHLDREEYGYGFDISVDDLGVIGQNNEAKKQNDNEN
                     KDKPHNKDNPSTLNK"
     gene            complement(588106..588372)
                     /locus_tag="BSPH_RS02820"
                     /old_locus_tag="Bsph_0568"
                     /db_xref="GeneID:6024990"
     CDS             complement(588106..588372)
                     /locus_tag="BSPH_RS02820"
                     /old_locus_tag="Bsph_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008178058.1"
                     /db_xref="GI:495453364"
                     /db_xref="GeneID:6024990"
                     /translation="MERFFLYDDVEDTKTRFVSFAGKKLRYDLAILQSGRFFGKVLVM
                     DIQFGRFAIIGPDDVEEPGYLEHVYNRTEDETEELREYLRELLN"
     gene            588461..588913
                     /locus_tag="BSPH_RS02825"
                     /old_locus_tag="Bsph_0569"
                     /db_xref="GeneID:6024991"
     CDS             588461..588913
                     /locus_tag="BSPH_RS02825"
                     /old_locus_tag="Bsph_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418562.1"
                     /db_xref="GI:670469935"
                     /db_xref="GeneID:6024991"
                     /translation="MYFVDRNKITKNLQYLDGLLAILETENNWSQNDIKKLAIERIGH
                     NIMESMMDVGNLMIDGFIMRDPGSYEDIIDILIDEKVVVAEMEAPYKAVVGLRKMLVR
                     EFIEVDIDEVIHVLTANLSALKQFSPAVHHYLTNELGPVSAFLPEDHQ"
     gene            588910..589662
                     /locus_tag="BSPH_RS02830"
                     /old_locus_tag="Bsph_0570"
                     /db_xref="GeneID:6024992"
     CDS             588910..589662
                     /locus_tag="BSPH_RS02830"
                     /old_locus_tag="Bsph_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_012292345.1"
                     /db_xref="GI:501249327"
                     /db_xref="GeneID:6024992"
                     /translation="MRAYKAYCFDLDGTVYRGKEGIPSAIAFIHRLQQAGIEPFYVTN
                     NSSKTREQLQDALLSIGIRAPLEHIYSSASVTAKYVALHYAGKKVAMMGSDGIRQALL
                     SENIVPVEDEADVFVMGIDRTLDYMALARAAIFVQKGAIFIATNQDIKFPTEYGFLPG
                     NGSFARLVGEVAGVDPIYIGKPSPAILEVIATEHNFSKEDMVMIGDNYDTDIMCGINF
                     GCDTIHVNTGVTPTKVVQEKVLQPTYVVDALQ"
     gene            complement(589744..589980)
                     /locus_tag="BSPH_RS02835"
                     /old_locus_tag="Bsph_0571"
                     /db_xref="GeneID:6022315"
     CDS             complement(589744..589980)
                     /locus_tag="BSPH_RS02835"
                     /old_locus_tag="Bsph_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008178065.1"
                     /db_xref="GI:495453371"
                     /db_xref="GeneID:6022315"
                     /translation="MNPMVEFCISNLANGSQATYEVLERDPNIDVLEYGCLSYCTKCS
                     ESFYAIVNGELVEADSPEALTKAIYQFIEENPLW"
     gene            590250..591313
                     /locus_tag="BSPH_RS02840"
                     /note="NADH dehydrogenase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319655"
     gene            complement(591360..591695)
                     /locus_tag="BSPH_RS02845"
                     /old_locus_tag="Bsph_0574"
                     /db_xref="GeneID:6022318"
     CDS             complement(591360..591695)
                     /locus_tag="BSPH_RS02845"
                     /old_locus_tag="Bsph_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide oxidoreductase"
                     /protein_id="WP_012292349.1"
                     /db_xref="GI:501249331"
                     /db_xref="GeneID:6022318"
                     /translation="MQPTKPMIEIYGTAVICASCVNAPSSKDTYEWLQSAIDRKYPDQ
                     QYDIRYIDIEGPIENERDQDYATRIQEDEFFYPLVLINNEVVGEGYVQLKPVFTALEG
                     LGFVPDETV"
     gene            591780..592016
                     /locus_tag="BSPH_RS02850"
                     /old_locus_tag="Bsph_0575"
                     /db_xref="GeneID:6022319"
     CDS             591780..592016
                     /locus_tag="BSPH_RS02850"
                     /old_locus_tag="Bsph_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010676419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen-fixing protein NifU"
                     /protein_id="WP_004228295.1"
                     /db_xref="GI:490348522"
                     /db_xref="GeneID:6022319"
                     /translation="MAEATINDQVQEVLDKLRPFLLRDGGDCELVDVEDGVVKLRLLG
                     ACGSCPSSTITLKAGIERALLEEVPGIVEVEQVF"
     gene            complement(592064..592756)
                     /locus_tag="BSPH_RS02855"
                     /old_locus_tag="Bsph_0576"
                     /db_xref="GeneID:6020645"
     CDS             complement(592064..592756)
                     /locus_tag="BSPH_RS02855"
                     /old_locus_tag="Bsph_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292350.1"
                     /db_xref="GI:501249332"
                     /db_xref="GeneID:6020645"
                     /translation="MDISPYYEKQIQCLNCKKDFPTLKVRSKFIKVEHTETDFHPIYT
                     DDVNALYYNVFVCEHCGFSFTEDFTKYFAPGIQDEIHTQITKKWVHHDFKGERTVFQA
                     IQAYKLAFLCGTIKKEKHVAIAGLALRLAWLYRSLKNSGQEERFMKLARDHYMESYST
                     EDYSSTQMSAVRIMYMIAELSRRIGDIENATRFFSRVIEKQSSGGEAKIVDMAKEQWA
                     IIREEKEHARHI"
     gene            592943..593317
                     /locus_tag="BSPH_RS02860"
                     /old_locus_tag="Bsph_0577"
                     /db_xref="GeneID:6020646"
     CDS             592943..593317
                     /locus_tag="BSPH_RS02860"
                     /old_locus_tag="Bsph_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_025116662.1"
                     /db_xref="GI:640692339"
                     /db_xref="GeneID:6020646"
                     /translation="MTSTKQVIEITQAAGFHINEMMEHNEEQGSFLRVVVNGGGCSGL
                     SYGMHFDQEKKEDDFVDVQHGLTILVSREDAPILMGTKIDYKQSLMGGGFTIDNPNAI
                     ASCGCGTSFKTAKREGTPEICE"
     gene            complement(593558..594079)
                     /locus_tag="BSPH_RS02865"
                     /old_locus_tag="Bsph_0578"
                     /db_xref="GeneID:6020647"
     CDS             complement(593558..594079)
                     /locus_tag="BSPH_RS02865"
                     /old_locus_tag="Bsph_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418555.1"
                     /db_xref="GI:670469928"
                     /db_xref="GeneID:6020647"
                     /translation="MIIKMTSSNMKDYNKSNHGFIVSGKIIPTYKNKVWTFTEEIGTE
                     PFFKKYEDDEIDLSYINDMEKAVFFYYIESNCVGQIKLCSNWNGYALIEDIAVAKDYR
                     KDGIGTALIKKAIEWAKERNYCGLMLETQDINVSACHFYAKNQFVIGAVDTMLYSNFP
                     TANEIAIFWYYRF"
     gene            complement(594239..594796)
                     /locus_tag="BSPH_RS02870"
                     /db_xref="GeneID:23319656"
     CDS             complement(594239..594796)
                     /locus_tag="BSPH_RS02870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041658741.1"
                     /db_xref="GI:753951668"
                     /db_xref="GeneID:23319656"
                     /translation="MLHLHYHTRPGKYFIVALIFAILTPFLAFFMPLTISQTFYAHRE
                     DVVLMTPPSNFIMLLIALGLIFLVLLVLGLKRNTKIYILACVIILGSIVLGYYSLLSY
                     SAIKKEEIVYQQYHHQTIYKWQDIKEVTYEYEIGTVGTYFFLTTNNEQFMIVENGQFG
                     LDEKRAIYKLAVLNGVKFTEREKLD"
     gene            594968..595465
                     /locus_tag="BSPH_RS02875"
                     /old_locus_tag="Bsph_0580"
                     /db_xref="GeneID:6020649"
     CDS             594968..595465
                     /locus_tag="BSPH_RS02875"
                     /old_locus_tag="Bsph_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_012292354.1"
                     /db_xref="GI:501249336"
                     /db_xref="GeneID:6020649"
                     /translation="MRKDRGKIWLGVSGVTVNELGPWLVVKKAYSGLKGRWSLPAGFV
                     NAGETVDEAVIREIKEETGIDCSVSGLIGFRTGVIRDDISDNMAIFYCRMLDEQQQVC
                     IQEKEILEAKWLYPQELAQDEATSVMLKEMATNQFQKHQLEAIEGINPGDIFGYTSYR
                     LFFKK"
     gene            595490..597237
                     /locus_tag="BSPH_RS02880"
                     /note="histidine kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319657"
     gene            597244..597987
                     /locus_tag="BSPH_RS02885"
                     /old_locus_tag="Bsph_0583"
                     /db_xref="GeneID:6020690"
     CDS             597244..597987
                     /locus_tag="BSPH_RS02885"
                     /old_locus_tag="Bsph_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012292357.1"
                     /db_xref="GI:501249339"
                     /db_xref="GeneID:6020690"
                     /translation="MNVYIVDDEPLARAELRYLLEQTALVNICGESESLDEFYHTTQY
                     EQVDCLFLDIELGMNNGLDLAKQLLLHEQKPEIIFATAFDEYALQAFEVNAFDYILKP
                     FEAQRVQAAVEKLVAKRRAAQVKTIEEIKVSQLDKLDKLTVYVNDRILLMKIQDILYC
                     TSEDSKTVVVTEQGRFFASESLAALEKKLTLKGFVRVHRAFIVNLEHIVELEPWSSSK
                     YNLILYNRHSIPVSRLYMKDVRKIFDLSR"
     gene            598106..599899
                     /locus_tag="BSPH_RS02890"
                     /old_locus_tag="Bsph_0584"
                     /db_xref="GeneID:6020691"
     CDS             598106..599899
                     /locus_tag="BSPH_RS02890"
                     /old_locus_tag="Bsph_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation protein CstA"
                     /protein_id="WP_031418550.1"
                     /db_xref="GI:670469923"
                     /db_xref="GeneID:6020691"
                     /translation="MNAITIVIGSICVLVISYRLYGIFFTKKVLKIKDDTPTPAHALE
                     DGKDYVPTNKWVTFGHHFAAIAAAGPLVGPILAAQFGYLPGLLWLLIGAVIGGAVHDA
                     VVLFASMRHGGKSLSEVMKEELGPIAGFCTGLAMLFIITITMAGLSMVVLGALERNPW
                     GTFAVGITIPIAMLVGIAYRKTGNLLATSAVGFILLMIGVFIGPLIQGTAFGDFLTFD
                     RDTLAIILPIYAFFAAALPVWLLLAPRDYLSSFMKIGVFIALIIGVFFVNPAIQFPPF
                     TEFIHGGGPVIAGPVWPFVSITIACGAISGFHAFVGSGTTPKMIDRWEDIRIVGFGAM
                     LVESLVGVMALIAATALHPADYFAINSAPAVFATLGMEPVHLQALSQSIGMDLEGRTG
                     GAVTLAVGMTDIFTGIPWFAELSSYFYQFVIMFEAVFILTAIDAGTRVARYLIQDFGG
                     NVYKPLKRTNWIPGTIFASALACFMWGYLLYSGDISSIWVLFGVSNQLMAAIGLVCGV
                     TMVLKVADKRIYALTCFIPLTYLYITVNVAGYWMIKNVYWNPAAAGFNMLNGILSVIM
                     LMLGLLIVISAFKKWAQLWKSQKFVLTQSTS"
     gene            600102..600431
                     /locus_tag="BSPH_RS02895"
                     /old_locus_tag="Bsph_0585"
                     /db_xref="GeneID:6020692"
     CDS             600102..600431
                     /locus_tag="BSPH_RS02895"
                     /old_locus_tag="Bsph_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292359.1"
                     /db_xref="GI:501249341"
                     /db_xref="GeneID:6020692"
                     /translation="MDGPVSLVQLIISILLFFVMFFGIGFLLNMLLRMTWLMAIVYPI
                     VVIFIVDEVSFLDYIFKPGSAFPALIDKLQALQFVDIAILSGGLAGSIVAGIVMIYLR
                     KSGYRMF"
     gene            complement(600529..601011)
                     /locus_tag="BSPH_RS02900"
                     /old_locus_tag="Bsph_0586"
                     /db_xref="GeneID:6020844"
     CDS             complement(600529..601011)
                     /locus_tag="BSPH_RS02900"
                     /old_locus_tag="Bsph_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_036160560.1"
                     /db_xref="GI:738204643"
                     /db_xref="GeneID:6020844"
                     /translation="MNMSLLQNTPLLIALFSVIFAQFVKIPIHFLMTRQVKWSLFTST
                     GGMPSSHSASVTGLATSIAYETGLASPIFAVAAMFSIIVMYDASGVRYQAGQHAAILN
                     QLRKDFQTLLHDLKKWPQMDGQEKMEELKTLLGHKRSEVFFGALTGIFIAIITYEFFI
                     "
     gene            601163..602644
                     /locus_tag="BSPH_RS02905"
                     /old_locus_tag="Bsph_0587"
                     /db_xref="GeneID:6020845"
     CDS             601163..602644
                     /locus_tag="BSPH_RS02905"
                     /old_locus_tag="Bsph_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_041658742.1"
                     /db_xref="GI:753951670"
                     /db_xref="GeneID:6020845"
                     /translation="MKRFRLELLVVGVTKHREQMQNWTSFSSFYGESLDMWVSAGDVS
                     TELKKLTKLPFVKEHANLKRILFVGLDERKNLTEGDVRAAFGLVGKELRALKVKEYSI
                     WLESFTTETISVTDVAFLAGEGIGLGYYSIPHYKTTSNEVDKRIEAVHLVTTAGDLDE
                     VVAGFEVGVIYADAVNEARSLINLPPNLLTATDLANYAESLASEYNFEVEILGKAQLE
                     ELGMGGILSVNQGSYEEPRLITLKYKATDDFENPIGLVGKGVTYDTGGYSLKPKDSMV
                     GMKGDMGGAAAVLGAMKIIGELRPNKNVVAVIGSTDNMVSDTAFKPDDVITTYSGKTV
                     EVLNTDAEGRLVLADATTYAKQQGAASLIDVATLTGGVITALGMDKTGALSNDDEFFA
                     AFMEAAGETDEFVWRMPLTESDKKRIRKSDVADLNNSPGRDGHMIFGGGFVGEFVGET
                     PWIHLDIAGTSDAVAAHDLGPKGGTGVMVRTLANFVQRLGEEK"
     gene            602779..602982
                     /locus_tag="BSPH_RS02910"
                     /old_locus_tag="Bsph_0588"
                     /db_xref="GeneID:6020846"
     CDS             602779..602982
                     /locus_tag="BSPH_RS02910"
                     /old_locus_tag="Bsph_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016991509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="WP_012292362.1"
                     /db_xref="GI:501249344"
                     /db_xref="GeneID:6020846"
                     /translation="MRNFGGYPGGGFGGFIWPFGAPFFGGFLGSFLGSQFNQYPYNPY
                     YPNYRPYPPGPFYRPGPRYRRPW"
     gene            603378..604151
                     /locus_tag="BSPH_RS02915"
                     /old_locus_tag="Bsph_0589"
                     /db_xref="GeneID:6020847"
     CDS             603378..604151
                     /locus_tag="BSPH_RS02915"
                     /old_locus_tag="Bsph_0589"
                     /EC_number="2.1.1.107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292363.1"
                     /note="catalyzes 2 sequential methylations, the formation
                     of precorrin-1 and S-adenosyl-L-homocysteine from
                     S-adenosyl-L-methionine and uroporphyrin III, and the
                     formation of precorrin-2 and S-adenosyl-L-homocysteine
                     from S-adenosyl-L-methionine and precorrin-1; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="WP_012292363.1"
                     /db_xref="GI:501249345"
                     /db_xref="GeneID:6020847"
                     /translation="MGKVYIVGAGPGDVDLITVKGLRCIECADVILYDRLINKELLNY
                     AKQDAQLIFCGKLPQQHAMIQEHINQTLVSYAQQGLIVTRLKGGDPFVFGRGAEEAEV
                     LVKHHIPFEIVPGITSGIAAPAYAGIPVTHRDLGSSFAMVTGHMQEGKDDAIRWESLA
                     KGIDTIAIYMGVGNLPYIRQQLLQYGRGEETPVAVIHWGTFTAKQKTVTGTLATIEEI
                     VQTENIQNPSIILVGEVVRLRETIQWFEHNGPQPIQVTG"
     gene            604164..604904
                     /locus_tag="BSPH_RS02920"
                     /old_locus_tag="Bsph_0590"
                     /db_xref="GeneID:6020848"
     CDS             604164..604904
                     /locus_tag="BSPH_RS02920"
                     /old_locus_tag="Bsph_0590"
                     /EC_number="4.99.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sirohydrochlorin ferrochelatase"
                     /protein_id="WP_012292364.1"
                     /db_xref="GI:501249346"
                     /db_xref="GeneID:6020848"
                     /translation="MQAILYIAHGSRVKAGVDQAVAFLQGVQQEVQVSIQEICFLELA
                     TPTIGEGIANCVRQGATRIAIVPILLLAAQHAKEDIPIEIAKAQKLFPHILFSYGEPL
                     GIHERIIDSLQARILEKQQPKHEASVLLIGRGSSDPAVKRDLAEIAARLRMKYNYQTV
                     DTCFLYGMGPSFDDWLQQEKERQHQVFIVPYLLFTGILRQSIAKRLQGLSNNNMVLCE
                     SLGYDVNVKKVLVERINELLHFKEEGVS"
     gene            605099..606883
                     /locus_tag="BSPH_RS02925"
                     /old_locus_tag="Bsph_0592"
                     /db_xref="GeneID:6024842"
     CDS             605099..606883
                     /locus_tag="BSPH_RS02925"
                     /old_locus_tag="Bsph_0592"
                     /EC_number="1.8.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase subunit alpha"
                     /protein_id="WP_012292366.1"
                     /db_xref="GI:501249348"
                     /db_xref="GeneID:6024842"
                     /translation="MKLQVINSPFNEEQVKLLNELLPQLTLEQKIWLNGYLSAAQATQ
                     EPIVVTAPATTQSITKTMTILYGSQTGNSQGLAEKYASLLEAQNVDVTVSSLGKFKAS
                     NLKKITNLLLIVSTHGEGDPPDQAIQFYEFLHSKRAPKLEHLQYSVLALGDSSYEFFC
                     KTGKDFDEQFAKLGATRMVPRTDCDVDYDDAAAQWFSAVQQEFLKQATAISVTSTESD
                     EILGATTYSRKNPFYAEVLENINLNGRGSNKETRHLELSIEGANFQFEPGDSIGIQPE
                     NSELLVDALLGALQFDPATEVTVFDEILSLKNALQKRLEITVLSKPVLEKIKAYTEHN
                     EFSRLLEEPNAWKDYAKGRDLLDVVEDFAPFTWSAQQFVDILRKIPSRLYSIASSQLA
                     NNDEVHLTISKVSYETNGRQRLGVCSGSVADLQIGDTLPIYVHKNPNFRLPEQKETPI
                     IMIGAGTGIAPYRAFLEEREELGVVGKAWLIFGDQHFVTDFLYQTDWQRWLASGTLSQ
                     MHIAFSRDTDKKIYVQHKIEENAANFYEWLEQGAVIYVCGDEKSMAADVDATIHRIIE
                     QQGQKSSEQAKAFVQELKQQKRYQRDVY"
     gene            606971..608689
                     /locus_tag="BSPH_RS02930"
                     /old_locus_tag="Bsph_0593"
                     /db_xref="GeneID:6024843"
     CDS             606971..608689
                     /locus_tag="BSPH_RS02930"
                     /old_locus_tag="Bsph_0593"
                     /EC_number="1.8.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HXC1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase"
                     /protein_id="WP_012292367.1"
                     /db_xref="GI:501249349"
                     /db_xref="GeneID:6024843"
                     /translation="MTEKIVLPPQSGKPSDVERIKTESNYLRGTLERTMNDPLSSGIP
                     EDDNRLMKFHGSYLQDDRDLRNERQRQKLEPAYQFMVRVRTPGGAATPAQWLVMDEMA
                     RKYGNGSLKLTTRQAFQVHGILKWNVKKYMQEINEVLLDSLAACGDVNRNVMCNVNPN
                     QSALHEEVYNWSAKLSEHLLPRTRAYHELWLDGEKVIDSQDDEIEPIYGAQYLPRKFK
                     IAIAIPPSNDVDVFSQDIGLIAIVEDEKLIGFNVAVGGGMGMTHGDHATYPQLAREIG
                     FITPDKLLETAEKIITIQRDYGNRSVRKNARFKYTIDARGLEWFNEELTRRLGWSIQE
                     ARPYTFERTGDEFGWIKGAEGKWHYTLFIQNGRIKDFQDYKLLTGLREIAKVHTGDFR
                     LTPNQNLMISNVTPQKKKKIAAIIEQYKLTDGAHYSALRRNSIACVSLPTCGLAMAEA
                     ERYLPSLITKIETIIDETGLNDTEIVIRMSGCPNGCSRAAMAEIGFIGKGPGKYNLYL
                     GASFTGNRLNKIYRENIGEEEILAELRPILVHYAKERLVGEHFGDFVIRAGYVTAVYD
                     GREFHV"
     gene            complement(608730..609800)
                     /locus_tag="BSPH_RS02935"
                     /old_locus_tag="Bsph_0594"
                     /db_xref="GeneID:6024844"
     CDS             complement(608730..609800)
                     /locus_tag="BSPH_RS02935"
                     /old_locus_tag="Bsph_0594"
                     /EC_number="3.6.3.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter ATP-binding protein"
                     /protein_id="WP_012292368.1"
                     /db_xref="GI:501249350"
                     /db_xref="GeneID:6024844"
                     /translation="MSIQIQNVSKIYGSFQALEDISIHIQSGELVALLGPSGSGKTSL
                     LRVIAGLETTDTGDIFFDGHSMTDRHPKERNVGFVFQHYALFRHMTVFENVAYGLKVR
                     PRKTRPTKQEIRDKVMELLPLVKLENFSDRYPTQLSGGQRQRVALARALAVEPKVLLL
                     DEPFGALDAKVRKELRRWLRKLHDEFHITSIFVTHDQEEALDVADRIVVMNNGKIEQI
                     GSPDEVYTHPKSPFVYDFLGNVNLFKGRLHNGKLMHGEVALDVPDVQSHSKDNVIGYV
                     RPHDIQIEKVNIPGTVPVKINHIHLLGPIVQIELRREDLDEFLEAELSKEQFLHLQLE
                     VGDHIFVRPKQLKVFIPEDYSI"
     gene            complement(609816..610688)
                     /locus_tag="BSPH_RS02940"
                     /old_locus_tag="Bsph_0595"
                     /db_xref="GeneID:6024845"
     CDS             complement(609816..610688)
                     /locus_tag="BSPH_RS02940"
                     /old_locus_tag="Bsph_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease"
                     /protein_id="WP_012292369.1"
                     /db_xref="GI:501249351"
                     /db_xref="GeneID:6024845"
                     /translation="MEQSAFIQQASPEKNKVPKSVALQEPRVIRYTLTCIALVFLAFF
                     IVLPLASIFITAFQKGVDVYLAAITHPDALAAIKLTLTVVAIAVPLNAIFGVMAAWTL
                     TKFNFKGKNLLLTIVDLPFAVSPVIAGLVFILLFGSQGLFGDWLFAKDIKIVFALPGI
                     VLATIFVTLPFVARELIPLMQAQGTSEEEASISLGASGFKTFWYVTLPNIKWGLFYGL
                     ILCNARAIGEFGAVSVVSGHIRGMTNTMPLHIEILYNEYQFSAAFAVASLMSVIAIFT
                     LILKDIIAWKSKSS"
     gene            complement(610699..611532)
                     /locus_tag="BSPH_RS02945"
                     /old_locus_tag="Bsph_0596"
                     /db_xref="GeneID:6020618"
     CDS             complement(610699..611532)
                     /locus_tag="BSPH_RS02945"
                     /old_locus_tag="Bsph_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/thiosulfate transporter subunit"
                     /protein_id="WP_012292370.1"
                     /db_xref="GI:501249352"
                     /db_xref="GeneID:6020618"
                     /translation="MSSLTLTKKSRRIIPGFHLSLGYTMLYVSLLVLLPLSMIFFHTM
                     SLSWTVFLDIITDPRAVASYKVSFSTALIAGLLNVLFGTIIAWVLVRYQFPFKRMMDG
                     LVDLPFALPTAVAGIALTSLYAPNGWIGQFFDFKIAFTPLGIIIALTFIGLPFVVRTV
                     QPVLQNISAEVEEASASLGANRLQTFRKVILPELLPAILTGFSLAFARALGEYGSVVF
                     IAGNMPMKTEITPLIIMTKLEQYDYAGATAIAVVMLVTSFILLLTINVIQWLANRRFV
                     H"
     gene            complement(611544..612596)
                     /locus_tag="BSPH_RS02950"
                     /old_locus_tag="Bsph_0597"
                     /db_xref="GeneID:6020619"
     CDS             complement(611544..612596)
                     /locus_tag="BSPH_RS02950"
                     /old_locus_tag="Bsph_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter subunit"
                     /protein_id="WP_041658743.1"
                     /db_xref="GI:753951673"
                     /db_xref="GeneID:6020619"
                     /translation="MKKRKNVFQSLALLAVLTLSVTGCSSANSNEDTSGQEGNKSVEL
                     LNVSYDPTRELYDEFNQDFIKKWKDETGQDVTIKQCHGGSGKQGRAVIDGLEADVVTL
                     ALAYDIDEIAQTRELLNKDWQTEFDHNSTPYTSTIVFLVRKGNPKDIQDWDDLIKKDV
                     SVITPNPKTSGGARWNYLAAWGYAGKLYNNDETKIKEFMKSLYSNVEVLDSGARGATT
                     TFVERNIGDVLIAWENEAYLSLHELGKDEFEIITPSLSILAEPPVAIVDKIVDKKGTR
                     EVAEAYLQHLYSDTGQEIAAKNYYRPRNEAVLAKYKDQFPQLELVSIDDFGGWTKAQA
                     THFKDGGTFDEIYLPQ"
     gene            613051..613752
                     /locus_tag="BSPH_RS02955"
                     /old_locus_tag="Bsph_0598"
                     /db_xref="GeneID:6020620"
     CDS             613051..613752
                     /locus_tag="BSPH_RS02955"
                     /old_locus_tag="Bsph_0598"
                     /EC_number="1.8.4.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1HXC6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="WP_012292372.1"
                     /db_xref="GI:501249354"
                     /db_xref="GeneID:6020620"
                     /translation="MLTHANWQEPNINFQVDEMYRGALEVLRWSYQEYGNEIVYACSF
                     GIEGIVLIDLISKVKPNATIVFLDTDVHFKETYETIRRVKEKYPQLNIVMKKSALTLE
                     QQAAQYGEELWKSDPNQCCAIRKIKPLHEALSGTKAWISGLRREQSPTRQQTNFLNRD
                     DKFKSIKVCPLIHWTWKDVWRYVSKNNLPYNPLHDQGYPSIGCEHCTKPAFTMDDLRS
                     GRWQGSGKTECGLHE"
     gene            613765..614829
                     /locus_tag="BSPH_RS02960"
                     /old_locus_tag="Bsph_0599"
                     /db_xref="GeneID:6020621"
     CDS             613765..614829
                     /locus_tag="BSPH_RS02960"
                     /old_locus_tag="Bsph_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178114.1"
                     /note="similar to phosphate permease AF_1798; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate permease"
                     /protein_id="WP_012292373.1"
                     /db_xref="GI:501249355"
                     /db_xref="GeneID:6020621"
                     /translation="MLEYFAIAISLFFAMNIGASGAAASMGVAYGAGAIKKAWQALLL
                     CAIGVYSGAVLGGGEVVKTISSGIMPQEYITVKIVIIILISATSSLFFANLLGIPLST
                     SEVTVGAVVGVGIAYKVLFVQSLLVIMSFWVIVPLIAFVMALILGKLLYKLQLRGLLK
                     DHPILTILLVLAGFFEAFSAGMNNVANAVGPLVGAGMMDVTIGIMLGGGFVAAGAILL
                     GKRVLETNGKKIMRFQKAEGILISSTGALLVGISSIFGLPVPLTQVTSSSIIGMGMAK
                     NGKQIFHKHIVKKIIRIWVVSPIFSLAISYFLVQLFLEKDLYAVIINGSIIVGTLGVI
                     SLMRTIREEEQSIYDAGEGI"
     gene            614908..616047
                     /gene="sat"
                     /locus_tag="BSPH_RS02965"
                     /old_locus_tag="Bsph_0600"
                     /db_xref="GeneID:6020622"
     CDS             614908..616047
                     /gene="sat"
                     /locus_tag="BSPH_RS02965"
                     /old_locus_tag="Bsph_0600"
                     /EC_number="2.7.7.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178115.1"
                     /note="ATP sulfurylase; ATPS; converts ATP and sulfate to
                     5'phosphosulfate and pyrophosphate; in some organisms this
                     enzyme is involved in the incorporation of inorganic
                     sulfate while in others it is involved in the production
                     of ATP in the reverse direction; the enzyme from Thermus
                     thermophilus is dimeric and binds a zinc ion that is
                     coordinated by cysteine and histidine residues that are
                     not found in all related proteins but is found in some
                     thermophilic organisms; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase"
                     /protein_id="WP_012292374.1"
                     /db_xref="GI:501249356"
                     /db_xref="GeneID:6020622"
                     /translation="MSLQPHGGFLVQAFHPDKEITSIHKEIELDAISLSDLELIAIGG
                     YSPIQGFLTQADYESVVEKSRLVSGIVWSIPITLPVTEEKAATLQPGEEVKLVYQGET
                     FGVIQVADIFEPNKRKEALLVYGTEDLAHPGVHKLHERPAIYVGGKITLIKRLAQKFP
                     TYSFDPVETRQLFASKGWQTIVGFQTRNPVHRAHEYIQKAALETIDGLFLNPLVGETK
                     SDDVSAAIRMESYEILLKNYYPENRVQLGVFPAAMRYAGPREAIFHALVRKNYGCTHF
                     IVGRDHAGVGDYYGTYDAQKIFEQFKEDELGIIPLKFEHSFYCQQCEGMATTKTCPHD
                     SSAHIILSGTKVREMLRNGEVPPSTFSRKEVVDVLIKGMQKEVVK"
     gene            616044..616637
                     /locus_tag="BSPH_RS02970"
                     /old_locus_tag="Bsph_0601"
                     /db_xref="GeneID:6024006"
     CDS             616044..616637
                     /locus_tag="BSPH_RS02970"
                     /old_locus_tag="Bsph_0601"
                     /EC_number="2.7.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylylsulfate kinase"
                     /protein_id="WP_012292375.1"
                     /db_xref="GI:501249357"
                     /db_xref="GeneID:6024006"
                     /translation="MSSNIVWHEASVTKDERRSQNKHQSFILWFTGLSASGKSSIANA
                     FARQLYERGNQAFVLDGDNVRHGLNKDLGFDESGRKENIRRIGEVSKLFIESGQIVLT
                     AFISPYREDRQVVRELVEDGEFIEVFVKCSVETCEKRDPKGLYKKARKAEIANFTGIS
                     APYEEPENPEIILDSEHHTVEECVEQLTSILTAKGYI"
     gene            complement(616694..617062)
                     /locus_tag="BSPH_RS02975"
                     /old_locus_tag="Bsph_0602"
                     /db_xref="GeneID:6024007"
     CDS             complement(616694..617062)
                     /locus_tag="BSPH_RS02975"
                     /old_locus_tag="Bsph_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292376.1"
                     /db_xref="GI:501249358"
                     /db_xref="GeneID:6024007"
                     /translation="MTILANSLVIFFISVGVLFIVVTAIGLIRLPDLYTRAHAASKSA
                     TLGVMCVLIGVFFHFWLIEDHFNPRILLGILFLFITGPVGGHIMTRSSYIAGVKPWKG
                     TVRDELGPEIDRMKKEQDVR"
     gene            complement(617046..617327)
                     /locus_tag="BSPH_RS02980"
                     /old_locus_tag="Bsph_0603"
                     /db_xref="GeneID:6024008"
     CDS             complement(617046..617327)
                     /locus_tag="BSPH_RS02980"
                     /old_locus_tag="Bsph_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228375.1"
                     /note="subunit F of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292377.1"
                     /db_xref="GI:501249359"
                     /db_xref="GeneID:6024008"
                     /translation="MTTFIIAVIVVICLSMIAVIYRMIKGPSASDRVVALDSLGVSLI
                     SLIGLFSILVETSFFLEIILLLAILSFIGTVAFSKFIEKGDIIKRDNSR"
     gene            complement(617324..617803)
                     /locus_tag="BSPH_RS02985"
                     /old_locus_tag="Bsph_0604"
                     /db_xref="GeneID:6024009"
     CDS             complement(617324..617803)
                     /locus_tag="BSPH_RS02985"
                     /old_locus_tag="Bsph_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178121.1"
                     /note="subunit E of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292378.1"
                     /db_xref="GI:501249360"
                     /db_xref="GeneID:6024009"
                     /translation="MAFQMILNFVLAFVWMFLSSNYTATGFIIGFLMGIILLIIMRRF
                     FKSRLYVYRLWAILKLTSLFFKELVLANVQVLKVVLKPKLDMQPAFFAYPTVLTEDWE
                     ITLLSSLITLTPGTVVVHVSDDAKTLYVHAIDINDVDEAVASIRDSFEKAILEVSKS"
     gene            complement(617808..619295)
                     /locus_tag="BSPH_RS02990"
                     /old_locus_tag="Bsph_0605"
                     /db_xref="GeneID:6024010"
     CDS             complement(617808..619295)
                     /locus_tag="BSPH_RS02990"
                     /old_locus_tag="Bsph_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292379.1"
                     /note="subunit D of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; contains an oxidoreductase domain; catalyzes the
                     transfer of electrons from NADH to ubiquinone; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292379.1"
                     /db_xref="GI:501249361"
                     /db_xref="GeneID:6024010"
                     /translation="MNNFLLLPIIIPFFFGMILMFGQKNLMYQRTFSLLGIGISLITA
                     ISLLLKVKHDGIQKVTFGDWPVPYGITMVSDMVSALLVTTTLLIAFFVVWYGFGSITK
                     ERERFFYYPGIMFILTGVNGAFTTGDIFNLFVFFEVLLMASYLLIVLGGEKGQLKGSI
                     KYILINVISSALFVITVAFLYSVVGTLNMADIAVKIAEINQPGIITVIAVLFLMVFGL
                     KAAIFPLYFWLPTSYAAAPIPVLTLFGALLTKVGVYAITRTYTLFFVHDLSYTHDLLM
                     VLAIATIVAGCIGALAYFDVKLIIIYNIVIAVGVILFGVSQMNEASLKGAMFYLVHDM
                     LIKAALFMLIGIIIYITGTSDLRKMGGLMKKYPVLGWCYLIAAFGLAGIPPLSGFVGK
                     LLIVQGGFEAGNMWSSIFILASSLLVLLSVIRIFIYAFWGEEKETKGTVDKSIYKMLF
                     MPSALLVLISVVYGVGSEWMTPFMDDAAKLLNDPSIYIDAVMKGD"
     gene            complement(619288..619629)
                     /locus_tag="BSPH_RS02995"
                     /old_locus_tag="Bsph_0606"
                     /db_xref="GeneID:6023320"
     CDS             complement(619288..619629)
                     /locus_tag="BSPH_RS02995"
                     /old_locus_tag="Bsph_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292380.1"
                     /note="subunit C of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292380.1"
                     /db_xref="GI:501249362"
                     /db_xref="GeneID:6023320"
                     /translation="MEIIMAFVIGFLFMAAVYLILSKSLLRIIIGTGLLSHGAHLLIL
                     TMGGLGGEAPPVLNEGAKPFADPLPQALILTAIVISFGVTAFFLVLAYRSYQELQTDD
                     ISLMRGSDEDE"
     gene            complement(619629..620051)
                     /locus_tag="BSPH_RS03000"
                     /old_locus_tag="Bsph_0607"
                     /db_xref="GeneID:6023321"
     CDS             complement(619629..620051)
                     /locus_tag="BSPH_RS03000"
                     /old_locus_tag="Bsph_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292381.1"
                     /note="subunit B of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; in the case of S. meliloti it was proved to be
                     involved specifically with K+ transport; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292381.1"
                     /db_xref="GI:501249363"
                     /db_xref="GeneID:6023321"
                     /translation="MKTNDVIIQFTAKIVFFIIFFFSIHIFLAGHYTPGGGFVGGLLT
                     SSAIVLLVLAFDIRTVRHILPINYTYLTAIGLLLALATAAFPMFVGEPFFTHFFNYFD
                     LPLLGKQSLHTAMLFDSGVYLVVVGVTMTIIQTIGEDE"
     gene            complement(620038..622419)
                     /locus_tag="BSPH_RS03005"
                     /old_locus_tag="Bsph_0608"
                     /db_xref="GeneID:6023322"
     CDS             complement(620038..622419)
                     /locus_tag="BSPH_RS03005"
                     /old_locus_tag="Bsph_0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_036162535.1"
                     /db_xref="GI:738206622"
                     /db_xref="GeneID:6023322"
                     /translation="MLAAIFVPFLYKSIKNIHTGWFVLAVPATLVVIYASYIAQVAKG
                     GVFTAKLPWIPSLDISFVSYLDGLSLLFSLLITGIGSLVVLYSIFYLDKHKEKLHNFY
                     VYLLLFMSAMLGVVQSDHLITLYFFWELTSISSFLLIGYWYNRDASRLGALKSMMITV
                     GGGLMMLGGFVLLYLMGGTYSIRELMVMAPNLVDHPLFTWSLVLLLLGAFTKSAQFPF
                     YIWLPDAMEAPTPVSAYLHSATMVKAGIYLVARFTPIFAASELWVWLVTGIGILTLFW
                     GSFFAVKQTDLKGILAFSTVSQLGLIMSLLGASAVAFHANESVDTIKFAAFAAIFHLI
                     NHATFKGSLFMIAGIIDHETGTRDIRKLGGLMSIMPISFTVAAIGSLSMAGLPPFNGF
                     LSKEMFLTAMLALQKFEFFGFDTWGVLFPIVAWVASIFTFIYSFYFVFRTFNGNYKPE
                     QLPHKPHEAPIGMLVSPMLLAGLVVLIFFIPNFIGDTFVKPAVLAIQPFLYEVPQDID
                     IHVSAWHGINPELLMTIGIIIIGVLLFVSLPKWQGMYQRFPKAFTLNNAYDKIMQGLD
                     VGLNRLSRLYMTGSMRHYLLYMFSGIAIIVIGSLFVKNAFSFSFQETAPIRPYEIILV
                     VVLLIGTAITILAKSRLTAIIGLGSVGYTVALFFVIFNAPDLALTQLVIETISVALFL
                     MAFYHLPKLGKREERMRFQLNRAVVSITIGAMVTLVALSAHSQKLIPSISKYYEETVY
                     SLAGGGNIVNVILVDYRGFDTLFEITVLGIAGMAILAMIKLRMNRKEKTHENK"
     gene            622604..623167
                     /locus_tag="BSPH_RS03010"
                     /old_locus_tag="Bsph_0609"
                     /db_xref="GeneID:6023323"
     CDS             622604..623167
                     /locus_tag="BSPH_RS03010"
                     /old_locus_tag="Bsph_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292383.1"
                     /db_xref="GI:501249365"
                     /db_xref="GeneID:6023323"
                     /translation="MKNPYIYGYLPLITILLFSLTFGMYAVGESLQIFRAIGVYSGMR
                     EFLSDVELRVFLLIVFAIVFFMLFSALKLVGETIHELGMLFFSKDNDGATVSQARGGY
                     IILFIGAMCSAFAIQFIYVLIGIFVLTVFTYFIYLIYKMSHFMSMGGTIGLLIFELFM
                     WTILLTFIVYVVLKLYNGILASLPFAQ"
     gene            complement(623316..625166)
                     /locus_tag="BSPH_RS03015"
                     /old_locus_tag="Bsph_0610"
                     /db_xref="GeneID:6023324"
     CDS             complement(623316..625166)
                     /locus_tag="BSPH_RS03015"
                     /old_locus_tag="Bsph_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_041658745.1"
                     /db_xref="GI:753951676"
                     /db_xref="GeneID:6023324"
                     /translation="MKKAFGFFIILLSLPVLWWISTNIRTEINTAQAHEEQISQAIHL
                     PEVQPQLPITLKDQNGQTFSEEYVEWRQPLTLQEIPQIAQEIFIASEDADFYEHIGFD
                     LSAIMRAVVANSSTSTSSQGGSTITQQLVRMRYLSDEKTYERKLTELFYAYELEKEFD
                     KEAILTMYLNESYFSNQVYGIGGAATYYFQRPLQQLSIAEIAFIAAIPNNPSLYNPLK
                     NFEQTKARQERLLDTLAVKGSITKEEATTYKAKPITLHIKDKIQSYPMYSTYVLQELK
                     WLVAEKEGYADRLNHTDNEEEKKKIKTQLDNRLDSLFQNGLIINTALDPQKQRHDEQQ
                     MTATLGAGSLQAAGAVIQNQSREIVSLYAGKSYEKFDYHRAFQGTRQPGSAFKPLAVY
                     APFFETTTHTPDSIVNGGSYCVGSFCPHNYGGYKYGDVSLRTAFRHSYNTSALRLFQT
                     VGIDTAFQYLDRFHFRSIVEKDHNYAASLGGLTYGVTALELADAYTSFIDGSYVLAHS
                     IRKVTALDGTELYSWDTQRDQIWSPKTVKYMRELLADVVTNGTGQGVYSNSSYVGAKT
                     GTTNDYRDYWLAGLNDTYTAAVWIGYDKPQSMQKLEEYKIHHQLFNVLLE"
     gene            625404..625991
                     /locus_tag="BSPH_RS03020"
                     /old_locus_tag="Bsph_0611"
                     /db_xref="GeneID:6020860"
     CDS             625404..625991
                     /locus_tag="BSPH_RS03020"
                     /old_locus_tag="Bsph_0611"
                     /EC_number="5.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_012292385.1"
                     /db_xref="GI:501249367"
                     /db_xref="GeneID:6020860"
                     /translation="MFPQLTTDVQAGEVLVEMNTTLGAVKIKLFPEFAPKTVENFLGH
                     AKSGYYNGIIFHRVIQDFMIQGGDPTGTGMGGESIWGDSFEDEFSDKLFNLRGALSMA
                     NAGPNTNGSQFFIVQMKHLPSDMLRQLQGAGFPEEIIEAYAQNGGTPWLDHKHTVFGH
                     VVEGMDIVDKIADVEKDPRDKPLEDVKIESITVFE"
     gene            626014..626226
                     /locus_tag="BSPH_RS03025"
                     /old_locus_tag="Bsph_0612"
                     /db_xref="GeneID:6020861"
     CDS             626014..626226
                     /locus_tag="BSPH_RS03025"
                     /old_locus_tag="Bsph_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292386.1"
                     /db_xref="GI:501249368"
                     /db_xref="GeneID:6020861"
                     /translation="MENLMYQFLYFPEDKSGYIPAAFEFLIMLILCVIVFTLFRKISK
                     KQEMKSKEIEARILAEKKSTNNQQNV"
     gene            complement(626267..627688)
                     /locus_tag="BSPH_RS03030"
                     /old_locus_tag="Bsph_0613"
                     /db_xref="GeneID:6020862"
     CDS             complement(626267..627688)
                     /locus_tag="BSPH_RS03030"
                     /old_locus_tag="Bsph_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292387.1"
                     /db_xref="GI:501249369"
                     /db_xref="GeneID:6020862"
                     /translation="MDLVPLTIERAYMTFLFPFAYQIKDRQKIGHTLLEEGFSFFELN
                     NANLEHAFYGDITIIHEELAQFFYPFLEDKLFPNKMDSPDFLRFSKAFYTQGALHHHE
                     NCINYELMSIDVTLCPFGNGIVTVRTSIDSQYDISDILNFIHYFRVLEAKLREEKGAS
                     HHFSFGHCDSTSELLFNYFIPFLKPFLQHHQDHTYEGLPFFEDERMFSSAYLICDEKA
                     ELLPEHLFRLGQVDGRTPDGKPFISSTNSQYISNYVQEHAHTRWAPNSFIISSAQSQM
                     TLTNRPFEHCSHSIQEFMGTHYYNLFIHYFYKMMLLKLSYEYSEIKWGKDKQIVNELI
                     ELITEFSARYYFEEVVVRTEGREIAQMLRKHFRINEHYVGTKATLNSLYRTQEDQSDN
                     RSNNLLFILTVFTVISGIYGMNLVIEEWKDSNDLDSVWSYTPFEWVAFITALSGIGLS
                     IVLVCFHAFKTIQNMVRRSKRKI"
     gene            complement(627800..628973)
                     /locus_tag="BSPH_RS03035"
                     /note="Fis family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319658"
     gene            629063..629307
                     /locus_tag="BSPH_RS03040"
                     /old_locus_tag="Bsph_0616"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6020627"
     gene            complement(629390..630730)
                     /locus_tag="BSPH_RS03045"
                     /old_locus_tag="Bsph_0617"
                     /db_xref="GeneID:6020628"
     CDS             complement(629390..630730)
                     /locus_tag="BSPH_RS03045"
                     /old_locus_tag="Bsph_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012292391.1"
                     /db_xref="GI:501249373"
                     /db_xref="GeneID:6020628"
                     /translation="MSSRDQFTTKIGFILAAAGSAIGLGAIWKFPYMAGTNGGSVFIL
                     LFVLCTFFIGLPVLIAEFMIGRRGQKDAVTSFKEQAPGKPWYLIGWGGMVIAGLILSF
                     YSVVGGWILSYLGRAFTFKLTNAGSDINFADLFGNIIASPFEAVLVQGLFMLLTVVIV
                     SAGIKGGIEKASTWMMPLLFIFFIILVIRSLTLDGAMEGVKFMFVPDWSYLNAETFLM
                     ALGQAFFSLSVGIAVMITYASYLSKTEKIGNSAINVASMNIIISLLAGLVIFPAVFAL
                     GYTPDQGPGLVFIILPAVFEQLPLGALFLTIFFILLLFATVTSSISMLEIVVAIAIGD
                     KPEKRKKIAWIGGIIIFIVGIPSALSFGILSDVKILDRSIFDFVDFMTNSIGMPIGAL
                     LISIFAGYYYTKDISRKELAASSWIFTIWYMLIRYVSPIAILIIFIQGILPLFK"
     gene            630940..631488
                     /locus_tag="BSPH_RS03050"
                     /old_locus_tag="Bsph_0618"
                     /db_xref="GeneID:6020629"
     CDS             630940..631488
                     /locus_tag="BSPH_RS03050"
                     /old_locus_tag="Bsph_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_012292392.1"
                     /db_xref="GI:501249374"
                     /db_xref="GeneID:6020629"
                     /translation="MVEADLIARAQQGDKDAYIDLIRIHQQTVERFAFQCGVHSNDLA
                     DVSQEVFVKLYRFLHQFKQDRFTTWLYKITLNATRDYYRKEQRELAKGDKLNAHRQTI
                     FLSAEDDVLLFEEDRTLHNAIQSLDEKYRYPIVLYYFHELKYEEIAEVLNISLSTVKV
                     RLLRAKEKLKAALMQEGSVENG"
     gene            631481..633112
                     /locus_tag="BSPH_RS03055"
                     /old_locus_tag="Bsph_0619"
                     /db_xref="GeneID:6020630"
     CDS             631481..633112
                     /locus_tag="BSPH_RS03055"
                     /old_locus_tag="Bsph_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292393.1"
                     /db_xref="GI:501249375"
                     /db_xref="GeneID:6020630"
                     /translation="MDDKQFNQRIALLKKSYERMESKLDPQHVLQQIENEDAIRDSQE
                     TINTILKSSAKWQKPAVWIASIASVLLVGLLISSFMLHPSTLVHSNEEKIESSYEEWF
                     SSLQKKYQEKREKTRVELDIPEEDFKKLSFVESADYKYNDKAKNKKIVLNKMAYDPKY
                     LTQLEQEILDSLQTPRELIERIETYENPMSFAESRYFFSIYYPTKDVLQYYTNELSQY
                     NKVLSQKKKDYPKELNQLIATAKKQYFELSYDGQNYSFRTNPIFMKDAPVSIDRLHPD
                     ILGYFKYLATGSLFNGEDLRFSAEESARILKLYERTLVNDLSNSYLDFQLRNLNKEFE
                     NTWLVLLKGDDKTRYSPEHIELLNDTANGKYGESMRLTAQFILEEFKREGTSKTIDKL
                     TRQDIRMELSYLSNEVYIEIYDGSTGLQIDNRWIIQTEGLYNAYVSSKDDTILDSLNP
                     MNVVSLFLYAQGKGDQETVKQLVSQAVDVDKLVQFDGMQHFTVLYATDTSQTTIKVGV
                     KPESIQMIGQRLTFQLGTVPIEKGEKRFIITAIPE"
     gene            633197..633574
                     /locus_tag="BSPH_RS03060"
                     /old_locus_tag="Bsph_0620"
                     /db_xref="GeneID:6020631"
     CDS             633197..633574
                     /locus_tag="BSPH_RS03060"
                     /old_locus_tag="Bsph_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004228409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general stress protein"
                     /protein_id="WP_012292394.1"
                     /db_xref="GI:501249376"
                     /db_xref="GeneID:6020631"
                     /translation="MVKKYELGDVLTGKVTGIQPYGAFVALDDNTQGLVHISEITYGF
                     VKDVSEFLAVGQEVAVKILEIDEEAEKISLSMRALQERPVTVRKKESPPRKSLQDRVD
                     ESDANGFNSLKDKLQDWIEQSGQ"
     gene            complement(633619..634926)
                     /locus_tag="BSPH_RS03065"
                     /old_locus_tag="Bsph_0621"
                     /db_xref="GeneID:6020607"
     CDS             complement(633619..634926)
                     /locus_tag="BSPH_RS03065"
                     /old_locus_tag="Bsph_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012292395.1"
                     /db_xref="GI:501249377"
                     /db_xref="GeneID:6020607"
                     /translation="MKNSEPLLPFYEFIATNVSVGIHAVDLSGKTIIYNTKMKEIEGF
                     HFDELADRSIIEMFSFRQHESTLMRVLQTGKKEINVKQTYWNKNGHEITTINDTFPLI
                     VEGKLIGAIEFARDITSLEKLVYQPLRRYDEPLTFDMIKAKSEAMKQVIENAKKAAAV
                     KLPVLLIGESGTGKDLVAEGIHHAASPDPEAFMTLVSRRSAQSVLDKLNQLLEEDKDY
                     TFFFERIDFLSLDIQEQLLDILQSLPQSKYMLIGSVGSDPITLIAEKKLSKSLYYFFA
                     TMAITIPNLTDRKEDILPFVDDYFSRHRERFASQVTELAPDVQELFLQYDWPGNLKEL
                     ELLLDEIVSFMTIESTVTSDLLPLHFRFKVQQQDTNNREPEFFMFHQNHDVMPLDAYL
                     REAESYYVQNVLNLYEGNITKAANALGMSRQNLQYRIRKIKKQ"
     gene            635072..636616
                     /locus_tag="BSPH_RS03070"
                     /old_locus_tag="Bsph_0622"
                     /db_xref="GeneID:6020608"
     CDS             635072..636616
                     /locus_tag="BSPH_RS03070"
                     /old_locus_tag="Bsph_0622"
                     /EC_number="1.5.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292396.1"
                     /note="catalyzes the conversion of 1-proline-5-carboxylate
                     dehydrogenase to L-glutamate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_012292396.1"
                     /db_xref="GI:501249378"
                     /db_xref="GeneID:6020608"
                     /translation="MIPYKHEPFTDFSQEANYNAYVEALNKVEGYLGQDYPLIIGGER
                     ITTEDKIVSYNPAKKTEVIGRVSKASKDLAEKAMQAADETFKTWKKVDPAIRADVLFK
                     AAAIIRRRKHEFSALLTKEAGKPWAEADADTAEAIDFLEYYGRQMLRIKNGQPVESRP
                     GEYNRYDYIPLGIGIVISPWNFPFAIMAGTTVAALVTGNTVLLKPASTTPVVAYKFIE
                     VLEEAGLPAGAVNFVPGSGAEVGDYLVDHPKTRFISFTGSRDVGLRINQRASVLNDGQ
                     IWIKRVIAEMGGKDTIVVDKEADLELAAQSIVKSAFGFSGQKCSACSRAVIVEDVYDQ
                     VVNRVEELTNALTVGDPTDFSNFMATVIDQAAFNKITEYIEIGKGEGRLVAGGTADDS
                     VGYFVQPTVFADVEPSARIMKEEIFGPVVAIAKAKDFDHAIEIANDTEYGLTGAVITT
                     NRMNLEKAREEFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLQLHMQAK
                     TTSEML"
     gene            636858..638051
                     /gene="rocD"
                     /locus_tag="BSPH_RS03075"
                     /old_locus_tag="Bsph_0623"
                     /db_xref="GeneID:6020609"
     CDS             636858..638051
                     /gene="rocD"
                     /locus_tag="BSPH_RS03075"
                     /old_locus_tag="Bsph_0623"
                     /EC_number="2.6.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine-oxoacid aminotransferase"
                     /protein_id="WP_012292397.1"
                     /db_xref="GI:501249379"
                     /db_xref="GeneID:6020609"
                     /translation="MTKTQQVIEQTQNYGAANYHPLPIVISEAEGAWVKDPEGNKYLD
                     MLSAYSAVNQGHRHPKIIAALKEQADKVTLTSRAFYSENLGEWYELVGKLTNKEMVLP
                     MNTGAEAVETAFKAARRWAYDVKGVEEGKAEVIACNGNFHGRTMLAVSLSSDEEYRRG
                     FGPMLPNVKLVDYGNLEALKAAITPNTAAFLIEPIQGEAGIVIPTEGFLKAARELCRE
                     NNVLFIADEIQAGLARTGKMFACDWEEVEPDMYILGKALGGGVFPISCVAANRNILGV
                     FNPGSHGSTFGGNPLACAVSIASIKVLLDEKLAERSHDLGEYFKGKLKEINNPVIKEV
                     RGRGLFIGMELTEAARPYCEKLKELGLLCKETHDTVIRFAPPLVISQEDLDWSIEQIE
                     KVFKL"
     gene            638136..639380
                     /locus_tag="BSPH_RS03080"
                     /old_locus_tag="Bsph_0624"
                     /db_xref="GeneID:6020610"
     CDS             638136..639380
                     /locus_tag="BSPH_RS03080"
                     /old_locus_tag="Bsph_0624"
                     /EC_number="1.4.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008178162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_012292398.1"
                     /db_xref="GI:501249380"
                     /db_xref="GeneID:6020610"
                     /translation="MSENLNLFTSTQDVIQDALNKLGYDEAMYELLKEPLRMLQVRIP
                     VKMDDGTTKVFTGYRAQHNDAVGPTKGGVRFHPQVSEEEVKALSMWMTLKCGIVDLPY
                     GGGKGGVICDPRQMSMGEIERLSRGYVRAVSQIVGPTKDIPAPDVFTNAQIMAWMMDE
                     YSRMDEFNSPGFITGKPLVLGGSQGRDRATAQGVTIVIEEAAKKRGIDIKGARVVIQG
                     FGNAGSFLAKFMHDLGAKVIGISDAYGALHDPEGLDIDYLLDRRDSFGTVTTLFENTI
                     SNKELLELDCDILVPAAIENQITADNAHNIKADIVVEAANGPTTAEATKILTERGILL
                     VPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVEERLYKKMVEAFDNVYTTATTRNINM
                     RLAAYMVGVRRTAEASRFRGWV"
     gene            639620..640783
                     /locus_tag="BSPH_RS03085"
                     /old_locus_tag="Bsph_0625"
                     /db_xref="GeneID:6020611"
     CDS             639620..640783
                     /locus_tag="BSPH_RS03085"
                     /old_locus_tag="Bsph_0625"
                     /EC_number="1.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-dependent butanol dehydrogenase A"
                     /protein_id="WP_012292399.1"
                     /db_xref="GI:501249381"
                     /db_xref="GeneID:6020611"
                     /translation="MDSFTFFNPVKLHFGEDALEKLPKELEQYGKKVLVVYGGGSIKT
                     NGVYDAVIDKLQQADKTIFELSGVEPNPRVETARRGIEICKTEGIDLVLAVGGGSVID
                     CSKLIVAGAKYDGDAWDIVKRKVLVEQALPLGTVLTLAATGSEMNSGSVITNAATEEK
                     LGWGSPAAFPKFSILNPAYTVSVPKNHTVYGIVDMMSHIFEQYFHNTTNTPITDEMCE
                     GVLRTVIKTAPKLLEDLENTQLRETILLAGTIGLNGFLSIGSRGDWASHNIEHAVSAV
                     YDIPHAGGLAILQPHWMRLSVPVNPERFAGIATRVFGVDATDKTVEEVAYEGIDRLSA
                     FWSSLGAPNRLADYNIDDSKFQQIVEHAMHNGPFGNFHQLQEKDVRTILQNSL"
     gene            complement(641105..642082)
                     /locus_tag="BSPH_RS03090"
                     /old_locus_tag="Bsph_0627"
                     /db_xref="GeneID:6021527"
     CDS             complement(641105..642082)
                     /locus_tag="BSPH_RS03090"
                     /old_locus_tag="Bsph_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="WP_012292401.1"
                     /db_xref="GI:501249383"
                     /db_xref="GeneID:6021527"
                     /translation="MGELFKLLKDGNKPSLMAACVNAFLGIIKGIAFFLTGNVAMFAE
                     MMHSLGDAANQLFVYIGSALSKKAPTKKFPSGFGRIVNLVCLFAVIIVAILSYETIKE
                     GWHHFIHPTGESSGVLIALGVLFIGIVLEGTVLAKAAVEVLHEAGQEKAGITTIPKAF
                     NYLNRAKPATKLVFMEDLVATSGNILAFIAIVIAHFTGWTRIEGLVSMIIGAMMFYVV
                     GKVFLDNARGVIGETDEEMLNHIAHLVMDDPNIKDIVRLEVIKEGEFLHVELVAEADP
                     KLSLAFLDDVRDHLTEVILSQKGVSKVAILFDEDDGKASWIHLGERPDH"
     gene            complement(642097..642819)
                     /locus_tag="BSPH_RS03095"
                     /old_locus_tag="Bsph_0628"
                     /db_xref="GeneID:6021528"
     CDS             complement(642097..642819)
                     /locus_tag="BSPH_RS03095"
                     /old_locus_tag="Bsph_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein sapB"
                     /protein_id="WP_012292402.1"
                     /db_xref="GI:501249384"
                     /db_xref="GeneID:6021528"
                     /translation="MGTLLENMITYEVGIKLVLAATLSLVIGIERELKKKPVGLKTSL
                     VIATFSCLLTIISIETAYSTPSREDINITMDPLRLAAQIVSGIGFLGAGVILRRGNDS
                     ISGLTTAAMIWGAAGIGIAVGAGFYMDATLAVIIIVFGIEILSPFLMKIGPKRIRMRE
                     ILLKVQIDDDKHTESFLLFLKNNNIIIENIRIKDVPLKNDTVLHELDLRLSLIVSDNL
                     LSFYRSLRTLSYIEKIEMEILN"
     gene            644568..646124
                     /locus_tag="BSPH_RS03100"
                     /old_locus_tag="Bsph_rRNA0716S"
                     /db_xref="GeneID:6021529"
     rRNA            644568..646124
                     /locus_tag="BSPH_RS03100"
                     /old_locus_tag="Bsph_rRNA0716S"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:6021529"
     gene            646427..649350
                     /locus_tag="BSPH_RS03105"
                     /old_locus_tag="Bsph_rRNA0723S"
                     /db_xref="GeneID:6021530"
     rRNA            646427..649350
                     /locus_tag="BSPH_RS03105"
                     /old_locus_tag="Bsph_rRNA0723S"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:6021530"
     gene            649536..649653
                     /locus_tag="BSPH_RS03110"
                     /old_locus_tag="Bsph_rRNA075S"
                     /db_xref="GeneID:6021511"
     rRNA            649536..649653
                     /locus_tag="BSPH_RS03110"
                     /old_locus_tag="Bsph_rRNA075S"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:6021511"
     gene            complement(649744..650416)
                     /locus_tag="BSPH_RS03115"
                     /note="histidine kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23319659"
     gene            650631..651914
                     /locus_tag="BSPH_RS03120"
                     /old_locus_tag="Bsph_0633"
                     /db_xref="GeneID:6021513"
     CDS             650631..651914
                     /locus_tag="BSPH_RS03120"
                     /old_locus_tag="Bsph_0633"
                     /EC_number="4.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292404.1"
                     /note="catalyzes the reversible formation of glyoxylate
                     and succinate from isocitrate; glyoxylate bypass pathway;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate lyase"
                     /protein_id="WP_012292404.1"
                     /db_xref="GI:501249386"
                     /db_xref="GeneID:6021513"
                     /translation="MSTRQERIQTLEKQWAENPRWAGIERTYSAEEVVKLQGTVVIEQ
                     TLARKGATRLWNSLHEEPFINALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGQ
                     MYPDQSLYPANSVPAVVKRINQALQRADQIDHAEGRVDQFDWFAPIVADAEAGFGGPL
                     NVFELVKGMVEAGAAGVHLEDQLASEKKCGHLGGKVLLPTQNAVRNLVAARLAADVMG
                     VDTILIARTDADAADMVTSDIDPRDAEFITGERTPEGFFRTKAGIKQAIARGLAYAPY
                     ADLIWCETSKPSLEEAREFAEAIHAEFPGKMLAYNCSPSFNWKANLSEEEIAEYQREL
                     GKLGYKFQFVTLAGFHALNHSMFELAHDYKDNGMAAYSKLQQAEFASESKGYTATRHQ
                     REVGTGYFDEISQVISGGTSSTTAMAGSTETEQFV"
     gene            652018..653616
                     /locus_tag="BSPH_RS03125"
                     /old_locus_tag="Bsph_0634"
                     /db_xref="GeneID:6020640"
     CDS             652018..653616
                     /locus_tag="BSPH_RS03125"
                     /old_locus_tag="Bsph_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="WP_031418044.1"
                     /db_xref="GI:670469394"
                     /db_xref="GeneID:6020640"
                     /translation="MKQATTGKLKIVGEQNEQTNEILTPEALEFVLALHEKFDARRKE
                     LLNARQKRQKRLDAGEKLDFLPETKHIREGDWSIAPLPQDLQDRRVEITGPVDRKMVI
                     NALNSGAKMFMACFEDASSPTWENMIGGQINMRDAINKTIEFTQASNGKTYKLNAETA
                     VLLVRPRGLHLLEKHVLVQGEPISGSFFDFGLYLFHNAKNALAKGTGPYFYLPKLESH
                     LEARLWNDVFVFAQDYIGIPQGTIKATVLIETILAAFEMDEILYELREHSAGLNCGRW
                     DYIFSYIKRLRNQADVILPDRGQVTMTVPFMKAYTSLCIQTCHKRNAPAMGGMAAQIP
                     VKNDDEANAVAFAKVAEDKRREATEGHDGTWVAHPGMVATAMEQFDAIMPTPNQIHKK
                     REDVHVTAEDLVAVPEGTITLEGLRVNCSVGVQYIASWLRGNGAAPINNLMEDAATAE
                     ISRTQVWQWIRHPKGILDDGRGITLAFVLEILEEELTKIKEAVGEQAYNCGRFDEAAE
                     LFKSLIAQDEFAEFLTLPGYEKLA"
     gene            complement(653839..654504)
                     /locus_tag="BSPH_RS03130"
                     /old_locus_tag="Bsph_0635"
                     /db_xref="GeneID:6020641"
     CDS             complement(653839..654504)
                     /locus_tag="BSPH_RS03130"
                     /old_locus_tag="Bsph_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_031418045.1"
                     /db_xref="GI:670469395"
                     /db_xref="GeneID:6020641"
                     /translation="MTELNSWHNVDNYFTNKLLPENSCLNAALLANKAAGIPEIDVSP
                     TQGRFLYLLTKLKGAVNVLEIGTLGGYSSICLAQALSKEGKVVTLEINEDYASVARQN
                     IRHAGLEEKVEIIVGHALDTLPDLKKRGQFFDVIFIDADKPNNPEYLKWALKLANSGA
                     IIIADNVVRNGAVTDINSEDERVRGVQQFIDLLKLEPRIEATAIQTVGVKGYDGFVLA
                     IVD"
     gene            654635..655525
                     /locus_tag="BSPH_RS03135"
                     /old_locus_tag="Bsph_0636"
                     /db_xref="GeneID:6020642"
     CDS             654635..655525
                     /locus_tag="BSPH_RS03135"
                     /old_locus_tag="Bsph_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_031418047.1"
                     /db_xref="GI:670469397"
                     /db_xref="GeneID:6020642"
                     /translation="MNIHGLKLFYHVATTGSFTKAAELLCISQPAVSSQIKRFEHEIG
                     VQLFKQQGRGVVLTEFGKALAEKAQHFMALEQHIKSFVEDYRLAKAGDLHIVATYLPA
                     NFLIPKWAAAFKAMNEHVNLMITTTNTKDAFEQLIHYKADIAIYGGGISERPKEIWWE
                     EIYEDELWFVVSPHHRYAHQTITLIEMFQEPFIMREKGSSMREHLFSLCQTYQVEPPK
                     IALQFNGINETIRSVIAGYGANFISSLAVREYVESGQLARVIIKDIHPVKHKISICTR
                     KNEKQNLLVQNFIETIKRSL"
     gene            655599..655994
                     /locus_tag="BSPH_RS03140"
                     /old_locus_tag="Bsph_0637"
                     /db_xref="GeneID:6020643"
     CDS             655599..655994
                     /locus_tag="BSPH_RS03140"
                     /old_locus_tag="Bsph_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012292408.1"
                     /db_xref="GI:501249390"
                     /db_xref="GeneID:6020643"
                     /translation="MFIQIETQSEVPIYEQVTRQIIEGIARGDMKQGETLPSVRSLAA
                     DLGVNMHTVNKSYHELEAKGIIVIRAKSGAIIRSTEERALTPEQLRQIEKNLKPVVAE
                     GMVLGATVEQIEHMMKKVFADLHIPAEGV"
     gene            655998..657092
                     /locus_tag="BSPH_RS03145"
                     /old_locus_tag="Bsph_0638"
                     /db_xref="GeneID:6020644"
     CDS             655998..657092
                     /locus_tag="BSPH_RS03145"
                     /old_locus_tag="Bsph_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418049.1"
                     /db_xref="GI:670469399"
                     /db_xref="GeneID:6020644"
                     /translation="MLLGVFISIYIMTLVLQMIVPFIVRDTIVFGVTVPDQNIKHPAL
                     ANLKKRYAQIVGGTGIVFLIVMIISYNLFTSESVRGIFLLGCLWSMLTVSMGLYWVYH
                     QKISVLKRQEQWGVNIKQVRAVDLTARSRDEMLPWSFFAVPLVISGFLIIYTILHYDK
                     MPANIAVHWGPSGEADAWRNKTYLTAISLPLIMLMIQFMMWGIIDSIKRSAIKIAVNR
                     KEESLEDQLKTRKYISWQILLVSYAITVLLTVLQLSNIYPAMTVGYKLLPLFILFLAV
                     VLGSLLIYVVKKRKYRVRYEKNSDSQVMDVDEDRYWKGGLIYMNRQDPSVFVEKRFGV
                     GWTMNLANPRGYIVIGLPFLLLLLICIFSL"
     gene            657166..657837
                     /locus_tag="BSPH_RS03150"
                     /old_locus_tag="Bsph_0639"
                     /db_xref="GeneID:6025112"
     CDS             657166..657837
                     /locus_tag="BSPH_RS03150"
                     /old_locus_tag="Bsph_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme transporter CcmC"
                     /protein_id="WP_012292410.1"
                     /db_xref="GI:501249392"
                     /db_xref="GeneID:6025112"
                     /translation="MRILVVDDDVHILQLVNIYLTREGYQVLRAENAQQALALLNGNL
                     PDLAVVDVMMPGMDGFTLTETLTQDYDIPVLLLTAKGELEDKERGFLAGSDDYVVKPF
                     EPKELLFRIAAILRRMDKKNQITIQVGQLVIDRRSFEVIIGEETLILPLKEFELLALL
                     ASRPNQVFTRSYIMEQVWGYDYDGDEQTLNTHVKRVRERLNRFDTAVEIITVRGVGYK
                     LEATS"
     gene            657834..659207
                     /locus_tag="BSPH_RS03155"
                     /old_locus_tag="Bsph_0640"
                     /db_xref="GeneID:6025113"
     CDS             657834..659207
                     /locus_tag="BSPH_RS03155"
                     /old_locus_tag="Bsph_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_036160583.1"
                     /db_xref="GI:738204666"
                     /db_xref="GeneID:6025113"
                     /translation="MKTLYSKFVMTTLLVMIGSLCIGFLATNTYYHQVVKEKNDTKNV
                     IIAQGIAQYIETAKPEDLNSYFMTLGEIGYQIYVTTGEQGNFFGGEYRDKTLSESVVE
                     HVLNGEVYHGMRDFPKETFMTGFFANELVNTIGVPFTYENKSYALFIRPDIRLLFSEV
                     HTLLGGLMLAMIVLSLLAMLLFAKALIRPITKLTAATRQLAHEKFDTVLDIDRNDELG
                     QLATSFNIMTEKLQENDRVRKEFISNVSHDFQSPLLNIQGYVDLLKNPLLKERERQEY
                     AAIIELETKRLSTLTKQLLLLTSLDQSTRIVKRERYRLDEQLKESVRKYRWQMEEAQL
                     QITYKLEQVIFNGDAGLLQNVWDNLLTNAIKYNIQGGQIHLYLQQKPASLEILVEDKG
                     IGMTAAQLAKVYDRFYRADTSRTKQGTGLGLAIVKQIVELHGGTVHIESTVNAGTKVY
                     INLPILS"
     gene            659281..659685
                     /locus_tag="BSPH_RS03160"
                     /old_locus_tag="Bsph_0641"
                     /db_xref="GeneID:6025114"
     CDS             659281..659685
                     /locus_tag="BSPH_RS03160"
                     /old_locus_tag="Bsph_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292412.1"
                     /db_xref="GI:501249394"
                     /db_xref="GeneID:6025114"
                     /translation="MEQKWSIRLIRLAAIFALIGTYLGSHMSGSGSYEYRPIHAHILL
                     VGWLSMFAWGIFYRAFKVKSQKLVNIHGWTAILGVFGLTLGMWFYNINPFHFGSTFTL
                     VFFIVGGTTLLISFALFIVVTFMIKQQEDLKN"
     gene            complement(659738..661642)
                     /locus_tag="BSPH_RS03165"
                     /old_locus_tag="Bsph_0642"
                     /db_xref="GeneID:6025115"
     CDS             complement(659738..661642)
                     /locus_tag="BSPH_RS03165"
                     /old_locus_tag="Bsph_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="suppressor of lin-12 (Sel-1L)"
                     /protein_id="WP_036162537.1"
                     /db_xref="GI:738206624"
                     /db_xref="GeneID:6025115"
                     /translation="MHYGILEEQCHKLRQLSYAALAKNLQEASFFAISNPQVSLQKSL
                     LVVEEILYEVYQLEMHTTPKLKNVRMLLNNRSFTAHIHPRRISLLMNLVYKMTSHTSN
                     ELVEAKAAKIVLDYTSDIVEWFIKRYDRSFNSNVAEEKDLMLDNTLYQRDHSPDAYKH
                     AAEWFEIAAQNGDASAQYNLGALYNQGRGVKKDYALAKMWYERAADQNDPNAHYSLGV
                     LFHLGQGIEQNYTEAAHHYQIAADLGNADAQYNLGVLYNQGLGMSQNFLEAAKWYTLA
                     ADQGNTSAQNNLGFLYHNGTGVEQSYVEASTYFEMAALAGDASAQYNLGYMHLKGRGI
                     PQNFTEAAKWFHMAALQDHMNAEFQIAMLYNTGQGIPMDHLEALKWFKLAAHKGHLHA
                     QFYLGLLYEKEQDMVLAEKWLLLAAEKGHISAGFELGRLYVYQLHQPDKALPYLKAAA
                     EKGYVDAQYELGLLLTAGDGVPVNYPEAVQWWRAATDQSHIQAEYQLGLVYEQGLGVS
                     IDLEEARRCYRLAAIQGHAGAQYQLGNLFDKGKGVTQDYTEAAKWIEQAAAQEHIKAQ
                     YQLAQMHIHGQGVPKDFAKAAQLYRLAANQGHQKAQFQLGLLYKKGQGVAQDYQEATK
                     WLKKSLQDIQ"
     gene            661824..662537
                     /locus_tag="BSPH_RS03170"
                     /old_locus_tag="Bsph_0643"
                     /db_xref="GeneID:6025116"
     CDS             661824..662537
                     /locus_tag="BSPH_RS03170"
                     /old_locus_tag="Bsph_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate mannose synthase"
                     /protein_id="WP_012292414.1"
                     /db_xref="GI:501249396"
                     /db_xref="GeneID:6025116"
                     /translation="MKNIAAIIPAYNPQQSLITYVHQLLATTITQIIIVNDGSDQKYK
                     EIFEDLNNIEGCQVLQHRDNIGKGGALKTAFTYIREQKRIFHGVLTVGAHGQHTLQDV
                     KLVLTMTKVFSEGIVLGVRNFHSVDSTFLSYWGNRATSLFFELLYHRKLMDTQTGLRY
                     ISMNELPWLMKVEGERYDYDTNMLIAALKRKCPIFEVEIGQLRIKKNSIIQYDEVINA
                     RSIITRMLMNYLRPRNNNN"
     gene            662623..662883
                     /locus_tag="BSPH_RS03175"
                     /old_locus_tag="Bsph_0644"
                     /db_xref="GeneID:6021183"
     CDS             662623..662883
                     /locus_tag="BSPH_RS03175"
                     /old_locus_tag="Bsph_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004233098.1"
                     /db_xref="GI:490353325"
                     /db_xref="GeneID:6021183"
                     /translation="MEYSDQVKNRVKRMEGQLRGILKMMEEEKDCKAVITQLSAVRSA
                     VDRTVGVIVSTNLLECVQNAEGDGEKMNEAIQEAVNLVVKSR"
     gene            <663460..>663897
                     /locus_tag="BSPH_RS03180"
                     /db_xref="GeneID:23319660"
     CDS             <663460..>663897
                     /locus_tag="BSPH_RS03180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292415.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_041658980.1"
                     /db_xref="GI:753952089"
                     /db_xref="GeneID:23319660"
                     /translation="QEAAVQKKIGQVLKNIIKPSMTEFDKVKAINDYIVSNTSYGTKT
                     KASPHSAYALLFEGQAVCQGYALAAQAMLSQSGIETKYVVGFVNGNEAHAWNLVKVDG
                     KWYHLDTTWNDPLPNRIGAASYDYFLVTDEVLKKDHSWIQTDYP"
     gene            664423..665634
                     /locus_tag="BSPH_RS03185"
                     /old_locus_tag="Bsph_0646"
                     /db_xref="GeneID:6021185"
     CDS             664423..665634
                     /locus_tag="BSPH_RS03185"
                     /old_locus_tag="Bsph_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="WP_012292416.1"
                     /db_xref="GI:501249398"
                     /db_xref="GeneID:6021185"
                     /translation="MADWTNNDEIETMLLSTKDKIVDVTARLSDNASIETAIPIEDMH
                     DMEVAPTAQAIQKPETKLVVTNVKEMTDAMYAYYSSFSPKFEIQYKGNTQRIEQIVEE
                     AYNNAIERDDYVYGHISKHSIRFEYGRNQATIFGEQSYLMTPEQAAYVEMNVQEIIAK
                     ISNKSMSDVEKVRAVNDYIVANTAYTDQTNSSPHSAYTVLAEQGGVCQGYALLAHSML
                     QKLGIETKYIVGYVGQEGHAWNLVKLGGQWYHLDTTWNDPVPDRKGAIRYQYFLVDDR
                     TMAKDHSWIAEDYPKATSTLYSYYHDIDFPAQVDDQLYFSNISDDNKLYVLDMKTGKT
                     KRVTNSRVQYVVYADGWLYYSNYSRGAYLTKIRPDGSGEQPLNREETKDLFVKDGYLY
                     FTTNELKKMAL"
     gene            complement(665660..666607)
                     /locus_tag="BSPH_RS03190"
                     /old_locus_tag="Bsph_0647"
                     /db_xref="GeneID:6021186"
     CDS             complement(665660..666607)
                     /locus_tag="BSPH_RS03190"
                     /old_locus_tag="Bsph_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160585.1"
                     /db_xref="GI:738204668"
                     /db_xref="GeneID:6021186"
                     /translation="MMKWLLVIDGGATKTACAVVHAETGIMEYSASTKGSNYQAIGME
                     AATAILQELLAKVDTFLQKHAGSQIAVATFALAGIDSPKDKEMVTAIIQNALSATQLS
                     IANLIIENDAEATLLGVTAGQAGALLIAGTGAIAYAYDGQQMVRAGGWGHRAGDEGSG
                     FWLGQEVVRAIFKMEDGRGETTILKEAVFHSLGIQNVTELAEWLFHPSYTNAQLAKMG
                     SFVAQAVEQQDACAIHISRQAAQELAFLAKAVLKKVGYQNGLFPLYCNGGAIKHNPLI
                     LKTFTDILALTYPQVSISLCEQPPIAYLIERTKRASDCL"
     gene            complement(666604..668118)
                     /locus_tag="BSPH_RS03195"
                     /old_locus_tag="Bsph_0648"
                     /db_xref="GeneID:6021187"
     CDS             complement(666604..668118)
                     /locus_tag="BSPH_RS03195"
                     /old_locus_tag="Bsph_0648"
                     /EC_number="4.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_012292418.1"
                     /db_xref="GI:501249400"
                     /db_xref="GeneID:6021187"
                     /translation="MFEDFRNKTQQEDGMIFPSNIYRKIVLQPAYEEAKKNFLTIMLQ
                     INIAHLKMLEEQGLVKKEEAKQIGAALKKIDLNYYRLEDYSPQYEDLFFRIENKLIEL
                     AGDVAGNLHIGRSRNDMGIAIYRMTLRQKLLLLMRELLTLRDDLIAAAEEHVDTIMIG
                     YTHTQQAQPTTFAHYLKAVIDQLERDFERMQHVYKTVNRSSMGAAALTTTGFNINRER
                     MRDLLAFDDIIENAWDAVAGADYIAEAASIVQLAALNLGRTSQDFLLWATQEFNAFTL
                     ASPYVQISSIMPQKRNPVSIEHTRSLLSAVVGDASTVLQMVHNTPFGDIVDTEDDMQP
                     YLWRAIDRLVGIYKLFGSLVVTMDVNKKKLRNRAENSFANVTELADTLVRSEDISFRQ
                     AHSIVSKCIKVLLAHSEESLASLTWGLVNTQSKLITGKELNISEEDFYKTLQPESFVG
                     VRTLPGGPAPATMKAALEQAKMNTKNLYEWIQLKENSIIEAEKELTVFLEEWSQ"
     gene            complement(668146..669867)
                     /locus_tag="BSPH_RS03200"
                     /old_locus_tag="Bsph_0649"
                     /db_xref="GeneID:6023768"
     CDS             complement(668146..669867)
                     /locus_tag="BSPH_RS03200"
                     /old_locus_tag="Bsph_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_012292419.1"
                     /db_xref="GI:501249401"
                     /db_xref="GeneID:6023768"
                     /translation="MKKQTANASQESIRTRIFHSNWFIYVLISPLFLVLFAYVVYPFY
                     QTFTQSFAGDERFLHYKKFFNLASPANLEALWTSIYISIISVLCCAIVGVTMAFLLER
                     YNFPGRRILAILVLVPMALPPLVGVLSFSFLYGDSGIFPRIFQHLFGLDHVPFSLKGI
                     WGVIVVHTFTMYTYFYLTASAAIKGLDPALEEAATSLGAGRIRVWTKVILPMLTPSIV
                     ASSLLVFMISMASYTAPLMFGVERTMTMQIYLSRTNGNLEMAATQSMILSFVSITFLI
                     IMRWYQNRRNYQNLSKGISVHRSEVSSKKIKIAATIASFIGTLILILPILVLILISFS
                     VDGAWKTQILPTDYTMDHYMALFTDERTWRPIWNSIQMGIVATFGNIIFGVAAAYAMV
                     RLNFKGKTLLDMLIMVPWALPGTVVAVNLIAAFSTENIFAFNQVLIGTFWILPLAYFI
                     RHLPLVFRSTSASLVQLDPSIEEASRGLGANWWYTFRRIVVPLTFTGILAGTLLALVQ
                     SFGEFVASILIYSTSTIPLSVAIFQKLYAFKFGTACAYGVLQICLILVVLIISEKLSK
                     GSAGTAI"
     gene            complement(669880..670950)
                     /locus_tag="BSPH_RS03205"
                     /old_locus_tag="Bsph_0650"
                     /db_xref="GeneID:6023769"
     CDS             complement(669880..670950)
                     /locus_tag="BSPH_RS03205"
                     /old_locus_tag="Bsph_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_036160587.1"
                     /db_xref="GI:738204670"
                     /db_xref="GeneID:6023769"
                     /translation="MKRVTIENVSKQFGQLYGVKDVDLEIKAGEFFTFLGPSGCGKTT
                     TLRMIAGFYYPTKGKILFDEQDVTRLQPNKRNIGMVFQNYALFPHMTVDENIAFGLQV
                     RKFSKAEIQHKVDRIRGQVKLSNYGNRKINELSGGQQQRVALARALVIEPDILLLDEP
                     LSNLDAKLREETRIEIKRIQSELGVTTIYVTHDQMEAMAMSDRIMVMENGYIKQIGTP
                     QEIYHRPVDRFVANFIGETNLIEGTIEAMEDEELQVKTANGHIFTGRKQQSSPALTHM
                     IGDKVFISIRPESIHLGTGDNTLTGKITFVEFTGISVNYIVDCNAFSLKVMLINSYDQ
                     IKKIGEDITITISHDSLYFLGE"
     gene            complement(671046..672152)
                     /locus_tag="BSPH_RS03210"
                     /old_locus_tag="Bsph_0651"
                     /db_xref="GeneID:6023770"
     CDS             complement(671046..672152)
                     /locus_tag="BSPH_RS03210"
                     /old_locus_tag="Bsph_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_012292421.1"
                     /db_xref="GI:501249403"
                     /db_xref="GeneID:6023770"
                     /translation="MKKTHILSFFLVFILFALAACSGNDDQKTTNDAANNDKTTDGDK
                     TEVAATTPSGKLVIYTGRDEEMVQNVIDQFNKKYPDIEVEFLTMGAQQILERLRGEKA
                     NPQADFWWGGTQSALIVGANEDLLHAWQPSFIDSLDATHKDVEGRWFGEMLLPEVIMI
                     NSDLLTKEDGPQDWDDLLDSKWKDQILIRGVLASGTMRTIYSSMIVRQDAHSPDKGYE
                     WLLKLDANTKEYTQDPNALYLKLTRQEGSVSLWNLQDILLKKYTTDYPFDYIYPKSGA
                     PILVDGVAVVNHAKNLENAKLFVEFLFEKEMVTQLANDYYQIPTRSDIDKASMPEWYQ
                     ELDLKTFDIDWQQMSDKETEWMEYWDNNIKGRGK"
     gene            complement(672352..673269)
                     /locus_tag="BSPH_RS03215"
                     /old_locus_tag="Bsph_0652"
                     /db_xref="GeneID:6023771"
     CDS             complement(672352..673269)
                     /locus_tag="BSPH_RS03215"
                     /old_locus_tag="Bsph_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_036160588.1"
                     /db_xref="GI:738204671"
                     /db_xref="GeneID:6023771"
                     /translation="MKKTNLIYPLLIVIASSSYGILSTIVKVAMQHGFTSAEAVSSQY
                     IIGFILVLVMFMLTDRKLPKPSKKGIFILLFAGIFTGTTGIVYGESLKYLPASLAVVM
                     LFQFTWIGLLIDCALHKRLPSRPEVISIIILFVGTILAAGVLNVDLSGIPLQGWLFGF
                     AAAVTFACFIQFNSRPVEGVTTTSRVLIVSFVALMMISIFLSPEVIWNGKLFMEGLWK
                     FGLALGLFGIILPIYLFSIAIPKIGGALASILSAIELPVAVTVSVIVLHEPLTALQIM
                     GIVLVIVGMLLPTIIAQRRQNDSLLDVQT"
     gene            complement(673285..673848)
                     /locus_tag="BSPH_RS03220"
                     /old_locus_tag="Bsph_0653"
                     /db_xref="GeneID:6023772"
     CDS             complement(673285..673848)
                     /locus_tag="BSPH_RS03220"
                     /old_locus_tag="Bsph_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_012292423.1"
                     /db_xref="GI:501249405"
                     /db_xref="GeneID:6023772"
                     /translation="MSITIRQAQPQDAHAVVPLIIDAIGDIANRLTGEQSTEAVHQEL
                     TTLFQRDDNRHSYLNTYVATEDGQILGILVYYYGSHAIVMDANLVKWLEAKNAPSIIV
                     DQEAHEDEAYIDTVCVTPEARGKGIGTLLLQYAEELTKQRGYTKLSLNVEIQKEDARR
                     LYERLGFVITEPWSIIDEPFHHMVKQF"
     gene            673994..674941
                     /locus_tag="BSPH_RS03225"
                     /old_locus_tag="Bsph_0654"
                     /db_xref="GeneID:6023985"
     CDS             673994..674941
                     /locus_tag="BSPH_RS03225"
                     /old_locus_tag="Bsph_0654"
                     /EC_number="2.7.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="WP_012292424.1"
                     /db_xref="GI:501249406"
                     /db_xref="GeneID:6023985"
                     /translation="MTKQDKDFILVYGDAFIDYIADDVTNTSFTKYMGGATVNVAAGI
                     SRIGAPSALITITGDDEGSQFVRDGLVEEGVKLDYAIFDPAKRVSGVYVHLTEACERI
                     FKDYVDETPDLQVEPLQLNEAAFKHASALTVCSGTMFHPTALATTRAAVEMAKDKGAI
                     IAMDANIRPLRWSSEEICRETITSFFEDVDILKVTDDELFFLTETTSLEEGIEQLSSY
                     LVPIILVTVGENGTYAVLNGEVIHVPTEKVIPVDTTGAGDAFMAGVLRDVHYNGLPTT
                     KEELVRCTSFGNKLGAFAATKAGALTALPYYEDIKHLLK"
     gene            674962..675393
                     /locus_tag="BSPH_RS03230"
                     /old_locus_tag="Bsph_0655"
                     /db_xref="GeneID:6023986"
     CDS             674962..675393
                     /locus_tag="BSPH_RS03230"
                     /old_locus_tag="Bsph_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292425.1"
                     /db_xref="GI:501249407"
                     /db_xref="GeneID:6023986"
                     /translation="MEKNYDVLVKDQIFFGGAKDAETAFEQEAVDVVIDVRVQGLTSE
                     EQGAISYSYKHMPIADEEIAVASSIQHVAKEIASSYEAGQKVYVHCGSGGGRAGVAAT
                     AALIELGLANSLEEAEAAVKKARPQVTIRPKMEEALQKLYK"
     gene            675609..675809
                     /locus_tag="BSPH_RS03235"
                     /old_locus_tag="Bsph_0656"
                     /db_xref="GeneID:6023987"
     CDS             675609..675809
                     /locus_tag="BSPH_RS03235"
                     /old_locus_tag="Bsph_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Negative regulatory protein YxlE"
                     /protein_id="WP_036162539.1"
                     /db_xref="GI:738206626"
                     /db_xref="GeneID:6023987"
                     /translation="MEELAKVPWAVIAPLIVVQLILMIVALIDLRKTHATNGPKILWV
                     FIILFTNIIGSIAYFIVGRKQA"
     gene            675806..676690
                     /locus_tag="BSPH_RS03240"
                     /old_locus_tag="Bsph_0657"
                     /db_xref="GeneID:6023988"
     CDS             675806..676690
                     /locus_tag="BSPH_RS03240"
                     /old_locus_tag="Bsph_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012292427.1"
                     /db_xref="GI:501249409"
                     /db_xref="GeneID:6023988"
                     /translation="MTTLLQVTGLTKRFAEHNVVDDVQFMLEEKTSTALIGPNGAGKT
                     TTLSMLTGLLTPTAGSVKMLNGDLRENIGFLPQYPQFHPWLSALEFTEMAARLNGVSA
                     KNAKLEAQKTLEFVGLGNAQHKKIDTFSGGMRQRLGISQAIVHKPKLLLLDEPVSALD
                     PVGRREVLDLLKGLQQETTILYSTHILNDAEEMTDQLLFLQNGKLVEQGTLREVRQRF
                     DEQNYIVEFSSEEEAKLFASSTDHVVGCYVYIEILNEEPTMRELLHRLSNCPYTIRKV
                     ERQTASLEEIFMKVAKKA"
     gene            676687..677469
                     /locus_tag="BSPH_RS03245"
                     /old_locus_tag="Bsph_0658"
                     /db_xref="GeneID:6023989"
     CDS             676687..677469
                     /locus_tag="BSPH_RS03245"
                     /old_locus_tag="Bsph_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012292428.1"
                     /db_xref="GI:501249410"
                     /db_xref="GeneID:6023989"
                     /translation="MRGFNVLLQKEFREAWRSWKFLWIPLVFALLGMNDPLINYYIMD
                     ILNAVGNVPEGFEMLMPELMPVDLLQASIGQFQTIGLLVIMASFVGIISKERASGMAT
                     LLYVRPISFGAYFMSKFIVMSAVCFVSILAGFAASVYYTSILYGTLEIGPLLASFCTY
                     YVWLIFVIAVTLMMSASFKTIIATTCAFTVIFGGQIVDMVVGLFWTISPWKLANYGPL
                     LVRGTMEMSDYWWSLIMTLALIILCICLGIIMMKKNAAMTKI"
     gene            complement(677675..678121)
                     /locus_tag="BSPH_RS03250"
                     /old_locus_tag="Bsph_0659"
                     /db_xref="GeneID:6023384"
     CDS             complement(677675..678121)
                     /locus_tag="BSPH_RS03250"
                     /old_locus_tag="Bsph_0659"
                     /EC_number="2.3.1.57"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine acetyltransferase"
                     /protein_id="WP_012292429.1"
                     /db_xref="GI:501249411"
                     /db_xref="GeneID:6023384"
                     /translation="MKEICLKPIDKSNWEEAIRLSVKEEQQAFIASNLYSIAEVQFLD
                     NFFAKGIYLNNKMIGFTMFGIDPDDNNYWIYRLMIDEEFQGKGIGKQAIYLVIEEIRK
                     NNHANIPFIMIGYDPKNLTAKFAYKRAGFIETELSSWGEQLAKYSL"
     gene            678696..679400
                     /locus_tag="BSPH_RS03255"
                     /old_locus_tag="Bsph_0661"
                     /db_xref="GeneID:6023386"
     CDS             678696..679400
                     /locus_tag="BSPH_RS03255"
                     /old_locus_tag="Bsph_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292431.1"
                     /db_xref="GI:501249413"
                     /db_xref="GeneID:6023386"
                     /translation="METENSDRFLTAFNRIDHRLRDIVGIKDFTPFYRLIDQAKKKEV
                     LVKKYEDDLRSYADLRNAIVHHRTSINYVIAEPHTDVVERIEYIDATLAKPTLVGQMF
                     RKRVLVFQENDSLKHVLKVIHQRKYTQFPVYFNKQFRGLITTVGITNWLASKMGGDYL
                     PKGIPTLHDILMHEKNRVNYKFVSRYITIYQAEEIFKQGVERGRRFEALLITEHGKPH
                     QKLIGIITPLDIVKID"
     gene            complement(679418..680137)
                     /locus_tag="BSPH_RS03260"
                     /old_locus_tag="Bsph_0662"
                     /db_xref="GeneID:6023387"
     CDS             complement(679418..680137)
                     /locus_tag="BSPH_RS03260"
                     /old_locus_tag="Bsph_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292432.1"
                     /db_xref="GI:501249414"
                     /db_xref="GeneID:6023387"
                     /translation="MESFIHANFWEMILRTTLSFFILLILARILGKKQLGQLTFFHYI
                     TGITFGSIAAEIASQEETPFLDGIISLVWWSALTYLMTIITIKSKKARVLIDDKPTIV
                     VQNGLILESALRKNRLHMDELTMMLREQAIFSVQDIHYALLETNGKLSVLQKTSEQVA
                     TKQDVKADVTPPTYLPTEVISDGQLIKENIVELELTEDWVMKKLKKQNVHSVEDVFFA
                     QVQTNGSLYISLKDKARHSSP"
     gene            680244..681449
                     /locus_tag="BSPH_RS03265"
                     /old_locus_tag="Bsph_0663"
                     /db_xref="GeneID:6023388"
     CDS             680244..681449
                     /locus_tag="BSPH_RS03265"
                     /old_locus_tag="Bsph_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fosmidomycin resistance protein"
                     /protein_id="WP_012292433.1"
                     /db_xref="GI:501249415"
                     /db_xref="GeneID:6023388"
                     /translation="MNNQINVANPIYPIMILIGVAHLINDTMQAVIPAMFPIFKSELG
                     LTFTQIGLISFVLNIFASALQPIVGFVSDKKPMPYALPIGMVSSFIAITIIAFTTQYW
                     IILIAVLFLGFGSAIFHPEGSRVSFMAAGSKRGLAQSIYQVGGNSGQALAPLISAYIF
                     DIFGQRGAAIVLVAATFGIILLTKIARWYKKQLEQERAAKKKRVLVSTLPPLTKKQVG
                     VALTLLFTIIFARSFYTTNITSFYVFYLMDHYDVNLRLGQILIFLFMAFGVVGTFFGG
                     SLSDRIGRKNVIILSVVVPMPFCLALPYVPLWAAMIFLVIIGTLIMISFSVTVVYAQE
                     LVPSKIGTMAGLTTGFAFGMGAIGAMVIGVLMDHKGIDFTMMVVSLLPLLLLIAFFLP
                     KDKPASSAA"
     gene            complement(681661..682347)
                     /locus_tag="BSPH_RS03270"
                     /old_locus_tag="Bsph_0664"
                     /db_xref="GeneID:6024153"
     CDS             complement(681661..682347)
                     /locus_tag="BSPH_RS03270"
                     /old_locus_tag="Bsph_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmosensitive K+ channel histidine kinase"
                     /protein_id="WP_012292434.1"
                     /db_xref="GI:501249416"
                     /db_xref="GeneID:6024153"
                     /translation="MRHVKGRLDESILVCVYYGLNGERLIRRGHKMATMLDCPLYILS
                     VDSQPLDAFDAEKSSYIEQWEKLSDELEVEKFILQDNEKRPIQKVIAEVAKNYGISQI
                     IVGQSAQSRWEEITKGSFLNVLLKEVPFVDFHIVAVQRPTDDDANETYEKGVRAYLIK
                     EQENFKVAFTCPKYVSIEGIFFKEIGTDFDNGVFKFTYNDKMHEVHISEGYVIDQEKL
                     PAEFLSPLRQ"
     gene            682870..685308
                     /locus_tag="BSPH_RS03275"
                     /old_locus_tag="Bsph_0665"
                     /db_xref="GeneID:6024154"
     CDS             682870..685308
                     /locus_tag="BSPH_RS03275"
                     /old_locus_tag="Bsph_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_036160589.1"
                     /db_xref="GI:738204672"
                     /db_xref="GeneID:6024154"
                     /translation="MILIVGGFHLVTVLIAILLPFVCAALIPLLYRRLRHITHLGWFV
                     FSVPFILFLLLTRYIPQIAGGKTFIHTYEWIPSFNINITTYLDGLSMIFGLLITGVGS
                     LVILYSIFYLSTKESLHHFYCYLLLFMGAMLGVVFSDNLMVLYTFWELTSVSSFLLIA
                     FWHHRKASRAGAKKAMMITVFGGLSMLAGFLMLYVAADTFSIRDIVAHVGVIRDHALF
                     TPALILILLGAFTKSAQFPFHIWLPDAMEAPTPVSAYLHSATMVKAGIYLVARFSPVF
                     GGEAIWFWLVSVIGLVTLFWGSFNAVRQTDLKALLAFSTVSQLGLIMSLFGLGSVGHY
                     YGYTKDSIVYTQASFAALFHLINHSTFKGALFMMVGIVDHEVGTRDIRRLGGLMSLMP
                     ITFTIAVIGSFSMAGLPPFNGFLSKEMFFAAVLAIRDVEAFSIADLGLFFPLVAWVAS
                     IFTFVYSLILISRTFLGKLQPEKMDRKPHEAPLGMLLSPIVLCLLVVGIFFFPNVLGH
                     YILEPAMASIYPTFPTTYELTPHISAWHGINAELLMTLGVIVLGFILFKTLKSWKPVY
                     RIFSQKYTFNTYYNRMIEISESGSEKLTRKYMTGNLTHYFVYIYVFFVALIAGYFIWS
                     DAMTFNFDMDSTIESYELILVFVMVFAAVWMIFAKGRVTAMLLNGVLGYSIAFFFVIF
                     RAPDLALTQLVVESVTTALFLLCFKYLPDLMPEAPRKRVQWSKAMISIFVGATVTMVG
                     LAVVHYEQFEPVSSYFNDAYELAGGSNIVNTILGDFRAFDTMLEVVVLLIAGLGVYTL
                     TKLKPRKEEADYEN"
     gene            685298..685720
                     /locus_tag="BSPH_RS03280"
                     /old_locus_tag="Bsph_0666"
                     /db_xref="GeneID:6024155"
     CDS             685298..685720
                     /locus_tag="BSPH_RS03280"
                     /old_locus_tag="Bsph_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016992399.1"
                     /note="subunit B of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; in the case of S. meliloti it was proved to be
                     involved specifically with K+ transport; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292436.1"
                     /db_xref="GI:501249418"
                     /db_xref="GeneID:6024155"
                     /translation="MKINDVILRTVTKAVVFIILTLGVYLFFAGHHAPGGGFIGGLVL
                     ASGIVLLYLAYDIETVHKGMPFDFKKVAALGVLLATSTAIGSLFFDVPFLTQAYTYIN
                     VPIFGKMGFSTVTIFEAGVALTVVGVVVTIILSISEDE"
     gene            685724..686062
                     /locus_tag="BSPH_RS03285"
                     /old_locus_tag="Bsph_0667"
                     /db_xref="GeneID:6024156"
     CDS             685724..686062
                     /locus_tag="BSPH_RS03285"
                     /old_locus_tag="Bsph_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292437.1"
                     /note="subunit C of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292437.1"
                     /db_xref="GI:501249419"
                     /db_xref="GeneID:6024156"
                     /translation="MESLILVLVGILVAVATYLILSKQLLRVILGTAVLSHAAHLLIL
                     TMGGLKKGDVPLLGESEGPYTDALPQALILTAIVISFAVTAFVLVLGYRAYKTNGSGN
                     LDELRGTPDE"
     gene            686055..687560
                     /locus_tag="BSPH_RS03290"
                     /old_locus_tag="Bsph_0668"
                     /db_xref="GeneID:6024157"
     CDS             686055..687560
                     /locus_tag="BSPH_RS03290"
                     /old_locus_tag="Bsph_0668"
                     /EC_number="1.6.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292438.1"
                     /note="subunit D of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; contains an oxidoreductase domain; catalyzes the
                     transfer of electrons from NADH to ubiquinone; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monovalent cation/H+ antiporter subunit D"
                     /protein_id="WP_036160591.1"
                     /db_xref="GI:738204674"
                     /db_xref="GeneID:6024157"
                     /translation="MSNMIVLPLIVPVITAILLVFLKEHVFLQRIISLLTLSFIVIIS
                     VILLVEIQEQGIMRIDFSGWAPPFGISFVADSFATLLVLVANLVAVICMLYAIFTMEL
                     RYEKMYFYPFTLLMVAGVNGSFLTGDIFNLFVCFEVMLLASYALISLGGEKIQLREAL
                     KYVLINIVASWIFLVALAFLYGTVGTLNMAHISVRVMEAGANPLITTVALIFLIVFSL
                     KAGLLLFFWLPGSYSVPPTAIAALFAALLTKVGIYALVRTFTLLFPNNTEVTHMALGI
                     MAGITIVAGCIGALSGRDVRTIASYNVLIGVGFIVAGLAMGTESALQGIVYYLMHDMV
                     AKAMLFIAVGMMIYVTGETVIDKMSGLIRNYPFFGWLFFLAMCSLAGIPPLSGFLGKV
                     LIGQGAIEGGNFVLLGLGFFSSLIVLYSLLRIFLSSFFGETIISLEDEKPLPKRVILP
                     LTLLAACTISLGIGAEKLAPFVTDAAETLYTPSIYIDAVLDGEQWQGEVNK"
     gene            687560..688042
                     /locus_tag="BSPH_RS03295"
                     /old_locus_tag="Bsph_0669"
                     /db_xref="GeneID:6024830"
     CDS             687560..688042
                     /locus_tag="BSPH_RS03295"
                     /old_locus_tag="Bsph_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292439.1"
                     /note="subunit E of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_012292439.1"
                     /db_xref="GI:501249421"
                     /db_xref="GeneID:6024830"
                     /translation="MAMQFILNLFIAALWLLLQDEVTPQFSTFLMGFIVGMGILYAMH
                     RFYGTQFYLRRVFSIIKLLWLFNWELFLSSYSVLKQITTPKLNITPGIFTYKTALKGD
                     WEITALALLLTLTPGSVVMEVSEEGDVFYIHAMDIEQSKDAVIRSIGKFEQAIMEVTR
                     "
     gene            688042..688326
                     /locus_tag="BSPH_RS03300"
                     /db_xref="GeneID:23319661"
     CDS             688042..688326
                     /locus_tag="BSPH_RS03300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233151.1"
                     /note="subunit F of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monovalent cation/H+ antiporter subunit F"
                     /protein_id="WP_025116881.1"
                     /db_xref="GI:640692561"
                     /db_xref="GeneID:23319661"
                     /translation="MIENILLLALAFFSISIALSLYRVIRGPSMPDRAIALDTIGVNL
                     LSAIAIVSIILKTKAYLEAILILGILAFIGTIAFTKYIERGVIVERKSND"
     gene            688304..688669
                     /locus_tag="BSPH_RS03305"
                     /old_locus_tag="Bsph_0671"
                     /db_xref="GeneID:6024832"
     CDS             688304..688669
                     /locus_tag="BSPH_RS03305"
                     /old_locus_tag="Bsph_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_036160595.1"
                     /db_xref="GI:738204678"
                     /db_xref="GeneID:6024832"
                     /translation="MNVNQMIEWAAVILILIGSVVSVISAFGMIRLPDVYTRSHAATK
                     SSTLSVLTCLLGTFIYFWVHDGYVSVRLILGILFVFVTAPVAGHLICRAAYRSHVPLA
                     EGSGEDELKDKLFTEKNKH"
     gene            688967..689758
                     /locus_tag="BSPH_RS03310"
                     /old_locus_tag="Bsph_0672"
                     /db_xref="GeneID:6024833"
     CDS             688967..689758
                     /locus_tag="BSPH_RS03310"
                     /old_locus_tag="Bsph_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012292442.1"
                     /db_xref="GI:501249424"
                     /db_xref="GeneID:6024833"
                     /translation="MKNKLFMMILVLAIGVLAACGAKEDDANNSNADSSTDKQVLKVG
                     TSADYAPFEYVDAAKGEEIIGFDIDLIKLVGEKIGVDMQVQDMDFNSLVPALQAGKID
                     VVISGMTPNPEREKVVDFSDQYNETEQVIIVKKDSGIKKEADLAGKKVGVQTASIQEN
                     LGNEIAKKVDVSVEGRTRIPEIIQDMMSKRLDAGILEGGVAKGYLKTNDQLAAFPVEE
                     QPEDFKAIAVPKGSNLKEKINKALKELAEEGKIQELEEKWLEKVE"
     gene            689879..690538
                     /locus_tag="BSPH_RS03315"
                     /old_locus_tag="Bsph_0673"
                     /db_xref="GeneID:6024834"
     CDS             689879..690538
                     /locus_tag="BSPH_RS03315"
                     /old_locus_tag="Bsph_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter permease"
                     /protein_id="WP_031418079.1"
                     /db_xref="GI:670469430"
                     /db_xref="GeneID:6024834"
                     /translation="MNLDFTAIVPSIPYILKGIGVTLQIAIGASIIGFIVGILLALCK
                     IGKVKVLRWFADFYTSIFRGTPLVLQLLIIYYAVPQLLDIQIEPIPTAIIAFGLNSGA
                     YISEIIRAGINAVDKGQMEAAQALGIPYAKMMKDIIIPQAVKNILPSLVNEFITLNKE
                     TAVVTVISALDIMRRAYIVGGSTYRYLEPLLFAGIIYYLMTLVLTFLGKRIEKGMRKS
                     D"
     gene            690531..691253
                     /locus_tag="BSPH_RS03320"
                     /old_locus_tag="Bsph_0674"
                     /db_xref="GeneID:6023936"
     CDS             690531..691253
                     /locus_tag="BSPH_RS03320"
                     /old_locus_tag="Bsph_0674"
                     /EC_number="3.6.3.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_012292444.1"
                     /db_xref="GI:501249426"
                     /db_xref="GeneID:6023936"
                     /translation="MIKIEDLHKSYGQNEVLKGISTEVKEKEVIAIIGPSGSGKSTFL
                     RCLNLLEIPTSGKVTIAGDVLTDKGTNIMKIREEVGMVFQHFHLFPHKTVLENLTYAP
                     INVKGMDKVVAIQNAEELLKKVGLFEKRQEYPNRLSGGQKQRVAIARALAMDPKVILF
                     DEPTSALDPEMVKEVLAVMKNLADSGMTMLIVTHEMGFAREVADRILFLDGGKLIEDA
                     PPEQFFTAPSTQRAKDFLEKVL"
     gene            691576..692391
                     /locus_tag="BSPH_RS03325"
                     /old_locus_tag="Bsph_0675"
                     /db_xref="GeneID:6023937"
     CDS             691576..692391
                     /locus_tag="BSPH_RS03325"
                     /old_locus_tag="Bsph_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_031418081.1"
                     /db_xref="GI:670469432"
                     /db_xref="GeneID:6023937"
                     /translation="MKKLLYGVFFVVFIVIFLYVNNHWLVVSKHVFESEKVPASFDGL
                     RIVQVSDLHDALFGNNQEKLIAKVKETNPDYIFITGDVIDSNRYDLNQSLQAVKGLVD
                     ITDVYYVLGNHEVATNKVSEIYEALSSLGVHILANESTVLERDGERLAIVGIEDPLMG
                     RSTEDMLELATAYLPDDMFKMLLAHRPEVFNTYVNDGIDLVFSGHAHGGQVRIPGLGG
                     LVAPGQGLFPKYTAGVYDEGITKMVVSRGLGNSSVPYRIFNLPEIVVMDLKKK"
     gene            complement(692413..693258)
                     /locus_tag="BSPH_RS03330"
                     /old_locus_tag="Bsph_0676"
                     /db_xref="GeneID:6023938"
     CDS             complement(692413..693258)
                     /locus_tag="BSPH_RS03330"
                     /old_locus_tag="Bsph_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase TatCD"
                     /protein_id="WP_012292446.1"
                     /db_xref="GI:501249428"
                     /db_xref="GeneID:6023938"
                     /translation="MDPYEDGKRKFLSPLDKPQAEPPLPMEALVEIQAVKMEDQQVAE
                     EPIIPVTSLLEHLSDLRKQIIKGLTVFILFFIVVFSTINIWFPFVTRGHSLIILGPLE
                     VVKFYMTISTTLSFGLAMPFLVHFLWSFVKPGLKETESRFLGLYAPVMLALFLLGIAF
                     GYFVVNPLSYSFLVGIGATNFDVMVSASEYMHFLIMTTVPLGLLFELPIVALFLSAIG
                     VLSAESMRKIRGWSYIVMGICSAVITPPDFISQLLVLIPMIILYEISIYLVKRLERKQ
                     IESTA"
     gene            complement(693270..693473)
                     /locus_tag="BSPH_RS03335"
                     /old_locus_tag="Bsph_0677"
                     /db_xref="GeneID:6023939"
     CDS             complement(693270..693473)
                     /locus_tag="BSPH_RS03335"
                     /old_locus_tag="Bsph_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292447.1"
                     /db_xref="GI:501249429"
                     /db_xref="GeneID:6023939"
                     /translation="MGGLGAIGVPGLVIILVIVLIVFGPRKLPEIGGAVGKTFAEFKK
                     STKGLMEDDDDSVKKVEKKSDVS"
     gene            complement(693516..695228)
                     /locus_tag="BSPH_RS03340"
                     /old_locus_tag="Bsph_0678"
                     /db_xref="GeneID:6023940"
     CDS             complement(693516..695228)
                     /locus_tag="BSPH_RS03340"
                     /old_locus_tag="Bsph_0678"
                     /EC_number="1.1.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="WP_012292448.1"
                     /db_xref="GI:501249430"
                     /db_xref="GeneID:6023940"
                     /translation="MAKTLPSVDVVTVGVGWTGGIVAAECAKAGLKVVGLERGQKRGT
                     EDYLNVHDEYRYAIRYDLMQNLSKETVTFRNDRNMKALPMRQLGSFLLGEGLGGSGTH
                     WNGMTFRFLPYDFQIKTLTDKHYGPNKLGPEYLIQDWGLTYDQLEPYMDKFEKTAGIS
                     GDDKNTFSGKRSNPYPTGPMKKTPMLMQFEKAAQDLKLTPYMVPSANVSEVYKNPDGE
                     TINACQYCGFCERFGCEYGAKSSAEITVVPTALKTGNFDLRYNSNVVEILKQGNKVTG
                     VRYIDTVSGEEFIQPTNAVVLTSYVFNNAKLLMVSDIGERYDPTTGKGTLGRNYCYQI
                     LPGAVGFFDEQYNTFMGAGSLGMCVDDYNGDNFDHSDLDFIHGGNIALTQTGTRPIGS
                     NPTPPDTPTWGPEFKKQSIHYYTRSFGIGAQGASMPHKQNYLTLDPTYKDAYGLPLMQ
                     LTYNFTDQDRALHKFISARAADIMKQMGAKTIVPNAEITDYNIVPYQTTHNTGGTVMS
                     LTPEQGVVNNYLQHWDVDNLFAVSAGNFAHNSGYNPTGTLGALAYRCAEGVIKYSQSG
                     GSLV"
     gene            complement(695241..695990)
                     /locus_tag="BSPH_RS03345"
                     /old_locus_tag="Bsph_0679"
                     /db_xref="GeneID:6023852"
     CDS             complement(695241..695990)
                     /locus_tag="BSPH_RS03345"
                     /old_locus_tag="Bsph_0679"
                     /EC_number="1.1.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_012292449.1"
                     /db_xref="GI:501249431"
                     /db_xref="GeneID:6023852"
                     /translation="MSSDKNNVSRRDFLKTTGIAAGTLVGGGLIGGLVGYNINGKGTS
                     TLEHGGHGTTNEALGSPKAKMFFRNERDFSILSKATERIFPEDDLGPGAIGLDVPYFI
                     DHQLAGNYGSNSKEYMQGPFDVGTPTQGYQSRLTRAEIFRQGIQKMEDEAQKRYKKSF
                     NDLDGEQIDEILTAFQKGEVEMVGVQSAFFFTLLRAATLEGAYSDPMYGGNRNMEGWR
                     MKNFPGHQMAYISQIEDSKFQKIEPKSLGNH"
     gene            696318..698315
                     /locus_tag="BSPH_RS03350"
                     /old_locus_tag="Bsph_0680"
                     /db_xref="GeneID:6023853"
     CDS             696318..698315
                     /locus_tag="BSPH_RS03350"
                     /old_locus_tag="Bsph_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292450.1"
                     /db_xref="GI:501249432"
                     /db_xref="GeneID:6023853"
                     /translation="MWIKGIGGKLVVAIIALVFVTCGTLGLSTWINSTKAMNEQVETN
                     LVSRAGDVSQYIEEHFQLTLVEVEAIAEQEAVRSMDFEKQKQYLSKRLADNKNYLGFG
                     IIKADGVAHYLDDTTADLGDRDYVKEGFTGNSVMSEITISRVTGEPVILIVSPIDTVS
                     GEKALLLARIDGYYLSNIVEDIKVGNSGYAFMLDANGTIIGHNNHSYVKEQNNPIKEA
                     EETGVMTGRALAAKEMIANKSGYFSFETEDAGTNLMGYHTLDNGWKMGVVALENEMFS
                     GLSKLKTNFIVTTIIVSLLGLIISFAISRSVSRPLRHVLRISEGLSEGDFTQEIPEKY
                     LKRIDEMGTMSRALDRMTDNMREMIAKVSHEATTVNEASCDLMGDVMAVTKHSEQIAG
                     AINEVDRGAQSQTVMAEESASAMEQMALGIQNVAEVASTIASNTDFISQKISESNHAV
                     QQSICRMNEIQEGTTAELMIIHKLEKESEEINLISNMITAISEQTNLLALNASIEAAR
                     AGDAGKGFAVVAEEVRKLSEQTAESATKINVLIERVQSYTLEVVKAAESGEDNVERGL
                     ASIEAVGERFEEIVRAVGEIAGQVEEMNASAEQMSANTEEVSASMEEMAATAHAASDY
                     VHEVTDATTEQLKTVTTMNNQTEKLSEMAKRLYEAIQKFKY"
     gene            complement(698363..699541)
                     /locus_tag="BSPH_RS03355"
                     /old_locus_tag="Bsph_0681"
                     /db_xref="GeneID:6023854"
     CDS             complement(698363..699541)
                     /locus_tag="BSPH_RS03355"
                     /old_locus_tag="Bsph_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="WP_036160598.1"
                     /db_xref="GI:738204681"
                     /db_xref="GeneID:6023854"
                     /translation="MKNLLYYQDVMLREFDAHIVSKEIDELGRHYVVLSNTAFYPTGG
                     GQPHDTGTLNGIDVIDVEKNGEEIRHYMQGDISELKGIVHGTLNWSRRFDHMQQHAGQ
                     HILTAAFVELFDAQTVSFHLGSQHVTIDIAVDTLTEQQLAAAEARANEVILENLPIET
                     TWITENELVHYHLRKEVAVAGDIRLVIIPNYDYNGCGGTHPTSTGQVNAIKILGTEKM
                     KGNVRVSFVCGQRVLHELAMRKKVLGDVARQLSVPEVEAATALTKILSAQKHTERALV
                     AAKEELLTYEAKALVSNSGNLMTAAFQQRTMQELQKLARTIVSEHDDMITLLVSESEG
                     KLQFVAARGKNVSKSMKAIAEKALPLINGKGGGSDQMVQGGGECIISKEELLEAIQNI
                     "
     gene            699698..699985
                     /locus_tag="BSPH_RS03360"
                     /old_locus_tag="Bsph_0682"
                     /db_xref="GeneID:6023855"
     CDS             699698..699985
                     /locus_tag="BSPH_RS03360"
                     /old_locus_tag="Bsph_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418093.1"
                     /db_xref="GI:670469444"
                     /db_xref="GeneID:6023855"
                     /translation="MEITQFSMEEILDPTNIMEGKRYEFILDIEIDEEDELYHEAGIE
                     IRVLIGEKAEEPYILNYFIMEKAEGEYLDFALEDDELEEILVFCKEEIAKA"
     gene            700241..701386
                     /locus_tag="BSPH_RS03365"
                     /old_locus_tag="Bsph_0683"
                     /db_xref="GeneID:6023856"
     CDS             700241..701386
                     /locus_tag="BSPH_RS03365"
                     /old_locus_tag="Bsph_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292453.1"
                     /db_xref="GI:501249435"
                     /db_xref="GeneID:6023856"
                     /translation="MSTYTQSILIAFFITIILSFILFIPWLIYTYRKYSYLSMSKTII
                     MFSFIFYFLSALCLVLLPFPSTRDTCSLQSPDTVHTNLRLFQFIEDILKGSGVVLTSP
                     STWLVITKQQAFYQAFFNFLLLMPFGVYLRYFLQERRYWKRAFLLSFLLTLFYEITQR
                     TGIYGIFNCAYRIFDVDDLLLNSVGALLGFFLAPIVWALFPSHEEVEAKAAEMEKSDI
                     VKPISVLLALVIDLFIVQVIWFIIGTLTGYSGTFEFLVIIALYMAIFGFIPSLMNGAT
                     LGMKIMRFTMVNKKGKSIVRQSWKRCIAIVATVLLSEAITTVGNIQLDMDSPFYVLQI
                     LISLLASLGGFALTMIIAIHVIRVIVSGGKRRLYIDQYADLMATKKK"
     gene            701400..702734
                     /locus_tag="BSPH_RS03370"
                     /old_locus_tag="Bsph_0684"
                     /db_xref="GeneID:6023121"
     CDS             701400..702734
                     /locus_tag="BSPH_RS03370"
                     /old_locus_tag="Bsph_0684"
                     /EC_number="1.8.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_012292454.1"
                     /db_xref="GI:501249436"
                     /db_xref="GeneID:6023121"
                     /translation="MKYVIIGGDAAGMSAAMEIYRNVPGAEITTLERGFIYSYGQCGL
                     PYVVDGRISSTKRLIARDVETFRGKYGIDARVGYEVEKVDIENKVVSGIQASGEVFEI
                     SYDKLLIATGADPVVPVRSGVNLEGIHTVKTIPQLEDLMADLTPDIEQVTIIGGGYIG
                     LEMAETLQTCGKKVRLVQRGSHVAKILDEELAQHVHEEAKKNNVELLLNTDVEAFEGN
                     KRVERVITNNGILETDLVIVASGIRPNTKFLEGTGIAFAKNGAIIVNRHLETSVENVY
                     AAGDCATHFNIVKERIDYIPLGTTANKQGRLAGLNMSGKFAPFRGIVGTSILKFFNLT
                     IATTGINERHAKELGFDYEAFKLSARHIAGYYPGAQRMYIKVVVRKRDQLLLGAQIVG
                     PAGVDKRIDVFATALYSKMTLPDLLDLDLAYAPPFNGVWDPLQQVARMNGRL"
     gene            702752..703225
                     /locus_tag="BSPH_RS03375"
                     /old_locus_tag="Bsph_0685"
                     /db_xref="GeneID:6023122"
     CDS             702752..703225
                     /locus_tag="BSPH_RS03375"
                     /old_locus_tag="Bsph_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="WP_036160600.1"
                     /db_xref="GI:738204683"
                     /db_xref="GeneID:6023122"
                     /translation="MSIYDINVTLEDGTDYSLERYKGKPMLIVNTASKCGFTPQFEEL
                     EGLFEKYQDEGLVVLGFPSNQFKQELATAEEAASQCRLEYGVTFPMHKIVKVNGKEAH
                     PIFDYLTSHSKGFLGNSIKWNFTKFLVNRDGEVVGRYASADKPSSFEDDIKKVLA"
     gene            703399..704166
                     /locus_tag="BSPH_RS03380"
                     /old_locus_tag="Bsph_0686"
                     /db_xref="GeneID:6023123"
     CDS             703399..704166
                     /locus_tag="BSPH_RS03380"
                     /old_locus_tag="Bsph_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016993265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacitracin ABC transporter ATP-binding protein"
                     /protein_id="WP_012292456.1"
                     /db_xref="GI:501249438"
                     /db_xref="GeneID:6023123"
                     /translation="MTPLLKVQNVEKTYGKGANTFTALSNISFEVKKGEFVGVMGPSG
                     AGKSTLLNVLATIDTPTTGEIIIGDTNLARMKDAELADFRRDNLGFIFQDYNLLDSLT
                     VRENIVLPLAIAKMPTKAISARVDRIASLFGISDLLDKYPYQISGGQKQRTASSRALV
                     TEPKLIFADEPTGALDSKSATDLLESLSDLNQSQAATIMMVTHDAFAASFCQRILFIQ
                     DGQLSKEIHRGTLTRKQFFQEILQVLSSIGGGVNDVI"
     gene            704153..706021
                     /locus_tag="BSPH_RS03385"
                     /old_locus_tag="Bsph_0687"
                     /db_xref="GeneID:6023124"
     CDS             704153..706021
                     /locus_tag="BSPH_RS03385"
                     /old_locus_tag="Bsph_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012292457.1"
                     /db_xref="GI:501249439"
                     /db_xref="GeneID:6023124"
                     /translation="MTLFSLARKNIQRNLSNYFLYIASMVFSIVIYFTFVTLKYNDDL
                     SALKQSSQQIKGLMSASSVVLLFFIVIFMAYSNSFFMKKRKKEVALYSLLGVRKQKIG
                     LLLFFENLVIGLVSLVLGIVLGFFMSQGLLMILVRLMGYEIVGNLTFSIEALVNTTVI
                     FTVLFLFTSLQGYRVIYQFKLIDLFHAEKQGEQIPRASLVAAVLGTALIAFGYYTAAS
                     DMFTSEIWRFFTVLGTPLMVIGVTIVGTYLLFHSVSVFVLTALKRATSWSWKGLNLIG
                     VSQLLYRIRANAKSLSIIAILSATTITAGGGVFGMYYNAEATVRQMLPNTFMWKGDPV
                     DFSQKDVIYNESLSVKNLRVDNEFSFFEYTLLKESDYNRLAKLQGKDQNLHIADGSTV
                     LLDAAYDERFSHDFTGENFKLKNGDSFHVEKMYTESVLNFIPAGTVLVVNDQEFAATN
                     AEEIKMQAIGLDNDLKQQVVSQDIIKQLSTEQQESFSSVPQSYEDSIATVGALLFVGS
                     FLGLVFLAATGSIIYFKILTEAEEDQAKYAILNKIGVNSKQILKTVAGQVAVIFSAPL
                     IVGIVHSAFALLAFSQLFGMNITKPVILWMIAYSAIYFIYYIFTVRSFYKIVRQGN"
     gene            706023..706382
                     /locus_tag="BSPH_RS03390"
                     /old_locus_tag="Bsph_0688"
                     /db_xref="GeneID:6023125"
     CDS             706023..706382
                     /locus_tag="BSPH_RS03390"
                     /old_locus_tag="Bsph_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292458.1"
                     /db_xref="GI:501249440"
                     /db_xref="GeneID:6023125"
                     /translation="MKKVFFGIGALLILFVAGLVVLMTVDFNRLNKDTYYVHITADGE
                     VEEYKASNGEIFKMYWYELPAYNKNGKEKTLKFSAHKNLRHDAYLKLYVKKETEVTSY
                     DEVKFHEVPNKAQDQMK"
     gene            complement(706408..707796)
                     /locus_tag="BSPH_RS03395"
                     /old_locus_tag="Bsph_0689"
                     /db_xref="GeneID:6025342"
     CDS             complement(706408..707796)
                     /locus_tag="BSPH_RS03395"
                     /old_locus_tag="Bsph_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_031418102.1"
                     /db_xref="GI:670469453"
                     /db_xref="GeneID:6025342"
                     /translation="MKWKLTARFLFSVLSIVIIVIFVNTAILIGLLSYKLNNDSDRAT
                     ESKEEDFVRNFQQYIEIENGETSISAEGLEQLHMRNAWIQLLDVNGQVIDSHFAPEEA
                     PSHYAPVDLIQVYKYKEFDADTTVYVGVKDEISYLVGVKGSEVERLVMHISGTSFLQF
                     VGKFGLFIVIADLIVAALVGWLFGRTLTTPLYALIERIRHLKNHEHQPVKTPGGVYKT
                     VFENLNEVSRELAAHEQERKRLELMREEWISNVSHDMKTPLASIRGYAELLDDETLTS
                     QEKAEYAQIIEKQSLHMQNLLDDLNLTMRLRHQQLPLTLKEVNMVPFIREIVIDTLNT
                     PQFELANIDFEAISENHHQLIDEHFMRRAIINFLHNALLHNTPDVSVHVSVDKDSITI
                     ADNGKGISSEDLEHIFERYYRGTNTDNTAGTGLGTAIARDIIEAHGGFVTITSEKGKG
                     TIVSINLKKEQH"
     gene            complement(707793..708515)
                     /locus_tag="BSPH_RS03400"
                     /old_locus_tag="Bsph_0690"
                     /db_xref="GeneID:6025343"
     CDS             complement(707793..708515)
                     /locus_tag="BSPH_RS03400"
                     /old_locus_tag="Bsph_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004233885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012292460.1"
                     /db_xref="GI:501249442"
                     /db_xref="GeneID:6025343"
                     /translation="MQEPTILVVDDEADLANLLKVSLQKEGYKQIYTAGSIHDAWTSF
                     QQTSPDIVLLDVMLPDGEGYDLCRRIREISHVPVLFMSAKNEEIDKILGLAIGGDDYI
                     TKPFSPKEVAYRVKAQLRRVGYQTHETTSGMAEKTIQVGPFQLNADETEVHKDGILLE
                     LTAKEIGLMACFMHNPHRILSKETLFERVWGEDFFGSDNTVMVHIRRLREKIEQDASK
                     PIFITTVKGLGYKFVIPKEAQE"
     gene            708731..709345
                     /locus_tag="BSPH_RS03405"
                     /old_locus_tag="Bsph_0691"
                     /db_xref="GeneID:6025344"
     CDS             708731..709345
                     /locus_tag="BSPH_RS03405"
                     /old_locus_tag="Bsph_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418105.1"
                     /db_xref="GI:670469456"
                     /db_xref="GeneID:6025344"
                     /translation="MFKKIAADALGLSDIGVVVQREDYDKTDADDFILHEIDEKIYFL
                     IKTKADEYCFTNRAILHVDGESAMSKKRLLRRYDYSMFAITDVFLETAGTIDLDVEIK
                     FTIGNSPLSIDIHKRFIDDIKDLYKALHAISYEQKNNAYKLEVAEKSLHIASSSLGRI
                     GNDNISPSASFEAITRFANTWMIDHKDQYKKEDFSHIFDLYMNN"
     gene            709467..710822
                     /locus_tag="BSPH_RS03410"
                     /old_locus_tag="Bsph_0692"
                     /db_xref="GeneID:6025345"
     CDS             709467..710822
                     /locus_tag="BSPH_RS03410"
                     /old_locus_tag="Bsph_0692"
                     /EC_number="3.5.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetamidase"
                     /protein_id="WP_012292462.1"
                     /db_xref="GI:501249444"
                     /db_xref="GeneID:6025345"
                     /translation="MTNELHVLDKEGLESDFIQQPQAAETLFVNEFIDGILDPSQEML
                     GPVKDGGTIIANTTPGCWGPMLTPTIRGGHEVTKPVFVEGAEVGDAIVIKIKSIQVTS
                     MATSSGHDEPITDRFIGDPFVSVKCPGCGKLHPSTVVKGIGPQAIRCSTCDTDTAPFN
                     MTNGYTMAFDHKGHIGVTVGREGARRIALDAKNYMRTPENSIQNPVVALAPSDIVGVM
                     ARMRPFLGQLGTTPSKAMPDSHNAGDFGSFLIGAPHEYAFTQDELDLHRTDGHMDISR
                     VREGATIICPVKVPGGGIYIGDMHAMQGDGEIAGHTTDVAGIVQLQVHVLKKVALEGP
                     VLLPNEEDLPYTAKPFTKEEKRRARELAEEFGVKQIEEALPVSIVGTGKTLNEATDNA
                     IRRASKLFELPESEVLNRATITGSIEIGRHPGVVTATFQVPKTILKKVRIFKTVKKQY
                     D"
     gene            711015..711569
                     /locus_tag="BSPH_RS03415"
                     /old_locus_tag="Bsph_0693"
                     /db_xref="GeneID:6025346"
     CDS             711015..711569
                     /locus_tag="BSPH_RS03415"
                     /old_locus_tag="Bsph_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292463.1"
                     /db_xref="GI:501249445"
                     /db_xref="GeneID:6025346"
                     /translation="MSELVRIGNKIEKKNIVKPFLLKMKGGGHAPSRTNFADAFTGAV
                     GGLICIFVLLLLTNYTDAPWLMASLGGSCVLVFVVWNAPLSQPRNIIGGHLVSACIGL
                     TLYSTLGSNILSISLGVGLTIFFMALLGIIHPPAGANPIIIILGGYSWSYLILPVLIG
                     AVIIVFFGLLINNLRETRKYPQFW"
     gene            711755..713230
                     /locus_tag="BSPH_RS03420"
                     /old_locus_tag="Bsph_0694"
                     /db_xref="GeneID:6021942"
     CDS             711755..713230
                     /locus_tag="BSPH_RS03420"
                     /old_locus_tag="Bsph_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_036160603.1"
                     /db_xref="GI:738204686"
                     /db_xref="GeneID:6021942"
                     /translation="MLLDCDEQLFMTYKQSNVEGAENLLATWLEAEVDLQEDPKILGT
                     SLSPKLFLVNEEMAMNIAFSTARKYWGRASTDMQMYFDKYGLDAKFVNDRLNAFFYTQ
                     KGKETFFEQLFAQHTIDLERLIWLVFGKRMQMEMPVNELQTIMLYKFQDEYLVHMMYK
                     EHTPFWHWLFTKKVYSLFIHRPLEQFTFLYEIMGHFEHSMKMSCEHVDNFVNNYKLIL
                     DKCITHVDKNKSSCLAKKQLRLYQIVTHYCLSEGDYKRVKDFITSFEAEWRYSMYALT
                     EKEKVLIAYILFHIANREQQSEKVIYYGEYLLEDERLNNYAIEILLEYKDLLPNRKPT
                     PPAIIKNYQLNYLENLYAILLDHYVKATRYEDGLLLLKEHVLASNKKINTSLVQKNYS
                     SEQLIAIEAYVQQDIALQVNNSLQHIGLSVEEWRQNYRQPEVPYYIVAQSASWHMLNI
                     LRVLFVTEQFELFEKLMEIYKKYLLIDDHFENLRVFISAYV"
     gene            complement(713277..714461)
                     /locus_tag="BSPH_RS03425"
                     /old_locus_tag="Bsph_0695"
                     /db_xref="GeneID:6021943"
     CDS             complement(713277..714461)
                     /locus_tag="BSPH_RS03425"
                     /old_locus_tag="Bsph_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine dehydratase"
                     /protein_id="WP_031418107.1"
                     /db_xref="GI:670469459"
                     /db_xref="GeneID:6021943"
                     /translation="MGILKGLKILDFSALLPGPMATMIFADLGADVIHVESSKRVDLT
                     RIMPPYDDDHEAYIHQHLNRSKKSLTLNLKSSEAIEIVKSLVQEYDVIIEGFRPGVMQ
                     RLGIGYEALKEINPRVIYCAITGYGQTGPYSNRPGHDNNYLSLAGVLDYSRHKDKKPV
                     SMGIQLADIAGGTMHAAIGVLAAALHREKTGVGQFIDISMTDAVFSLNAMYGSAFIGG
                     GRVPQPEQEILNGGSYYDFYKTKDGRFFSVGSLEPQFRKLLCEALDIPELIDNTFNDS
                     YYTQIRFKEAVHDAFLSKTYEEWLEVFNEDFEGCVEPVLTFPEACEHPQLKAREMIVS
                     IPKGDGTLQQQIASPLKFDGSEPEYKHVGAKLGEHNEEILSSLGYGTEQIKALKDKGV
                     LE"
     gene            714948..716510
                     /locus_tag="BSPH_RS03430"
                     /old_locus_tag="Bsph_0696"
                     /db_xref="GeneID:6021944"
     CDS             714948..716510
                     /locus_tag="BSPH_RS03430"
                     /old_locus_tag="Bsph_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012292466.1"
                     /db_xref="GI:501249448"
                     /db_xref="GeneID:6021944"
                     /translation="MKSHQLKLKNLIMGVAMAAFFFTIIGSVWGGYRMNVDSIKENTL
                     ETNHVYAQKLASTADAYLHEAFQILSYSANQVSENLGDEQILNRETDRLRLQNEMFNS
                     VVITNAEGLVLSVSPPSIEIKGEVLTSLGAQEALAKKIPLVSKPYEAMTGRLIIFISH
                     PIFSASNEYLGMVAGTIYLKEPNAFKTLLGEHYSKDGSYVYVVDSDGRVIYHQDPSRI
                     NDVVTKNKVVQAVMSGKSGVQIVDNTKGVKMLAGFSSVSSTGWGVVAQKPLEVALAPS
                     FDRVQEVIIKSVPLMIVSVVIVLWAAARIANPLQQLAMLTEESLDKKNVEGLKSVSGW
                     YFEAHSLKYVLIRSLSFLHGQVTFFKDQSTVDPLTGVTNRRTMDAMLAEWFENRVPHA
                     IILLDLDHFKSVNDTYGHAVGDKVLQFLAKHMQSVAREGDVCCRYGGEEFVMLLPNTT
                     VIEAEQVAEQLRGNLAETDSPCGRPVTLSAGIALYPEMAATPETLIEAADGALYEAKQ
                     AGRNQVKVAVKK"
     gene            716961..>720479
                     /locus_tag="BSPH_RS03435"
                     /old_locus_tag="Bsph_0698"
                     /db_xref="GeneID:6021946"
     CDS             716961..>720479
                     /locus_tag="BSPH_RS03435"
                     /old_locus_tag="Bsph_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292468.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="WP_036162541.1"
                     /db_xref="GI:738206628"
                     /db_xref="GeneID:6021946"
                     /translation="MDKSKIQKVNKALIATVFASSGIAVVVPSPQKAAAATSPFTDID
                     QYSVHYNDILKLYSQGVINGFADNTFRPDVNVTRGQAAKMLATALKLDTRNVQDPYYK
                     DVPKGSEFYKSVAALQNAGIMSGYSNGTFMPNEVMTRGELAKILVLAFHLEVSPSYNN
                     IFKDVDSKSSNAIYIQTLIDLNITEGTTPVTFSPFDPVNRGQFASFVVRSQEKKNNET
                     SYKITSVDDDAVYINGKAYTVSENLSHIFNDYNAPVLKGAYIEGNLSSKKILSISKLT
                     INASGTSKDFLDFDGDHGSLGATIEVNGNYIEFNNLKMTGTMFVNETVRPPLHLGAIN
                     NQPLSIGRVASNNISFINWSDPDNSKGDDSSINNSTNDLQNWTNQNPDKDKPFVNWSN
                     EKQEMKNVEKHLEFYNSTVSRLVVSQTGTKIESNMKLPRVDIIGSVREFEIQGYIGTL
                     NLNTETPLTIYGSGNIDWINYNSRTDLELYIYGRIGTLFVDNVYGKIDIGDYTYIDKV
                     ILPKDGSPNNIFDDFLDDKDNIGNITDPDGKPIDKDENENQNPDDKTKPIVSITNVKV
                     LNGSEIQADFTSDEVGTYYYIVREKGAEAPNKREMVNHLSNENIAYGSGAAVKGTNSV
                     KVSNLGEKKEYVIYIMVVDGSKNASDIVSQSFQMKDATPPVVKSLQVTPLHGGTRAEF
                     KFAASEPGDYYYYVRKKTTAADPTTADIVANPTGKGKAKAGELGITEILTGLDAETDY
                     QLYVVMKDDSGNYSVDPAVVKDFKTSELDNVPPYVVGGQLVLLDEIKNEFYITVSEEL
                     DPISAEKVENYDLSGTGIVNQGAQLPIHPTKVVYNKAQKRLIFTIPSLTGFVNGDNLV
                     VTISPNVKDLADIEFENINNIPINTVPRNTAEYIHNDIELPVLTIIGEPAINNAKDQT
                     LLEFNASKAGTYHYLIMESDLTLTRDDRLRLIEAVQLNETTFKVGTQDVAIVGSGGNK
                     PAQLGKQKVTIPLPNTFPPLDPFKSYSIYMVLRDRSGNVSDIQTKHVIDDRTAPKIEN
                     TSIKIAEGDKKATFKFMSDEAGTYYYILRKAGDTTVPVPASAEEVIERGRASAMRKDT
                     NEINLSPLEPHENYELYVAVKDRYNNSTMVQVGTESTIYTHDEKQNKPISLTPSLNNT
                     GIMAYKFFSDGTPPKVEDPIVKQLDGK"
     gene            complement(721594..722391)
                     /locus_tag="BSPH_RS03440"
                     /old_locus_tag="Bsph_0699"
                     /db_xref="GeneID:6023395"
     CDS             complement(721594..722391)
                     /locus_tag="BSPH_RS03440"
                     /old_locus_tag="Bsph_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012292469.1"
                     /db_xref="GI:501249451"
                     /db_xref="GeneID:6023395"
                     /translation="MTAKIKKPYITETNFEYAMTSYKQDYRILIANPTDAPPVDGYAV
                     IYALDGDALFPTLAEAVKLQTRKPKGYEPILVIGIGYPSKEPFDMERRCNDFTLPVSE
                     GKLPPRPDGTPWPPNGKANDFLDFIEYELMPAVEKEWSINKKKQAVVGHSLGGLFTLY
                     ALCERPHLFSHIVASSPSIWWADNAILKEMDRFFGDWNGQHAINLLLTIGANELPDML
                     EGADLAAERMKPLRVKNIYTNYVKFDDEDHVSVLPCMLSRLPRFLDG"
     gene            complement(722388..723380)
                     /locus_tag="BSPH_RS03445"
                     /old_locus_tag="Bsph_0700"
                     /db_xref="GeneID:6023396"
     CDS             complement(722388..723380)
                     /locus_tag="BSPH_RS03445"
                     /old_locus_tag="Bsph_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012292470.1"
                     /db_xref="GI:501249452"
                     /db_xref="GeneID:6023396"
                     /translation="MTHNGRNQTIIKSVYILATFMLAIGLLSACNAQSSSNEKKVDTQ
                     ANPDNIKEQSAYPLTIKDEVGNDVTLPAKPSKIFAPVLEDSLLALGIKPTMQWSNGVK
                     PQLYLQKQLQGVPEISFASGPPSPEAIMADKPDLIVLHNSFYVENGTYEKYAKVAPTY
                     VFKNAATDIEGSIKMLGQLLDEPHKAQHAIQNYQEKVDAAKSKLASTTKGKKVALIRF
                     NAKGMFFMTDEYFSGYVLTHELGFEQSSYVKNGAFEVSLEILPELDADYIFLINDGNL
                     GDSFINELKNSPIWQSTNAFKNNQVFETSEDYWLNGGIHAQEKVIDDVLEFLAP"
     gene            complement(723426..724613)
                     /locus_tag="BSPH_RS03450"
                     /old_locus_tag="Bsph_0701"
                     /db_xref="GeneID:6023397"
     CDS             complement(723426..724613)
                     /locus_tag="BSPH_RS03450"
                     /old_locus_tag="Bsph_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-hydroxamate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012292471.1"
                     /db_xref="GI:501249453"
                     /db_xref="GeneID:6023397"
                     /translation="MKTENMTDKKTTQISLKDIRDYIAKNHHQPLTIKHLAIISGLSS
                     SYFGEAFKKAFGQSATDYLTELRIGHAKQLLRDTDLLLREIAREVGYSDEFYFSRKFK
                     KEVGVSPSAFSKIARQRISTFSVSTIGNLLALDIIPVAAPLNAKWSPYYYNHYQDQIQ
                     VHVNIFDAESEDNFRKLASAKPDIHIFQEEPSLSMLDWLQTVGIKSVYIEAKDWRTQL
                     REIAVAVKRQSVCEHFIQSYEQKALEAKQEIKRVTKEDSFAVLRLCGDQLFLYCNKGI
                     QDVLFTDLQLFPIDAQQQTCNEPITLDQLGDINPDRLLFIVCPDSPTRNYWLTLQYLD
                     RWKELQAIKNGYVYVLPSNPWFEYSAIAVNRMLDEMLLMLTGKNPSSFPVPVHGIVSD
                     SEL"
     gene            complement(724640..726268)
                     /locus_tag="BSPH_RS03455"
                     /old_locus_tag="Bsph_0702"
                     /db_xref="GeneID:6023398"
     CDS             complement(724640..726268)
                     /locus_tag="BSPH_RS03455"
                     /old_locus_tag="Bsph_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component"
                     /protein_id="WP_012292472.1"
                     /db_xref="GI:501249454"
                     /db_xref="GeneID:6023398"
                     /translation="MEDNHSFRHNLLFHLEDIDCISQSYPFICPSHHTMILFTDGCGT
                     LTIDDIPYLVTKGKIFLIQPHSMIDLSNLTNEFCFYKITFSAFQLQQELPSPYLGPIF
                     SDEVEHTVYPNTRFIRLTEDMYQLKTKSDYFKQQGALYELLNLLFEHQLHNNAPLTMT
                     KAVEETINYIHKYFQRPLTVKMLAELAHIAQWQYSSIFQTLTGKKPLDYITDLRLTNA
                     KELLLQTNVPLKEIAQRVGFDNEYYFNRRFRQVIGIPPKQFARQYRQRTVVKDWTGHE
                     VTIPSAPHRIIYHGETFGDMLIFDVQPIGGDKRSISKSFYKNHVPYIQDVAFPINLEK
                     SSKLNPDLIIFTNNDEQQYQALSSIAPTITLNSWDSLEERILLLGQWLSQQQRAEDWL
                     TRYKVQEKTMWQQLQTVVAPGETATVLTFDHGQRLYVMGCTGLSPALFHPDGFTPHQQ
                     VKKLLQAGKGYKEILIDHLPKYVGDRIFLLLSDKPESQMATMELMNSDIWKNLKAVQN
                     NHFYLVDATKWNYNDAFTREKLLGALPRLLITAK"
     gene            complement(726366..727322)
                     /locus_tag="BSPH_RS03460"
                     /old_locus_tag="Bsph_0703"
                     /note="ferrichrome-binding protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:6023399"
     gene            727907..728494
                     /locus_tag="BSPH_RS03465"
                     /old_locus_tag="Bsph_0705"
                     /db_xref="GeneID:6023542"
     CDS             727907..728494
                     /locus_tag="BSPH_RS03465"
                     /old_locus_tag="Bsph_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001066470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292475.1"
                     /db_xref="GI:501249457"
                     /db_xref="GeneID:6023542"
                     /translation="MFKRIILPFLILLSVVTAVFTMDSKTATAEEVVDLEEVVNSEEV
                     VVDSEEVINSEENVEVDSEEVTPYFVNDFRYRKVNVKTYNEWSDYKRASDNITTGKGG
                     GSITATKSVTFGTDVSGAIDGLGISTSKSITSSIGYTLNADPNKTVYMGYRVYYKVET
                     GTREYYDLVTGKVLKSNSYTVKVPQHGEFKLITAK"
     gene            complement(728528..728746)
                     /locus_tag="BSPH_RS03470"
                     /db_xref="GeneID:23319662"
     CDS             complement(728528..728746)
                     /locus_tag="BSPH_RS03470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017812739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_031418118.1"
                     /db_xref="GI:670469470"
                     /db_xref="GeneID:23319662"
                     /translation="MMDNKYKLLGLLCIIIPILSAIYILLNSNILIPKGYNLAIDGYV
                     ISRNLMVIFLLYLLSKLGYFLSTKLKQD"
     gene            complement(729193..730149)
                     /locus_tag="BSPH_RS03475"
                     /old_locus_tag="Bsph_0706"
                     /db_xref="GeneID:6023543"
     CDS             complement(729193..730149)
                     /locus_tag="BSPH_RS03475"
                     /old_locus_tag="Bsph_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012292476.1"
                     /db_xref="GI:501249458"
                     /db_xref="GeneID:6023543"
                     /translation="MIDFSKKNSIFTGILIFSILLTACGYQSVPSADKANVDYSNRVL
                     TDSLGNEVTVSESPQRIIAPYLEDHLVALGIKPVAQWSVKGGASIQDYLQESLKDVPT
                     IGFDLPFEAVTSFNPDLIVIGSSKIAEGRKYEQYRKIAPTYVMGAEDNNWRNKLLKVG
                     EIFNQVDKAKEVLTDYDQFAKEAKEDIHNKVGNPSATVIWNTNNTIYMVSDTASSGIV
                     LYEDLGLKTPSLVKEISASAAGDWSQVSLEKFVQIDADYLFVINNNRAGSSTLLNDPL
                     LANIPAIKNGHVYEFDQSSSWLYSGAIANRQIIENVLDSIAK"
     gene            730248..731813
                     /locus_tag="BSPH_RS03480"
                     /old_locus_tag="Bsph_0707"
                     /db_xref="GeneID:6023544"
     CDS             730248..731813
                     /locus_tag="BSPH_RS03480"
                     /old_locus_tag="Bsph_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-hydroxamate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012292477.1"
                     /db_xref="GI:501249459"
                     /db_xref="GeneID:6023544"
                     /translation="MYKDNEVLCQFFYQPIQIVKLEELLCDKRGRLAYPLIIVVYEGH
                     AIYTLQGRQLQLSSNSIMFVDDVDDFQLLKANECTGVVIIYRAYGPNIINLLQDTTLM
                     EHCSYRLMNLVKEIEREAKITVESNPFRLQKLFSEMLEELYNHLCIHKQQEGLWIDRV
                     LDYMNLNFNEDLTREQMAEKAQVSPEHFSRTFHRYTGYTYSEYLTLLRIRESQKKLLL
                     GMPKLDDLAQVVGYREGTYLSRKFKEIVGVSPTVYYQKSKRLIVLNANHTACLLALGI
                     TPVLGVYSPFLEDIKSVPSSQKLKGYEYDITSNYQEIAVARPDVIINYSSGKEKQTLL
                     SLAPVFELPCRQLSWREQFELIANLVDRREVYNNWLQQYDAQVAQCNQLLDQQLGARG
                     TAIVWEIGSQAAYCINSSHGRGSHILYEDLGFSRPDEIVTHNIEKTGYLTVNIEEIVH
                     FPADYIFVTALPTKDFGKEWLLTALHSEKWQSLVAVQKKQVYFINQYELFYGYDPLST
                     TAQLQKLMEVLTS"
     gene            731914..732852
                     /locus_tag="BSPH_RS03485"
                     /old_locus_tag="Bsph_0708"
                     /db_xref="GeneID:6023545"
     CDS             731914..732852
                     /locus_tag="BSPH_RS03485"
                     /old_locus_tag="Bsph_0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012292478.1"
                     /db_xref="GI:501249460"
                     /db_xref="GeneID:6023545"
                     /translation="MLKQNRKFITPLFLLLLLLLTACGEKEKTDSPATEQDEAETKTV
                     QTTNGEIVIPTNPQRIVAEEYIASLLVLDVKPVGAPGLALENYYLKEALKSVEDIGVY
                     GKPSSERILGLKPDLIITGNGENYDALSKIAPTVVIPYGELKNAHEELTFFGELLGKE
                     REAKDWLSQYDQKIADAKSQVDAIIPEDASFSIMEDAGKSIYVYGDNFGRGGQPVYQS
                     FGRKPPANVAEEIIQKQWAEISEEVLADYAGDYIILTSNDRTVEDFKKDPIWGSLPAV
                     KNNHLYVWPEERSWYYDPTAVLAQVEELTNWLTNKR"
     gene            complement(733366..734664)
                     /locus_tag="BSPH_RS03490"
                     /old_locus_tag="Bsph_0709"
                     /db_xref="GeneID:6023947"
     CDS             complement(733366..734664)
                     /locus_tag="BSPH_RS03490"
                     /old_locus_tag="Bsph_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012292479.1"
                     /db_xref="GI:501249461"
                     /db_xref="GeneID:6023947"
                     /translation="MKNKKKLALLSLVAVPSLLYSSPAPASAANVSGQPSMAYIYSTS
                     YYNSNVSNVVQLINNINYTTSTFQANLEAALKAYNALTELEKQYVTNYSTLSAHQQTR
                     ISYRKLAAQIEEKLYSVESTAVNYYQNVMETRDWYNTLNAAQKTFVSAAAQKILTSYI
                     APNTSVDKVVNKIQLINSSRPTFHKDVADARAELYALRRFSYVSLPTGVEQLLLDAEQ
                     LVLKDKAAAKAVESAITALSPKTSTPQDVQEVKTAFEALTPVQQQLVPNVWTLVDFVQ
                     GKYTLPSKGNVPKIPVLSDTVAIPGKTTAMTKSKNIYKTKINVSDSEIDTERFILTTK
                     DKITIIIPPLYTLVNEDEGVIDIQVTKRGDRITLQATLNKKQVTFDANMEIIIEGLSA
                     NSSINHLNDFGKQVPANYIVSGNRHIIQTMAPGTFQIIRN"
     gene            735122..736276
                     /locus_tag="BSPH_RS03495"
                     /old_locus_tag="Bsph_0711"
                     /db_xref="GeneID:6023949"
     CDS             735122..736276
                     /locus_tag="BSPH_RS03495"
                     /old_locus_tag="Bsph_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_012292481.1"
                     /db_xref="GI:501249463"
                     /db_xref="GeneID:6023949"
                     /translation="MRIVLVDDEYLSLKRLKTLLEESHVPGIEIVGEYTDSLKVIEEI
                     QNLQPSVVFLDIVMPDMDGLALGEKIQELLPDVEIVFTTGFDQYALDAFNLHAVDYLL
                     KPIQITRLEKTLDRLEQINNKHKKRVVNSTIISLFGGLQVISPDGHTQILKWRTSKAK
                     ELFAYLLNHRDEIIYRDTILELFWPESDRDKASKQLYTAVYTIRQTLKNYGLDGVQIS
                     SPLLNSGYKLLLEQTIVDVEQWLSSLKSLPTLEQENVEEHEQVFQMYTGDYLEDCDYL
                     WAESERERLRRLWLHHAHQLSEFYIKIENYSAAIKVQETVQALFAGEEENYFTLMKLY
                     DLLNNVAAVEEQYLLLKKALQEHFAVEPSEEIENWYKRWKKTKTLTHMNV"
     gene            complement(<736619..738223)
                     /locus_tag="BSPH_RS03500"
                     /old_locus_tag="Bsph_0712"
                     /db_xref="GeneID:6023950"
     CDS             complement(<736619..738223)
                     /locus_tag="BSPH_RS03500"
                     /old_locus_tag="Bsph_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292482.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="WP_036162542.1"
                     /db_xref="GI:738206629"
                     /db_xref="GeneID:6023950"
                     /translation="MTNKALSTLIATAITATLVLPVSTAQASFSLNQSNLYETQVQVA
                     ATKKMVGNAVTIKNITNDTVITSNGTFRIHKDLKPLFDHSNKTALTNALATIVVKNKQ
                     IIDVTSLTLNKAGTSKKSVYFDGGHTHISGDFTVNADYVNIQDVTVDGQLIITNRVKK
                     AITLDDVSVSDTITLKPLIIKKNDWLYVTLRDMKSSTINLARTKVNISSDQALSKIDI
                     IGKVPTFELKANVEKLTINVEENFNLFGEGKIEQIIVKDGTKVALNSGHQVGKVQVDN
                     KKVSVTLPAIDKKELTTLLASPPYVQVSINGYDILTTDKWTTQVDRNIFDSAVTSARA
                     IANNNSASQEQVKNAISQYRNALAVYQNAQKSGTKYGYGYNYGDKATLQSLINSIQYV
                     TVSWGSDVYHNNPWTTQAERNAIDSAVSAAQAVVNNYYATQTDIASAINNLNNAIWTY
                     KNAYKYNNNYYYGNKYNLQTLVNQAKSIYVTVSEDGADLSSNTNWTTYMEWYIFDSAV
                     SYAETFLSNNYFSDYEVTYVINYLNNA"
     gene            738478..740577
                     /locus_tag="BSPH_RS03505"
                     /old_locus_tag="Bsph_0713"
                     /db_xref="GeneID:6023951"
     CDS             738478..740577
                     /locus_tag="BSPH_RS03505"
                     /old_locus_tag="Bsph_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_036160608.1"
                     /db_xref="GI:738204691"
                     /db_xref="GeneID:6023951"
                     /translation="MKKSRGIALKLSSLIIGLFLVLFLSYTVTTGIIIKKQSVEDAEY
                     GTLQTAESSAAIMSERFKKANTTLQTTKRIVESMEKNKTLSTKGILDIMENNLASNDD
                     LLGVGAIFEENSLIVNPNEAILVDSQKRFGPYLSKNDNEITTTLIEGLDDKNVSQWYW
                     VPKEEGRTVLTEPYDYSVNGQTVLMTTISVPLVNASGKFFGVLTADVSIDYLNELTKS
                     VAPEGGYAAIITNNGVLTANSFGKELDGQNMQDDPAWTSIRKTMENGELTSMYIDSNE
                     LKDKAYNVFAPMILEDIDETWTVQIVLAESKILETYNHVFVYTIIASIIMVALMTAAS
                     VLFIYKQLKPLKFLRSSIETAAGGDLTQKVEEKYIKQDEIGAVALAYNNMLDKTNSAI
                     KAVLNSTTLLNQSSNQVHEAFNEIVSSSQEVSVAINEIAQGASKQSEDTEETNYRMMD
                     LSDQIDAITALSNEMDELSLKTNVTTEKGMQEVQSLHEHNIGTNEMNGRIQQQMELLA
                     SNIANINQIIGSIQSITEQTNLLALNASIEAARAGEHGKGFAIVAEEVRKLAEQSKNE
                     TEVIKSTVESILENSQQTVAVIASNAELMQSQNESVQSTQLAFKDNSDLSRAIATSIS
                     ELMTQLSTMLEHKNQAIMSIQSISAISEETAASAEQVSASAMDQQAELQKVAESMQNM
                     NDISNELQEVVNRFKLA"
     gene            741006..741935
                     /locus_tag="BSPH_RS03510"
                     /old_locus_tag="Bsph_0714"
                     /db_xref="GeneID:6024516"
     CDS             741006..741935
                     /locus_tag="BSPH_RS03510"
                     /old_locus_tag="Bsph_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012292484.1"
                     /db_xref="GI:501249466"
                     /db_xref="GeneID:6024516"
                     /translation="MVYLGMIFFQIVAPILVLLVLGAILQKKFRFNLKALSQLITYCF
                     MPAAVFINLYETSIKLSVLGEVGLFIVLFIGSQMLLSHFLAKGLGLAKTEAAVFKNSV
                     VLINSGNYGIPVAQMIFASQPIGVAIQVILVIFQNMTTYTYGLYNLISSTKSGLTILK
                     DFIKMPIIHALIIGVAMNYFDIGIPPFIKIPIDHVADGFIAVALITLGAQLSQMEIKT
                     MFNKTVFVSCLTRLIIGPAVALVIIFALGLNGVVAQSLFIASAFPTSRNSSSLALEYD
                     IESATAAQTVLFSTIVSCITVTIVIYIADVLFT"
     gene            742265..744043
                     /locus_tag="BSPH_RS03515"
                     /old_locus_tag="Bsph_0715"
                     /db_xref="GeneID:6024517"
     CDS             742265..744043
                     /locus_tag="BSPH_RS03515"
                     /old_locus_tag="Bsph_0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012292485.1"
                     /note="catalyzes the formation of
                     4-amino-2-methyl-5-phosphomethylpyrimidine from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole and
                     S-adenosyl-L-methionine in thiamine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase"
                     /protein_id="WP_012292485.1"
                     /db_xref="GI:501249467"
                     /db_xref="GeneID:6024517"
                     /translation="MSAISEKNIMIMSNFEGSKKVYVEGSRPDILVPMREITLS